Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML115C (VAN1)8.842ON53553527620.0
Suva_13.288.842ON53053424960.0
Smik_13.198.842ON53652323730.0
Skud_13.268.842ON53952523510.0
KNAG0G034208.842ON51143118410.0
KAFR0A028308.842ON50740218330.0
NCAS0B003008.842ON52353718240.0
NDAI0E002908.842ON52254018030.0
ZYRO0G14234g8.842ON50949017900.0
TDEL0B005608.842ON50953117600.0
SAKL0D01430g8.842ON44742617360.0
Kpol_541.158.842ON49840217340.0
TBLA0B032708.842ON52040316700.0
KLTH0C03828g8.842ON40440316430.0
KLLA0D01529g8.842ON50151116150.0
CAGL0B02321g8.842ON51240016100.0
Ecym_46138.842ON52448715850.0
ABL124W8.842ON48540515610.0
TPHA0C047808.842ON52552015410.0
Kwal_27.102468.842ON33933814290.0
Ecym_35731.479ON44736410401e-137
SAKL0D11792g1.479ON48336410291e-134
KLTH0C03432g1.479ON48936510241e-134
NCAS0G041101.479ON49436410251e-134
CAGL0L01331g1.479ON44736410201e-133
KAFR0I027701.479ON45536510191e-133
TBLA0B021701.479ON57236410261e-133
Kwal_27.101571.479ON47636410161e-132
KNAG0I003001.479ON45736610131e-132
NDAI0G003401.479ON50435310151e-132
NDAI0B012501.479ON44636110051e-131
YEL036C (ANP1)1.479ON50035410081e-131
Smik_5.571.479ON49135310061e-131
Kpol_370.51.479ON64535310131e-130
AFR357W1.479ON4343659941e-130
Skud_5.541.479ON4913539991e-130
Suva_5.331.479ON49535310001e-130
KLLA0E22155g1.479ON4503659951e-130
TDEL0C026001.479ON4623629801e-127
TPHA0O004301.479ON5483539871e-127
ZYRO0F05170g1.479ON6083559741e-124
KLTH0E11616g8.500ON3943745136e-59
TPHA0L013708.500ON3923835111e-58
KLLA0E12849g8.500ON3923495092e-58
ZYRO0F08492g8.500ON3963674943e-56
Suva_16.2658.500ON3953704892e-55
Smik_16.1868.500ON3953704857e-55
KNAG0A021508.500ON3963704832e-54
YPL050C (MNN9)8.500ON3953704813e-54
TDEL0B013708.500ON3963834804e-54
SAKL0H11110g8.500ON3933704794e-54
NCAS0C023308.500ON3933704795e-54
TBLA0H033408.500ON3933834786e-54
Skud_16.2328.500ON3953704752e-53
CAGL0L12804g8.500ON3933514742e-53
Kpol_1031.788.500ON3923694734e-53
NDAI0E030208.500ON3963804692e-52
Kwal_27.118648.500ON4533624625e-51
KAFR0H013908.500ON3983824587e-51
Ecym_25508.500ON3903454462e-49
AGL259C8.500ON3893484375e-48
NCAS0B024408.500ON4003644193e-45
NDAI0C052508.500ON4023414035e-43
KNAG0A039908.500ON3571752421e-21
SAKL0H20438gsingletonON5652101769e-13
KLTH0G10626g2.296ON30359810.25
Kpol_1003.452.296ON28059780.46
TPHA0C034702.296ON26457751.1
Suva_14.3142.296ON28162741.6
YNL032W (SIW14)2.296ON28157732.1
Smik_14.2982.296ON28157732.2
TBLA0B054602.503ON27485732.2
ZYRO0G12540g3.295ON95087742.4
Kwal_55.206524.26ON69467723.3
NDAI0G007702.296ON33957713.9
Agos_YGOB_Anc_6.3476.347ON469138705.9
NCAS0G036902.296ON34960696.4
Suva_10.4164.136ON145479707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML115C
         (535 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...  1068   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   966   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   918   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   910   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   713   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   710   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   707   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   699   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   694   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   682   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   673   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   672   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   647   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   637   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   626   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   624   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   615   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   605   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   598   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   555   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   405   e-137
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   400   e-134
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   399   e-134
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    399   e-134
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   397   e-133
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   397   e-133
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   399   e-133
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   395   e-132
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   394   e-132
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   395   e-132
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   391   e-131
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   392   e-131
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   392   e-131
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   394   e-130
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   387   e-130
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   389   e-130
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   389   e-130
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   387   e-130
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   382   e-127
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   384   e-127
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   379   e-124
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   202   6e-59
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   201   1e-58
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   200   2e-58
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   194   3e-56
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   192   2e-55
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   191   7e-55
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   190   2e-54
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   189   3e-54
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   189   4e-54
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   189   4e-54
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   189   5e-54
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   188   6e-54
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   187   2e-53
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   187   2e-53
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   186   4e-53
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   185   2e-52
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   182   5e-51
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   181   7e-51
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   176   2e-49
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   172   5e-48
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   166   3e-45
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   159   5e-43
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    98   1e-21
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    72   9e-13
KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar...    36   0.25 
Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON} (10663...    35   0.46 
TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.29...    33   1.1  
Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W...    33   1.6  
YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyros...    33   2.1  
Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W...    33   2.2  
TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {...    33   2.2  
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    33   2.4  
Kwal_55.20652 s55 complement(505826..507910) [2085 bp, 694 aa] {...    32   3.3  
NDAI0G00770 Chr7 complement(162781..163800) [1020 bp, 339 aa] {O...    32   3.9  
Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, ...    32   5.9  
NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296     31   6.4  
Suva_10.416 Chr10 (733026..737390) [4365 bp, 1454 aa] {ON} YLR32...    32   7.5  

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/535 (96%), Positives = 517/535 (96%)

Query: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60
           MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF
Sbjct: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60

Query: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIXXXXXXXX 120
           QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTI        
Sbjct: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYY 120

Query: 121 XXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180
                     VISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF
Sbjct: 121 DYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300
           ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY
Sbjct: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420
           DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD
Sbjct: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQSE 535
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQSE
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQSE 535

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/534 (87%), Positives = 485/534 (90%), Gaps = 4/534 (0%)

Query: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60
           MG+F NLRSNIK+KAMDNGLSLPISRNGSSNN KDKRS H S SLKGKY YQPRS+ SKF
Sbjct: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60

Query: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIXXXXXXXX 120
           QL V++ SL+II VLSLYL I FLS M +G+S QNG  LLGS    ENYKTI        
Sbjct: 61  QLAVNVISLVIIIVLSLYLMILFLSEMKLGISIQNGNPLLGS----ENYKTIDLEDEEYY 116

Query: 121 XXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180
                     V+SKFDDGVQHYLI+QFGSEVLTP D+EKYQ E++ML DSTVE+YDL+NF
Sbjct: 117 NYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNF 176

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 177 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 236

Query: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300
           ALIAYSR LQNGTLS+IFQEIDAVIDSQTKGTDKLYLKYMDE YINRVHQAFSPPFH+NY
Sbjct: 237 ALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356

Query: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420
           DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFL +EQPYDLNSWMES EAL LAKTLD
Sbjct: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDA GDPNE VDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQS 534
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA+REREKRRQS
Sbjct: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS 530

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/523 (86%), Positives = 476/523 (91%)

Query: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60
           MG+F NLRSN K+K++DNGLSLPISRNGSSN+IKDKR+ HNS S K KY YQPRS  SKF
Sbjct: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60

Query: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIXXXXXXXX 120
           Q+TV+  SLIII +LSLYL ISFL+GM IGV  QNGR LLGSSKSS+NYKTI        
Sbjct: 61  QMTVNAISLIIITILSLYLSISFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIDLEDEEYY 120

Query: 121 XXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180
                     V+SKFD+GV+HYLISQFGS+VLTPKDDEKYQ EL+ML DSTVE+YDLS F
Sbjct: 121 DYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGA NG+ETRDHILLC+PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE DTTLD
Sbjct: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240

Query: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300
           ALIAYSR LQNGTLSQIFQEIDAVIDSQTKGTDKLYL+YMD+ YINRV QAFSPPFHENY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420
           DADVELCPGS+IQDLMSKNYDVIVPNVWRPLPTFL +EQPYDLNSWMES+E L LAKTLD
Sbjct: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNE +DLDGVGGVSILAKAK+FRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/525 (85%), Positives = 480/525 (91%)

Query: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60
           MG+F NLRS+IK+KAMDNGL LPISRNGSSNNIK+KRS+H+  SLKGKYRYQ RST SK 
Sbjct: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKL 60

Query: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIXXXXXXXX 120
           QL+VS  S+III VLSLYL IS L+G+ + VS ++G+SLL  S+SSENYKTI        
Sbjct: 61  QLSVSFISIIIITVLSLYLLISRLAGLNVNVSLRDGKSLLSPSESSENYKTIDLEDEEYY 120

Query: 121 XXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180
                     VISKFD G QHYLISQFGSEVL P+++E+YQ+ELNML DSTVE+YDLS+F
Sbjct: 121 NYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300
           ALIAYSR LQNGTLSQIFQ+IDA+IDSQTKGTDKLYLKYMDE YINRVHQAFSPPFH+NY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420
           DADVELCPGSVI+DLMSKNYDV+VPNVWRPLPTFL +EQ YDLNSWMES+EAL LAKTLD
Sbjct: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEG+PNE VDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAS 525
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA+
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT 525

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/431 (75%), Positives = 378/431 (87%), Gaps = 3/431 (0%)

Query: 106 SENYKTIXXXXXXXXXXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELN 165
           + NYKT+                  VI KFD GVQHYLIS+FG++VLTPKD E+Y+ E+ 
Sbjct: 81  NHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVK 140

Query: 166 MLFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDL 225
            LFDSTV+ YDL+ F G+P+G   RDH+L+C+PLR+A +VLPLMFKHLMNLTYPHELID+
Sbjct: 141 QLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDV 200

Query: 226 AFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVID---SQTKGTDKLYLKYMDE 282
           AFLVSDCS+ D TL+ALIAYSR LQNGTLSQIF E+DAV D   ++ +  +KLYLKYM +
Sbjct: 201 AFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQ 260

Query: 283 GYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 342
            Y+N+V +AF+PP+HENYDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+R
Sbjct: 261 EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR 320

Query: 343 NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYD 402
           NWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+M+K+YDV+VPNVWRPLP FL  EQPYD
Sbjct: 321 NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD 380

Query: 403 LNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVS 462
           LNSWMES EAL LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD EGDP+E VDLDGVGGVS
Sbjct: 381 LNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440

Query: 463 ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE 522
           ILA+AK+FRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+E
Sbjct: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE 500

Query: 523 IASREREKRRQ 533
           IA++EREKRR+
Sbjct: 501 IANKEREKRRE 511

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/402 (80%), Positives = 364/402 (90%)

Query: 131 VISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETR 190
           VI KFD G QHYLISQFG++VLTP+D E Y+RE+NML+DST+E YDL +F G PNG E R
Sbjct: 106 VIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENR 165

Query: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQ 250
           DH+LLCIPLR+A+ VLPLMF+HLMNLTYPHELIDLAFLVSDCSE D TLDALI +S++LQ
Sbjct: 166 DHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQ 225

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIF 310
           NGTLSQ+  EIDA    +T     L+LKYMD  Y+ RV +AFSPPFHE+YDKPFRSVQIF
Sbjct: 226 NGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIF 285

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           +K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCPGS
Sbjct: 286 EKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGS 345

Query: 371 VIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYA 430
           VI+DLM+K+YDVIVPNVWRPLP FL  EQPYDLNSW ES EAL LA+TLDEDDVIVEGYA
Sbjct: 346 VIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYA 405

Query: 431 EYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHLAYIRD +G+P+E VD+DGVGGVSILAKAK+FR+GVQFPAFTFENHAETEAF
Sbjct: 406 EYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAF 465

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532
           GKMAKKMGY+VGGLPHYT+WHIYEPSDDDLKE+A++ERE+RR
Sbjct: 466 GKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/537 (64%), Positives = 409/537 (76%), Gaps = 20/537 (3%)

Query: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60
           M +   ++  ++ KA    L LP SRN S  N  D+  + NS              P + 
Sbjct: 1   MDLLIKVKKGVQNKAQQEEL-LPTSRNNS--NYGDEEQKKNS------------FVPKRR 45

Query: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLL--GSSKSSENYKTIXXXXXX 118
           +   S+  L + ++L + ++I + S +    S  +  + L  G +  + +YKT       
Sbjct: 46  KTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENE 105

Query: 119 XXXXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLS 178
                       V+ KFD+GVQHYLISQ+G++VLTP D+E Y +EL M+ D++VE+YDLS
Sbjct: 106 YYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLS 165

Query: 179 NFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTT 238
            F G+ NG   RDH+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD T
Sbjct: 166 TFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRT 225

Query: 239 LDALIAYSRHLQNGTLSQIFQEIDAV-ID--SQTKGTDKLYLKYMDEGYINRVHQAFSPP 295
           LDAL+AYS+HLQNGTLSQ+F E+D   +D   ++KGT  L+LKYM+  Y+  V  +F   
Sbjct: 226 LDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKR 285

Query: 296 FHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHS 355
            H NYDKPFRS+Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+
Sbjct: 286 KHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHA 345

Query: 356 WVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALAL 415
           WVYWRDAD+ELCPGSVI+DLMSK+YDVIVPNVWRPLP FL  EQPYDLNSW+ES EAL L
Sbjct: 346 WVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKL 405

Query: 416 AKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQ 475
           AKTLDEDDVIVEGYAEYPTWRVHLAYIRDA GDPNE VDLDGVGGVSILAKAKIFR+GVQ
Sbjct: 406 AKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQ 465

Query: 476 FPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532
           FPAFTFENHAETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL EIA++ER+ +R
Sbjct: 466 FPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/540 (63%), Positives = 414/540 (76%), Gaps = 27/540 (5%)

Query: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60
            G+      N +K   D  L LPISRN S  N+ D+        LK K R+ P+   +  
Sbjct: 2   FGLLHKFGRNSRK---DAKLELPISRNNS--NVADE--------LK-KQRFIPKKKSTAK 47

Query: 61  QLTV-SITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKS---SENYKTIXXXX 116
            + + S+ S II A++  Y   S+        S + G+  L ++K+   S +YKT     
Sbjct: 48  NVAIGSVVSFIICALI--YCGYSYF----FNTSPRLGKINLYANKNNKVSTSYKTTELSD 101

Query: 117 XXXXXXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYD 176
                         V+ KF++GVQHYLIS+FG++VLTPKD E+Y++EL ML D++VE+YD
Sbjct: 102 KEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYD 161

Query: 177 LSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD 236
           L  F+G+ NG E RDH+LLC+PLR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD
Sbjct: 162 LKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGD 221

Query: 237 TTLDALIAYSRHLQNGTLSQIFQEIDAVI---DSQTKGTDKLYLKYMDEGYINRVHQAFS 293
            TL+AL+ YSRHLQNGTLSQ+FQ++D         T+GT  L+LKYM++ Y+  V  AF+
Sbjct: 222 NTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFN 281

Query: 294 PPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 353
            P HENYDKPFRSVQIF+KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPY
Sbjct: 282 TPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPY 341

Query: 354 HSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEAL 413
           HSWVYWRDAD+ELCPG++++D+M+ +YDV+VPNVWRPLP FL +EQPYDLNSW+ES EAL
Sbjct: 342 HSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEAL 401

Query: 414 ALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNG 473
            LAKTL EDDVIVEGYAEYPTWRVHLAYIR+A+GDP   VDLDGVGGVSILAKAK+FR+G
Sbjct: 402 KLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSG 461

Query: 474 VQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533
           V FPAFTFENHAETE FGKMAK+MGYRVGGLPHYTIWHIYEPSDDDLKEIA++ER+ R +
Sbjct: 462 VHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/490 (69%), Positives = 391/490 (79%), Gaps = 15/490 (3%)

Query: 50  RYQPRSTPSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLL---GSSKSS 106
           +  P+   S +Q    I S +II V+ L L+ +F SG+      + GR ++   GS+ SS
Sbjct: 29  KLSPKGKRSSWQ-NRKIVSWVIITVMVLILYKAF-SGV-----VRGGREVMKTVGSNTSS 81

Query: 107 ENYKTIXXXXXXXXXXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNM 166
            + + +                  VI KFD GVQHYLI+QFG++VLTP+D E ++RE  M
Sbjct: 82  NDGQVLEEDAYYDYDFEDIDPK--VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKM 139

Query: 167 LFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLA 226
           L  STVE YDLS F G+ NG    +H+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLA
Sbjct: 140 LLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLA 199

Query: 227 FLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQ---TKGTDKLYLKYMDEG 283
           FLVSDC+E D TLDALIAYSR LQ+GTLSQ+F ++D         +KGT+KLYLKYM+  
Sbjct: 200 FLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPD 259

Query: 284 YINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 343
           Y+  V ++FSPPFHENYDKPFRSVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARN
Sbjct: 260 YLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARN 319

Query: 344 WLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDL 403
           WLTANALKPYHSWVYWRDADVELCPGSVI+DLMSK+YDV VPNVWRPLP FL  EQPYDL
Sbjct: 320 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDL 379

Query: 404 NSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSI 463
           NSWMES EAL LAKTLDEDDVIVEGYAEYPT+RVHLAYIRD   DPNE +DLDGVGGVSI
Sbjct: 380 NSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSI 439

Query: 464 LAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523
           LAKA++FR G+QFPAFTFENHAETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EI
Sbjct: 440 LAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREI 499

Query: 524 ASREREKRRQ 533
           A++ERE RR+
Sbjct: 500 ANKERESRRE 509

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/531 (63%), Positives = 400/531 (75%), Gaps = 22/531 (4%)

Query: 3   MFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKFQL 62
           M F   S  +K+  D+   LP+SR  S  N K K +    N  + K              
Sbjct: 1   MMFRWGSKREKRKDDDNYRLPVSR--SKLNPKTKSASFTWNGSRVK-------------- 44

Query: 63  TVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIXXXXXXXXXX 122
              I +  +I+V+   +F  FLS + +G S  +       +KS   Y TI          
Sbjct: 45  --RIANWALISVICFLMF-KFLSTVILGSSESSSPLPSIWTKS---YDTITLSDEAYYDY 98

Query: 123 XXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEG 182
                   VI KFD+GV +Y I+QFG E +T ++  K+++E++ML DSTVE+YD+  F G
Sbjct: 99  DFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRG 158

Query: 183 APNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDAL 242
             N  E ++H+LLC+PLR+A +VLPLMFKHLMN+TYPHELIDLAFLVSDCSEGD TLDAL
Sbjct: 159 TTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDAL 218

Query: 243 IAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDK 302
           IAYSR LQNGTLSQ+F E++     + KG + LYL+YMD+ Y+ RV  +FSPPFHENYDK
Sbjct: 219 IAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDK 278

Query: 303 PFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDA 362
            FRSVQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDA
Sbjct: 279 SFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDA 338

Query: 363 DVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDED 422
           DVELCPGSVIQDLM+K+YDV+VPNVWRPLP FL  +QPYDLNSW+ES+EAL LAKTLDED
Sbjct: 339 DVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDED 398

Query: 423 DVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFE 482
           DVIVEGYAEYPTWR HLAY RDA GDPNE V+LDGVGGVSILA+A++FR G+ FPAFTFE
Sbjct: 399 DVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFE 458

Query: 483 NHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533
           NHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDLKEI ++EREKRR+
Sbjct: 459 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/426 (74%), Positives = 356/426 (83%), Gaps = 1/426 (0%)

Query: 108 NYKTIXXXXXXXXXXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNML 167
           NYKT                   +I K+D G +H+LISQ G+EVLTP+D+E+Y++E+ ML
Sbjct: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80

Query: 168 FDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227
             +TV+ YDLS +EG+ NG E RDH+LLC+PLRNA +VLPLMFKHLMNLTYPHELIDLAF
Sbjct: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140

Query: 228 LVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVI-DSQTKGTDKLYLKYMDEGYIN 286
           LVSDCSE D TLDALIAYS+ LQNGTLS++F E D +   +  KG+  LYLKYM++ Y+N
Sbjct: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200

Query: 287 RVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346
            V  AF PPFH++YDKPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWLT
Sbjct: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260

Query: 347 ANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSW 406
           ANALKPYHSWVYWRD D+ELCPGSVI+DLMS N DV VPNVWRPLP FLG EQ YDLNSW
Sbjct: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320

Query: 407 MESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAK 466
           +ES EAL LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + +P E +DLDGVGGVSILAK
Sbjct: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380

Query: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASR 526
           AK+FR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDDDLKEIA +
Sbjct: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKK 440

Query: 527 EREKRR 532
           EREKRR
Sbjct: 441 EREKRR 446

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 356/402 (88%), Gaps = 2/402 (0%)

Query: 131 VISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETR 190
           ++ KFDDG +HYLIS++GSEVLTP+D  +Y++EL  L  +TV+ YDLS + G  NG++ R
Sbjct: 98  LVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNR 157

Query: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQ 250
           +H+LLC+PLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+EGD TL++LIAYSRHLQ
Sbjct: 158 EHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQ 217

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIF 310
           +GTL+ +FQE+D   D   K ++KLYLKYM++ Y+  V  A+SPPFH +Y+KPFRSVQIF
Sbjct: 218 DGTLAGLFQEMDK--DDSKKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIF 275

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           QKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+
Sbjct: 276 QKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGT 335

Query: 371 VIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYA 430
           VI+DLMSKN+DV+VPNVWRPLP FL +EQPYDLNSWMES EAL LAK LDEDDVIVEGYA
Sbjct: 336 VIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYA 395

Query: 431 EYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHLAYIR+  G+PN+ VDLDGVGGVSIL KAK+FR+G+ FPAFTFENHAETEAF
Sbjct: 396 EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAF 455

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532
           GKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EIAS+ERE  R
Sbjct: 456 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/403 (74%), Positives = 344/403 (85%), Gaps = 3/403 (0%)

Query: 135 FDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHIL 194
           FD G QHYLI+Q+G +V+T KD E+Y +E+  L  S+V++YDLS FEG  NG E R+H+L
Sbjct: 118 FDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLL 177

Query: 195 LCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTL 254
              PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDCSEGD TLD LI ++RHLQ+GTL
Sbjct: 178 YLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTL 237

Query: 255 SQIFQEIDAVI---DSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQ 311
             IF+++DA I   + + +  +K YLK+MD+ YI     +F+ P H  Y+KPFRSVQIFQ
Sbjct: 238 VDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQ 297

Query: 312 KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 371
           KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV
Sbjct: 298 KDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 357

Query: 372 IQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAE 431
           IQDLMSKNYDVIVPNVWRPLP FL  EQPYDLNSWMES EAL LAKTLDEDDVIVEGYAE
Sbjct: 358 IQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAE 417

Query: 432 YPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFG 491
           YPTWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAK+FR+GV FPAFTFENHAETEAFG
Sbjct: 418 YPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFG 477

Query: 492 KMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQS 534
           KMAKKMGY VGGLP+Y +WHIYEPSDDDLK++A+ ER +  Q+
Sbjct: 478 KMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQN 520

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/403 (73%), Positives = 340/403 (84%), Gaps = 1/403 (0%)

Query: 131 VISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETR 190
           ++ KFD+G +HYLIS+ G E+L   D E+Y+ E+  L DSTVE YDL +FEG+  G   R
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQ 250
           +H+LL +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL+ Y + LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 251 NGTLSQIFQEIDAVID-SQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQI 309
           +GTLS +F    +  +  + KGT  L+LKYM   Y+  V  A+SPPFH+ YDKPFRSVQI
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 370 SVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGY 429
           SVIQDLMS ++DV VPNVWRPLP FL  EQPYDLNSW+ES  AL LA+TLDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 430 AEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 489
           AEYPTWRVHLAY+RD + +P + ++LDGVGGVSILAKAK+FRNGV FPAFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532
           FGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +IA REREK+R
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/511 (59%), Positives = 379/511 (74%), Gaps = 28/511 (5%)

Query: 33  IKDKRSE---HNSNSLKGKYRYQPRSTPSKFQLTVS--------ITSLIIIAVLSLYLFI 81
           +KDKR E   H+ +  KG + ++P+S    F   ++        I  L  + ++S +L +
Sbjct: 5   VKDKRLELPMHHDSKQKGNH-FRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLL 63

Query: 82  SFLSGMGIGVSTQNGRSLLGSSKSSENYKTIXXXXXXXXXXXXXXXXXXVISKFDDGVQH 141
           S L G  + +      SL        ++K +                   I K+D+GV H
Sbjct: 64  SKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDID---------------TIKKYDEGVSH 108

Query: 142 YLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRN 201
           Y+IS+ G E L+ +D E ++RE +ML  ST + YDLS + GA NG   RDH+LLC+PLR+
Sbjct: 109 YIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRD 168

Query: 202 AADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEI 261
           AA +LP++FK+LMNLTYPHELID+AFLVSDC++   T+ +L+ +S+ LQNGTLS+  Q+ 
Sbjct: 169 AASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDF 228

Query: 262 DAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQG 321
           +A  D +    ++LYLKYM + Y+  V  AF+PPFH++YDKPFRS+QIF+KDFGQ IGQG
Sbjct: 229 EADKD-KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQG 287

Query: 322 FSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYD 381
           FSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+VI+DLM  +YD
Sbjct: 288 FSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYD 347

Query: 382 VIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAY 441
           VIVPNVWRPLPTFLG  Q YDLNSW+ES EA+ LAKTLDEDDVIVEGYAEYPTWRVHL Y
Sbjct: 348 VIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGY 407

Query: 442 IRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRV 501
           +R   G+P++ +DLDGVGGVSILA+A++FR G+ FPAFTFENHAETEAFGKMAKKMG++V
Sbjct: 408 LRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKV 467

Query: 502 GGLPHYTIWHIYEPSDDDLKEIASREREKRR 532
           GGL HYT+WHIYEPSDDDL+EIA  ERE RR
Sbjct: 468 GGLMHYTLWHIYEPSDDDLREIAKLERESRR 498

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/400 (72%), Positives = 338/400 (84%), Gaps = 2/400 (0%)

Query: 131 VISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETR 190
           ++SKFD G+ +YLIS++G+E  +  D  +Y   L ML DSTVE+YDL NF+G+ +G E +
Sbjct: 115 IVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQ 174

Query: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQ 250
           +HIL+C+PLR+A +VLPLMFK+LMNLTYPHELIDLAFLVSDCSEGD TL+AL  YS+ LQ
Sbjct: 175 EHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQ 234

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIF 310
            G L  I  ++D    ++ K  + ++LKYM+  Y+ RV  A+ PPFH NY KPFRSVQIF
Sbjct: 235 EGILPDILADMDNY--NKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIF 292

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELCPGS
Sbjct: 293 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGS 352

Query: 371 VIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYA 430
           VI+DLM ++YDVIVPNVWRPLP FL + QPYDLNSWMES EAL LAKTLDEDDVIVEGYA
Sbjct: 353 VIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYA 412

Query: 431 EYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAF 490
           EYPT+RVHLAYIR+ +GDP + VDLDGVGGVSILA+A++FR GV F AFTFENHAETEAF
Sbjct: 413 EYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAF 472

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530
           GKMAKK+G+RVGGLPHYT+WHIYEPSDDDL  +A  E+ K
Sbjct: 473 GKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/487 (62%), Positives = 355/487 (72%), Gaps = 7/487 (1%)

Query: 50  RYQPRSTPSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENY 109
           RY P+    KF   +S     +I  L     I FL    +  +    RS  G    S++Y
Sbjct: 40  RYHPK-VKGKFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSY 98

Query: 110 KTIXXXXXXXXXXXXXXXXXXVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFD 169
            T                    + ++DDG +H LI Q G+  L    +E ++  L+ML  
Sbjct: 99  DTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLS 156

Query: 170 STVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229
           +TVE YDLS + G  NG E R+H+L+C+PLRNA +VLPLMF+HLMNLTYPHELIDLAFLV
Sbjct: 157 TTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLV 216

Query: 230 SDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAV-IDSQTKGTDK---LYLKYMDEGYI 285
           SDCS+ D T+D+LI+Y+  LQ GTLS+  +  DA  +  ++K  +K   L+LKYM++ Y+
Sbjct: 217 SDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDYL 276

Query: 286 NRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 345
           N V  A   PFH+NYDKPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWL
Sbjct: 277 NMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWL 336

Query: 346 TANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNS 405
           TANALKPYHSWVYWRDADVELCPGSVI+DLMS  YDVIVPNVWRPLP FLG+EQ YDLNS
Sbjct: 337 TANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNS 396

Query: 406 WMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILA 465
           W+ES  AL LAKTLDEDDVIVEGYAEY TWR HLA  RD +G+  + +DLDGVGGVSILA
Sbjct: 397 WIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILA 456

Query: 466 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAS 525
           KAK+FRNGV F AF FENHAETEAFGKMAKKMGYRVGGL HYT+WHIYEPS+DDL EIA 
Sbjct: 457 KAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIAR 516

Query: 526 REREKRR 532
           +ER  RR
Sbjct: 517 KERSSRR 523

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/405 (68%), Positives = 329/405 (81%), Gaps = 7/405 (1%)

Query: 132 ISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRD 191
           ++K+D+G +HY +++ G      +DD +++ ++  L  +TVE+YDL N+EG PNG E R+
Sbjct: 83  LAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENRE 139

Query: 192 HILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQN 251
           H+L+CIPLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCSE D TL +L+ Y+ +LQ 
Sbjct: 140 HVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQK 199

Query: 252 GTLSQIFQ----EIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSV 307
           GTL+ +      EI  +      G   LYLKYMD+ Y+  V  AFSPP+HENY+KPFRSV
Sbjct: 200 GTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSV 259

Query: 308 QIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 367
           Q+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVELC
Sbjct: 260 QVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELC 319

Query: 368 PGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVE 427
           PGSVI+DLMS  YDVIVPNVWRPLP FLG +Q YDLNSW+ES +AL LAK L+EDDVIVE
Sbjct: 320 PGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVE 379

Query: 428 GYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAET 487
           GYAEY TWR HL   R+A+G+P E +DLDGVGGVSILAKAK+FR G  F AF FENHAET
Sbjct: 380 GYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAET 439

Query: 488 EAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532
           EAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +IA RERE RR
Sbjct: 440 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRR 484

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/520 (58%), Positives = 383/520 (73%), Gaps = 20/520 (3%)

Query: 24  ISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKFQLTV---SITSL-IIIAVLSLYL 79
            SRN     + +K  E   N     +R  P+   SKF++T     +++  + ++V+ L +
Sbjct: 11  FSRNSYKLPLSEKTKEKRKNR---DFRLLPKY--SKFKVTNFRDKVSNFNVALSVILLCI 65

Query: 80  FISFLSGMGIGVSTQNGRSLLGSSKS-SENYKTIXXXXXXXXXXXXXXXXXXVISKFDDG 138
           FI+    + + VS     S +   ++ +  + T                    ISK+D G
Sbjct: 66  FIA--KTISVNVSIYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISKYDKG 123

Query: 139 VQHYLISQFGSE---VLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHILL 195
           V+ YL+  + ++    L+ +  E Y  EL  L  S+V+ YD+ +F G  +G+ +R+H+LL
Sbjct: 124 VRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLL 183

Query: 196 CIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLS 255
           CIPLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++L+ Y+R LQNGTL 
Sbjct: 184 CIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLP 243

Query: 256 QIFQE---IDAVIDSQTKGTD--KLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIF 310
            +F+E   +D + D   +  D  KLYLKYM + Y+ RV +AF  PFHENYDKPFRS+QI+
Sbjct: 244 DVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIY 303

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           +KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDADVELCPG+
Sbjct: 304 KKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGT 363

Query: 371 VIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYA 430
           VI+DLMSK++DVIVPNVWRPLP F+ +EQPYDLNSWMES+EA+ LAK L ED+VIVEGYA
Sbjct: 364 VIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYA 423

Query: 431 EYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHLAY+R+ +GDPN+ VD+DGVGGVSILA+A++FR GV FPAFTFENHAETEAF
Sbjct: 424 EYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAETEAF 483

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530
           GKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  IA++E+E+
Sbjct: 484 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/338 (76%), Positives = 289/338 (85%), Gaps = 1/338 (0%)

Query: 197 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQ 256
           +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D T +AL+ Y++ LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 257 IFQEIDAVIDS-QTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFG 315
           +F   ++  +  + +G+  L+LKYM   Y+  V  AF+PPFH+NYDKPFRSVQIFQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 316 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 375
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+DL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 376 MSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTW 435
           M+  YDV VPNVWRPLP FL  EQ YDLNSW+ES  AL LAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 436 RVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 495
           RVHL YIR+ +GDP   +DLDGVGGVSILAKA++FRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 496 KMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533
           KMGY V GLPHYT+WHIYEPSDDDL ++  RERE +RQ
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  405 bits (1040), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 244/364 (67%), Gaps = 47/364 (12%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V+ YDLSN++G  +G +  D +L C+PLR+AA+ LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            +  D T+  L+     LQ                SQ  GT                   
Sbjct: 110 ST--DDTMGVLLNSLHDLQ----------------SQADGT------------------- 132

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F  ++IFQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 133 ----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIK 182

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + D+IVPNVWRPLP +L   QPYDLNSW+ES+ 
Sbjct: 183 PYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEG 242

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA +L EDDVIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 243 GLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFR 302

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKR 531
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDLK +A    E++
Sbjct: 303 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQ 362

Query: 532 RQSE 535
           R+ E
Sbjct: 363 RKME 366

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  400 bits (1029), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/364 (52%), Positives = 244/364 (67%), Gaps = 47/364 (12%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+N++G  +G +  D +L C+PLR+AA+ LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++  +  Q+                                        
Sbjct: 142 SS--DDTMGVLLSSLKKAQS---------------------------------------- 159

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                +++  + F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 160 -----NQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 214

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  N DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 215 PYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 274

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA +L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 275 GLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFR 334

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKR 531
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDLK +A    E++
Sbjct: 335 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEK 394

Query: 532 RQSE 535
           R+ E
Sbjct: 395 RKVE 398

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  399 bits (1024), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/365 (52%), Positives = 245/365 (67%), Gaps = 47/365 (12%)

Query: 171 TVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            V+ YDL N++G  +G +  DH+L  +PLR+AA+ LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 231 DCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           D S  D T+  L+ Y                                          + +
Sbjct: 112 DSS--DDTMGVLLEY------------------------------------------LQK 127

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
           A S P   +  + F +++I++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + AL
Sbjct: 128 AQSKP---DRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVAL 184

Query: 351 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQ 410
           KPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+
Sbjct: 185 KPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 244

Query: 411 EALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIF 470
             L LA++LDED VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK+F
Sbjct: 245 GGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVF 304

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530
           R G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDLK +A    E+
Sbjct: 305 RAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 364

Query: 531 RRQSE 535
           +R+ E
Sbjct: 365 KRKIE 369

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  399 bits (1025), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/364 (53%), Positives = 245/364 (67%), Gaps = 47/364 (12%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  D IL C+PLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++   +LQN    Q                                   
Sbjct: 142 SS--DNTMGVLLS---NLQNAQSQQ----------------------------------- 161

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  +  K F +++IF+KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL + A+K
Sbjct: 162 -------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIK 214

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 215 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 274

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++L+G+GGVSIL+KAK+FR
Sbjct: 275 GLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFR 334

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKR 531
           +G  FPAF+FE HAETEAFGK++++M + V GLPHY IWHIYEPS +DLK +A    E++
Sbjct: 335 SGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEK 394

Query: 532 RQSE 535
           R+ E
Sbjct: 395 RKLE 398

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  397 bits (1020), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/364 (53%), Positives = 244/364 (67%), Gaps = 49/364 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+++ G P+G +  D IL C+PLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L+    HLQ                                         
Sbjct: 114 SS--DNTMGVLM---HHLQQA--------------------------------------- 129

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++ +K F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 130 -----QKDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 184

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE+ P S+++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW+ES+ 
Sbjct: 185 PYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 244

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA TL ED VIVEGY EY TWR HLAY+RD  G+P + + LDG+GGVSIL+KA++FR
Sbjct: 245 GLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFR 304

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKR 531
            G  FPAF+F+ HAETEAFGK++++MG+ V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 305 AGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEK 364

Query: 532 RQSE 535
           R+ E
Sbjct: 365 RKLE 368

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  397 bits (1019), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/365 (54%), Positives = 248/365 (67%), Gaps = 48/365 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  D IL C+PLR+AA+ LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++   HLQ+               +Q++         MD+         
Sbjct: 122 SS--DDTMGVLLS---HLQS---------------AQSQ---------MDKS-------- 144

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 254

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA+ L+ED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK+FR
Sbjct: 255 GLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-SREREK 530
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS +DLK +A   E EK
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEK 374

Query: 531 RRQSE 535
           RR  E
Sbjct: 375 RRLEE 379

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  399 bits (1026), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/364 (53%), Positives = 239/364 (65%), Gaps = 47/364 (12%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V  YDL+N+ G  +G +  D IL C+PLR+AA  LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
               D T+  L++   HLQ     Q                                   
Sbjct: 132 SK--DDTMGVLLS---HLQTAQSQQ----------------------------------- 151

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  N  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 152 -------NKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 204

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE CP ++++DLM    DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 205 PYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 264

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA +LDED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK+FR
Sbjct: 265 GLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 324

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKR 531
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK +A    E++
Sbjct: 325 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEK 384

Query: 532 RQSE 535
           R+ E
Sbjct: 385 RKLE 388

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  395 bits (1016), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/364 (52%), Positives = 243/364 (66%), Gaps = 47/364 (12%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  D +L  +PLR+AA+ LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L+ + +  Q+ T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  +  K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 133 -------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 186 PYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            + LA++LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSIL+KAK+FR
Sbjct: 246 GMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFR 305

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKR 531
            G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 532 RQSE 535
           R+ E
Sbjct: 366 RKVE 369

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 193/366 (52%), Positives = 241/366 (65%), Gaps = 47/366 (12%)

Query: 170 STVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229
           +  E YDL N+ G  NG +T D IL C+PLR+AA+ LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 230 SDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVH 289
           SD    D T+  L++                     + QT  + K               
Sbjct: 125 SDSK--DDTMGVLLS---------------------NLQTAQSQK--------------- 146

Query: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349
                    +  K F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 147 ---------DRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 350 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMES 409
           +KPYHSWVYWRD DVE  P ++++DLM    DVIVPNVWRPLP +LG  QPYDLNSW ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 410 QEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKI 469
              L LA +LD+D VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA++
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASRERE 529
           FR+G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DLK +A    E
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 377

Query: 530 KRRQSE 535
           ++R+ E
Sbjct: 378 EQRKLE 383

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  395 bits (1015), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/353 (55%), Positives = 238/353 (67%), Gaps = 47/353 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+N++G  +G +  D IL C+PLR+AA+ LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++   +LQN    Q                DK                 
Sbjct: 147 SS--DDTMGVLLS---NLQNAQSQQ----------------DK----------------- 168

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 169 ---------SKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 219

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 220 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 279

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA TL EDDVIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 280 GLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 339

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFGK+++KM Y V GLPHY IWHIYEPS +DLK +A
Sbjct: 340 TGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  391 bits (1005), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/361 (52%), Positives = 243/361 (67%), Gaps = 47/361 (13%)

Query: 171 TVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           +VE YD+SN++G  +G    + IL+C+PL++A++ LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 231 DCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           D S  D T+  L+   + LQ              ID  T G                   
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ--------------IDGGTSGK------------------ 139

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                        F +++I++KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL   A+
Sbjct: 140 -------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAI 186

Query: 351 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQ 410
           KPYHSWVYWRD DVE+ P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+
Sbjct: 187 KPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 246

Query: 411 EALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIF 470
             LAL+ +L ED VIVEGY EY TWR HLAY+RD  GDP   ++LDGVGGVSIL+KA +F
Sbjct: 247 AGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVF 306

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530
           R+G  FPAF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +DL+ +A  E ++
Sbjct: 307 RSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKE 366

Query: 531 R 531
           R
Sbjct: 367 R 367

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  392 bits (1008), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 237/354 (66%), Gaps = 47/354 (13%)

Query: 171 TVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           +VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 231 DCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           D S  D T+  L++  +  Q+                                       
Sbjct: 121 DSS--DNTMGVLLSNLQMAQS--------------------------------------- 139

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                  ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 140 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 351 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQ 410
           KPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 411 EALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIF 470
             L LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
           R G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 237/353 (67%), Gaps = 47/353 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++                                           +H+A
Sbjct: 122 SS--DNTMGVLLS------------------------------------------NLHKA 137

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
            S    ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 138 QS---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA  L+ED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  394 bits (1013), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/353 (53%), Positives = 239/353 (67%), Gaps = 47/353 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDLSN++G  +G +  D IL CIPLR+AA  LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++   HLQ              + SQ                       
Sbjct: 126 SS--DDTMGVLLS---HLQ-------------TVQSQ----------------------- 144

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL + ALK
Sbjct: 145 ------QDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALK 198

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD D+E  P ++++DLM  + D+IVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 199 PYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 258

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA  LDE+ VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK+FR
Sbjct: 259 GLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFR 318

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK +A
Sbjct: 319 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  387 bits (994), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 237/365 (64%), Gaps = 48/365 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE +DLS   G  +G    D +L C+PLR+AA+ LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
               D T+  L  + R LQ                SQ                       
Sbjct: 102 SK--DETMSVLRQHVRELQ----------------SQPDNA------------------- 124

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     + F +++IFQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 125 ----------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 174

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++I+DLM  + DVIVPNVWRPLP +LG  QPYDLNSW+ES+ 
Sbjct: 175 PYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEG 234

Query: 412 ALALAK-TLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIF 470
            L LA  T DED VIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL++A++F
Sbjct: 235 GLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVF 294

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530
           R+G  FPAF+F+ HAETE FGK+++ MGY V GLPHY IWHIYEPS DDLK +A    E+
Sbjct: 295 RSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 354

Query: 531 RRQSE 535
           +R+ E
Sbjct: 355 QRRLE 359

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  389 bits (999), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 187/353 (52%), Positives = 235/353 (66%), Gaps = 47/353 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++  +  Q+                                        
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 140 -----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DV+  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  389 bits (1000), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 191/353 (54%), Positives = 235/353 (66%), Gaps = 47/353 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L++  +  Q                SQ   T                   
Sbjct: 122 SS--DNTMGVLLSKLQMAQ----------------SQQDKT------------------- 144

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/365 (52%), Positives = 239/365 (65%), Gaps = 48/365 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  NG +T D ++ C+PLR+AA  L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L+++ R  Q+                                        
Sbjct: 117 SS--DDTMKTLLSHLRRAQS---------------------------------------- 134

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                +++  + F +++IF+KDFGQ +GQ FSDRH    QG RRK M RARNWL + ALK
Sbjct: 135 -----NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALK 189

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHS+VYWRD DV+  P ++++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW+ES+ 
Sbjct: 190 PYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 249

Query: 412 ALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFR 471
            L LA +LDED  IVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 250 GLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFR 309

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-SREREK 530
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS DDLK +A   E EK
Sbjct: 310 TGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 369

Query: 531 RRQSE 535
           RR  E
Sbjct: 370 RRVEE 374

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 239/362 (66%), Gaps = 48/362 (13%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL N++G  +G +  + IL  +PLR+AA  LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            S  D T+  L+    HLQ             +  SQ                       
Sbjct: 117 SS--DDTMGELL---HHLQ-------------IAQSQ----------------------- 135

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++ +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +  LK
Sbjct: 136 ------KDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLK 189

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQE 411
           PYHSWVYWRD DVE+ P S+++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+ 
Sbjct: 190 PYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 249

Query: 412 ALALAKTL-DEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIF 470
            + LA TL DED VIVEGY E+ TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+F
Sbjct: 250 GIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 309

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530
           R G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS +DLK +A    E+
Sbjct: 310 RTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 369

Query: 531 RR 532
           +R
Sbjct: 370 KR 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  384 bits (987), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 231/353 (65%), Gaps = 47/353 (13%)

Query: 171 TVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            VE YDL N++G  +G +  D I+ C+PLR+AA  LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 231 DCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           D S  D T+  L++  +  Q+                                       
Sbjct: 124 DSS--DDTMGVLLSNLQTAQS--------------------------------------- 142

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                   +  K F +++I++KDFGQVIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 143 ------QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 351 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQ 410
           KPYHSWVYWRD D+E  P ++++DLM  + D+IVPNVWRPLP +LG  QPYDLNSW ES+
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 411 EALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIF 470
             L LA  L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523
           R+G  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DLK +
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/355 (51%), Positives = 235/355 (66%), Gaps = 48/355 (13%)

Query: 171 TVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            VE YDL N++G P+G +  + IL  +PLR+AA+ LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 231 DCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           D S  D T+ AL+++    Q+                                       
Sbjct: 122 DSS--DDTMGALLSHLEKAQS--------------------------------------- 140

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                 +++  + F +++I++KDFGQ IGQ FSDRH    QG RRKLM RARNWL   AL
Sbjct: 141 ------NKDKTRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVAL 194

Query: 351 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQ 410
           K YHSWVYWRD DVELCP S+++DLM  + DVIVPNVWRPLP +LG  QPYDLNSW ES+
Sbjct: 195 KAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 254

Query: 411 EALALAKTLDEDD-VIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKI 469
             + LA +L +DD VIVEGY +Y TWR HLAY+RD  G+P + ++LDG+GGVSIL+K K+
Sbjct: 255 VGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKV 314

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
           FR G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DL+ +A
Sbjct: 315 FRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  202 bits (513), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 121/374 (32%), Positives = 185/374 (49%), Gaps = 63/374 (16%)

Query: 153 TPKDDEKYQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAA 203
           TPK    Y+++ N LF  TVE+         YDL+           ++ +L+  P++   
Sbjct: 70  TPK--YSYKKKSNWLFSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFH 127

Query: 204 DVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDA 263
           D     + +L+ LTYP +LI+L F++   + GDT L  L A  +  Q G           
Sbjct: 128 DQY---WDNLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQLG----------- 173

Query: 264 VIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFS 323
                                                D+ F  + I ++D          
Sbjct: 174 -----------------------------------KKDQRFSKITILRQDSQSFDSLQEK 198

Query: 324 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVI 383
           +RHA+KVQ  RR  M  ARN L  + + P+ SW+ W DAD+   P S+IQD+ + N  V+
Sbjct: 199 ERHALKVQKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVL 258

Query: 384 VPNVWRPL---PTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLA 440
             NV++      T    E+PYD N+W +S++AL +A  + +D+V+ EGYAE PT+R  +A
Sbjct: 259 AANVYQKYMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMA 318

Query: 441 YIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYR 500
           ++ DA G     + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA+++ Y 
Sbjct: 319 HMYDASGSQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYE 378

Query: 501 VGGLPHYTIWHIYE 514
           + GLP+Y ++HI E
Sbjct: 379 IFGLPNYLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 192/383 (50%), Gaps = 69/383 (18%)

Query: 147 FGSEVLTPKDDEKYQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCI 197
           F S+   PK    Y+++ N L +  VE+         YDL+      + ++ ++H+L+  
Sbjct: 64  FSSKFKMPK--YSYKKKSNWLSNDFVEDIIPEGHIAHYDLNKLHSTKDAMKLKEHVLIAT 121

Query: 198 PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQI 257
           P++   D     + +L+ ++YP  L++L F++     GD TL  L A  +++Q G +   
Sbjct: 122 PMQTFHDAY---WSNLLKMSYPRSLLELGFIIPRTPTGDETLKKLEAAVKNVQTGKVEDR 178

Query: 258 FQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQV 317
           F +I  ++   ++  DKL                                          
Sbjct: 179 FAKI-TILRQDSQSFDKL------------------------------------------ 195

Query: 318 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 377
              G  +RH++ VQ  RR  M  ARN L  +++ P  SWV W DAD+   P +VIQD+ +
Sbjct: 196 ---GEKERHSLAVQKERRSAMALARNELLFSSIGPSTSWVLWLDADIVETPATVIQDMTN 252

Query: 378 KNYDVIVPNVWRPLPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAE 431
            N  V+  NV++    F   E+      PYD N+W ES++ L +AK ++ED++IVEGYAE
Sbjct: 253 HNKPVLAANVYQ---RFFDKEKNENSIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAE 309

Query: 432 YPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFG 491
             T+R  +A+  D  G  +  + LDGVGG   L KA++ R+G  FP F F +  ETE F 
Sbjct: 310 IATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFA 369

Query: 492 KMAKKMGYRVGGLPHYTIWHIYE 514
           KMAK++ Y + GLP+Y ++HI E
Sbjct: 370 KMAKRLNYEIFGLPNYLVYHIEE 392

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  200 bits (509), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 118/349 (33%), Positives = 178/349 (51%), Gaps = 58/349 (16%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL+  +   N L  ++ +L+  P++         + +L++LTYP  LI+L F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPR 152

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            + GD  L  L +  R +Q G   + F +I  ++   ++  D+L                
Sbjct: 153 TASGDAALQKLESAVREVQTGKQDKRFAKI-TILRQASQSFDRL---------------- 195

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                        G  DRHA++VQ  RR  M  ARN L  + + 
Sbjct: 196 -----------------------------GEKDRHALEVQKERRAAMALARNELLFSTIG 226

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQ------PYDLNS 405
           P+ SW+ W DAD+   P +VIQDL S N  V+  NV++    F   +Q      PYD N+
Sbjct: 227 PHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYDFNN 283

Query: 406 WMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILA 465
           W ES+  L LA+ L ++++IVEGY+E  T+R  +A+  DA G  N  ++LDGVGG   L 
Sbjct: 284 WAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLV 343

Query: 466 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA++ R+G  F  F F +  ETEAF KMAK++GY V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  194 bits (494), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 180/367 (49%), Gaps = 61/367 (16%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++ + LF+  VE+         YDL+           ++H+L+  P++         +
Sbjct: 76  YKKKSSWLFNDRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YW 132

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ LTYP E  +L F++   S GD  L  L A  + +Q    +Q F +I  ++   + 
Sbjct: 133 DNLLQLTYPREFTELGFILPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKI-TILRQNSA 191

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
           G DKL  K                                             +RHA++V
Sbjct: 192 GFDKLMEK---------------------------------------------ERHALEV 206

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  ++L P  SWV W DAD+   P ++IQD+ S N  V+  NV++ 
Sbjct: 207 QKERRSAMASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQK 266

Query: 391 LPTFLGTE---QPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEG 447
                  +   +PYD N+W ES  AL LAK + +D+++VEGY +  T+R  +AY  DA G
Sbjct: 267 YYDDQAKKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATG 326

Query: 448 DPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHY 507
             N  ++LDGVGG   L KA + R+G  FP F F +  ETE F KMA+++ Y + GLP+Y
Sbjct: 327 ATNAEMNLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNY 386

Query: 508 TIWHIYE 514
            ++HI E
Sbjct: 387 LVYHIEE 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 181/370 (48%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++   LF+  VE+         YDL+     P+    ++HIL+  P++         +
Sbjct: 75  YKKKSGWLFNDHVEDIIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YW 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ L YP ELI+L F+    + GD+ L  L +  + +Q    +Q F +I  ++   ++
Sbjct: 132 DNLLQLNYPRELIELGFITPRTATGDSALKKLESAIKKVQTDKKTQRFSKI-TILRQNSQ 190

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA++V
Sbjct: 191 SFDKLMEK---------------------------------------------ERHALEV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+IQD+   N  V+  N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ- 264

Query: 391 LPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              F   E+      PYD N+W ES   L +A  + +D++IVEGYAE  T+R  +A+  D
Sbjct: 265 --RFYDQEKKQASIRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFD 322

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
           A    NE + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 323 ASKPQNEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGL 382

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  191 bits (485), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 118/370 (31%), Positives = 180/370 (48%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++   LF+  VE+         YDL+     P+    ++H+L+  P++         +
Sbjct: 75  YKKKSGWLFNDHVEDIIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---W 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ LTYP ELI+L F+    + GD  L  L    + +Q    +Q F +I  ++   ++
Sbjct: 132 DNLLQLTYPRELIELGFITPRTATGDLALKKLENAVKKVQADKKAQRFSKI-TIMRQNSQ 190

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA+ V
Sbjct: 191 SFDKLMEK---------------------------------------------ERHALDV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P ++IQD+   N  V+  N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ- 264

Query: 391 LPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              F   E+      PYD N+W ES   L +A  +D+D++IVEGYAE  T+R  +A+   
Sbjct: 265 --RFYDQEKKQSSIRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYS 322

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
           A   P++ + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 323 ANELPSKEMVLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGL 382

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  190 bits (483), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 182/370 (49%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+ + N LF+  V++         YDL+           ++ +L+  P++   +     +
Sbjct: 76  YKEQHNWLFNDHVDDIIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YW 132

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +++++TYP ELI+L F+      GD  L  L A  + +Q+G  ++ F +I  ++  +++
Sbjct: 133 DNILHMTYPRELIELGFIAPRTPTGDAALKKLEAAIKKIQSGKKNERFAKI-IILRQESQ 191

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             D L  K                                             DRHA+ V
Sbjct: 192 SFDMLAEK---------------------------------------------DRHALAV 206

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + L P+ SWV W DAD+   P +VIQDL + +  V+  NV++ 
Sbjct: 207 QKQRRSAMALARNELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ- 265

Query: 391 LPTFLGTE------QPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              F   E      +PYD N+W ES+  L LA +L  D++IVEGYAE  T+R  +A+  D
Sbjct: 266 --RFFNDELSKADIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFD 323

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
                +E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++GY V GL
Sbjct: 324 ESKPVSEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGL 383

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 384 PNYLVYHIEE 393

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 177/370 (47%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++   LF+  VE+         YDL+           ++HIL+  P++         +
Sbjct: 75  YKKKSGWLFNDHVEDIIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YW 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ L YP ELI+L F+    + GD  L  L    + +Q    +Q F +I  ++   ++
Sbjct: 132 DNLLQLNYPRELIELGFITPRTATGDLALKKLENAIKKVQTDKKTQRFSKI-TILRQNSQ 190

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA+ V
Sbjct: 191 SFDKLMEK---------------------------------------------ERHALDV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+IQD+   N  ++  N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ- 264

Query: 391 LPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              F   E+      PYD N+W ES   L +A  + +D++IVEGYAE  T+R  +A+  D
Sbjct: 265 --RFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYD 322

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
           A G P E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 323 ANGVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGL 382

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  189 bits (480), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 122/383 (31%), Positives = 184/383 (48%), Gaps = 63/383 (16%)

Query: 147 FGSEVLTPKDDEKYQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCI 197
           + S+   PK    Y+++ N LF+  VE+         YDL+           ++ +L+  
Sbjct: 65  YASKYKMPK--YSYKKKSNWLFNDRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILT 122

Query: 198 PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQI 257
           P++   +     + +L+ LTYP ELI+L F+V     GD  L  L    + +Q    +Q 
Sbjct: 123 PMQTFHEQ---YWDNLLQLTYPRELIELGFIVPRTQSGDVALAKLEEAVKKVQTDKKNQR 179

Query: 258 FQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQV 317
           F ++  ++   +K  DKL  K                                       
Sbjct: 180 FVKV-TILRQDSKSFDKLQEK--------------------------------------- 199

Query: 318 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 377
                 +RHA+ VQ  RR  M  ARN L  + + P+ SWV W DAD+   P ++IQD+ +
Sbjct: 200 ------ERHALAVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTA 253

Query: 378 KNYDVIVPNVWRPLPTFLGTE---QPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPT 434
            N  V+  NV++        E   + YD N+W ES+  L LA  + ED++IVEGY+E  T
Sbjct: 254 HNKPVLAANVYQRYYDEEKKESSIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELAT 313

Query: 435 WRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMA 494
           +R  +AY  DA G P   + LDGVGG   L +A + R+G  FP F F +  ETE F KMA
Sbjct: 314 YRPLMAYYYDANGSPGAEMALDGVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMA 373

Query: 495 KKMGYRVGGLPHYTIWHIYEPSD 517
           K++ + V GLP+Y ++HI E +D
Sbjct: 374 KRLNHEVFGLPNYLVYHIEEWND 396

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  189 bits (479), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 118/370 (31%), Positives = 178/370 (48%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++ N LF+  +E+         YDL+      N    ++ +L+  P++N        +
Sbjct: 74  YKKKSNWLFNDKIEDVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YW 130

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ LTYP ELI+L F+V     G+  L+ L A  + +Q G     F +I  ++   ++
Sbjct: 131 DNLLQLTYPRELIELGFIVPRTGSGNVALEQLEAAVKKVQTGKKEDRFGKI-TILRQASQ 189

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA++V
Sbjct: 190 SFDKLLEK---------------------------------------------ERHALEV 204

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + + PY SW+ W DAD+   P SVI+D+ + N  V+  NV++ 
Sbjct: 205 QKERRAAMALARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ- 263

Query: 391 LPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              +   EQ      PYD N+W ES   L LA  +  D+++VEGY E  T+R  +A+  +
Sbjct: 264 --RYYDQEQKKESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYE 321

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
                   ++LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++GY V GL
Sbjct: 322 DSAPATVEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGL 381

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 382 PNYLVYHIDE 391

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  189 bits (479), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 121/370 (32%), Positives = 180/370 (48%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+ E N +FD  V+E         YDL+      +    ++ IL+  P++         +
Sbjct: 73  YKNEHNWMFDDHVDEIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YW 129

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
           ++L+ LTYP ELI+L F+      GD  L AL A    +Q+   +Q F ++  ++   + 
Sbjct: 130 ENLLQLTYPRELIELGFIAPRTPTGDQALAALEAAVDKVQSDKKNQRFSKV-TILRQDSV 188

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
           G +KL  K                                             +RHA++V
Sbjct: 189 GFNKLTEK---------------------------------------------ERHALEV 203

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+IQD+ + +  V+  NV++ 
Sbjct: 204 QKERRASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ- 262

Query: 391 LPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              +   E+      PYD N+W ES   L LA  + +D++IVEGYAE  T+R  +AY  D
Sbjct: 263 --RYYDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHD 320

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
            +    E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 321 PDNSVAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGL 380

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 381 PNYLVYHIEE 390

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  188 bits (478), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 188/383 (49%), Gaps = 69/383 (18%)

Query: 147 FGSEVLTPKDDEKYQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCI 197
           F S+   PK    Y+++ N LF+  VE+         YDL+      +    ++ +L+  
Sbjct: 62  FTSKYKMPK--YSYKKKTNWLFNRHVEDIIPENHIAHYDLNKLHSTSDAAVNKEQVLILT 119

Query: 198 PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQI 257
           P++   D     +++L+ LTYP ELI+L F++     GD  L AL A  + +Q    +Q 
Sbjct: 120 PMQTFHDEF---WQNLLQLTYPRELIELGFILPRSDSGDAALKALEAAVKKVQTDKKNQR 176

Query: 258 FQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQV 317
           F +I  ++   ++G                                          FGQ+
Sbjct: 177 FSKI-TILRQDSQG------------------------------------------FGQL 193

Query: 318 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 377
           + +   +RHA+ VQ  RR  M  ARN L  + + P+ SWV W DAD+   P +VIQD+ +
Sbjct: 194 MEK---ERHALHVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTA 250

Query: 378 KNYDVIVPNVWRPLPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAE 431
            +  V+  NV++    +   E+       YD N+W ES   L +A  +++D++IVEGY+E
Sbjct: 251 HDKAVLAANVYQ---RYFDEEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSE 307

Query: 432 YPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFG 491
             T+R  +A+  D     N  + LDGVGG   L KA + R+G  FP F F +  ETE F 
Sbjct: 308 IATYRPLMAHFYDPTASVNSEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFA 367

Query: 492 KMAKKMGYRVGGLPHYTIWHIYE 514
           KMAK++ Y V GLP+Y ++H+ E
Sbjct: 368 KMAKRLNYEVFGLPNYLVYHMEE 390

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 180/370 (48%), Gaps = 67/370 (18%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++   LF+  VE+         YDL+      +    ++H+L+  P++         +
Sbjct: 75  YKKKSGWLFNDHVEDIIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YW 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ L+YP ELI+L F+    + GD  L  L    + +Q    +Q F +I  ++   ++
Sbjct: 132 DNLLQLSYPRELIELGFITPRTATGDLALKNLENAIKKVQTDKKTQRFSKI-TILRQNSQ 190

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA+ V
Sbjct: 191 SFDKLMEK---------------------------------------------ERHALDV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SW+ W DAD+   P S+IQD+   +  V+  N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ- 264

Query: 391 LPTFLGTEQ------PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              F   E+      PYD N+W ES   L +A  + +D++IVEGYAE  T+R  +A+  +
Sbjct: 265 --RFYDQEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYN 322

Query: 445 AEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
           A+G PNE + LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 323 ADGLPNEEMALDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGL 382

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 173/351 (49%), Gaps = 56/351 (15%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V +YDL+      +    ++ +L+  P++         + +L+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
            + GD  L  L A  +  Q    +  F ++  ++   +KG DKL  K             
Sbjct: 151 SASGDAALKQLEAAVKRAQTDKKNNRFGKV-TILRQDSKGFDKLQEK------------- 196

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 197 --------------------------------ERHALAVQKERRSAMALARNELLFSTIG 224

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTE-----QPYDLNSW 406
           P+ SWV W DAD+     S+IQD+ + N  V+  NV++    F   E     +PYD N+W
Sbjct: 225 PHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRY--FDEAENKPSIRPYDFNNW 282

Query: 407 MESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAK 466
            +SQ A  L   + +D++IVEGYAE  T+R  +A+    +G PNE + LDGVGG   L K
Sbjct: 283 ADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVK 342

Query: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 517
           A++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E +D
Sbjct: 343 AEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  186 bits (473), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 183/369 (49%), Gaps = 65/369 (17%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++ N LF+  VE+         YDL+      + +  ++H+L+  P++   +     +
Sbjct: 75  YKKKFNWLFNDRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YW 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
           ++L+ L+YP ELI+L F++     GD  L  L    +++Q+   +  F +I  ++  +++
Sbjct: 132 ENLLKLSYPRELIELGFIIPRSDAGDAALKKLETAVKNVQSDKKNNRFSKI-TILRQESQ 190

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RH++ V
Sbjct: 191 SFDKLEEK---------------------------------------------ERHSLAV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
           Q  RR  M  ARN L  + L P+ SWV W D+D+   P +VI+ +   +  V+  NV++ 
Sbjct: 206 QKERRAAMALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQR 265

Query: 391 LPTFLGTEQ-----PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA 445
              F   +Q     PYD N+W ES   L LA  + +D++IVEGYAE  T+R  +A+  + 
Sbjct: 266 F--FDNDKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNP 323

Query: 446 EGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLP 505
            GD  E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP
Sbjct: 324 SGDVGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLP 383

Query: 506 HYTIWHIYE 514
           ++ ++HI E
Sbjct: 384 NFLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  185 bits (469), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/380 (30%), Positives = 184/380 (48%), Gaps = 63/380 (16%)

Query: 147 FGSEVLTPKDDEKYQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCI 197
           F S+   PK    Y++  N +F+  ++E         +DL+      +    ++ +L+  
Sbjct: 65  FTSKFRIPK--YSYKKVQNWMFNEHIDEIISEGHIAEFDLNKLHSTKDASINKEKVLILT 122

Query: 198 PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQI 257
           PL+         +++++ L+YP ELI+L F+V     GD  L +L               
Sbjct: 123 PLQKFHQE---YWENILQLSYPRELIELGFIVPRTQTGDLALQSLE-------------- 165

Query: 258 FQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQV 317
                AV  +QT                            +  ++ F  V I ++D    
Sbjct: 166 ----KAVEKTQT----------------------------DKKNQRFAKVTILRQDSESF 193

Query: 318 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 377
                 +RHA+ VQ  RR  M  ARN L  + + P+ SWV W DAD+   P ++IQD+ +
Sbjct: 194 NKLAEKERHALNVQKERRSSMALARNELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTA 253

Query: 378 KNYDVIVPNVWRPL---PTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPT 434
            +  V+  NV++            +PYD N+W ES+  L LA  +++D++IVEGY+E  T
Sbjct: 254 HDKSVLAANVFQRYYDDEKKASATRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIAT 313

Query: 435 WRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMA 494
           +R  +AY  D     +E + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA
Sbjct: 314 YRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMA 373

Query: 495 KKMGYRVGGLPHYTIWHIYE 514
           K++GY + GLP+Y ++HI E
Sbjct: 374 KRLGYEIFGLPNYLVYHIEE 393

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  182 bits (462), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 114/362 (31%), Positives = 175/362 (48%), Gaps = 61/362 (16%)

Query: 165 NMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMN 215
           N LF  TVE+         YDL+      N    ++ +L+  P++   +     + +L+ 
Sbjct: 139 NWLFSDTVEDNIPPEQITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQ 195

Query: 216 LTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKL 275
           LTYP EL++L F++   + GD  L  L A                  AV  +Q    D+ 
Sbjct: 196 LTYPRELLELGFIIPRTTSGDNALRKLEA------------------AVKKTQLSKKDQR 237

Query: 276 YLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRR 335
           +LK                            + I ++D          DRHA++VQ  RR
Sbjct: 238 FLK----------------------------ITILRQDSQSFDLLKEKDRHALEVQKKRR 269

Query: 336 KLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWR---PLP 392
             M  ARN L  + + PY SWV W DAD+   P ++IQD+ + +  V+  NV++      
Sbjct: 270 SAMALARNELLFSTIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKK 329

Query: 393 TFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEA 452
           T   T+ PYD N+W +S  AL +A ++ +D V+ EGY E  T+R  +A+       P+  
Sbjct: 330 TGQKTKGPYDFNNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAE 389

Query: 453 VDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHI 512
           + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI
Sbjct: 390 MVLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHI 449

Query: 513 YE 514
            E
Sbjct: 450 EE 451

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  181 bits (458), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 118/382 (30%), Positives = 187/382 (48%), Gaps = 66/382 (17%)

Query: 147 FGSEVLTPKDDEKYQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCI 197
           F ++   PK   K +++ N LF+  V++         YDL+           ++ +L+  
Sbjct: 66  FTNKFKMPKYSYK-RKQSNWLFNDHVDDIIPEGHIAHYDLNKLRSTAYAAVNKERVLILT 124

Query: 198 PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQI 257
           P++         +++L+ LTYP ELI+L F++     G+  L  L    + +Q+   +Q 
Sbjct: 125 PMQTFHKQ---YWENLLQLTYPRELIELGFIIPRTKTGENALKELEIAIKKVQSDKKNQR 181

Query: 258 FQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQV 317
           F +I  ++   ++  D+L  K                                       
Sbjct: 182 FAKI-TILRQDSQSFDQLAEK--------------------------------------- 201

Query: 318 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 377
                 DRH++ VQ  RR  M  ARN L  + L P+ +WV W DAD+   P +VIQD+ S
Sbjct: 202 ------DRHSILVQKERRAAMALARNELLFSTLGPHTAWVLWLDADIIETPPTVIQDMTS 255

Query: 378 KNYDVIVPNVWRPLPTFLGTEQ-----PYDLNSWMESQEALALAKTLDEDDVIVEGYAEY 432
            +  V+  NV++    F   E+     PYD N+W ES   L +A  +DE+++IVEGY+E 
Sbjct: 256 HDKSVLAANVYQKY--FDNDEKKMAIRPYDFNNWRESDIGLEIAANMDENEIIVEGYSEI 313

Query: 433 PTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGK 492
            T+R  +A+  +A+G   + ++LDGVGG   L KA + R+G  FP F F +  ETE F K
Sbjct: 314 ATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAK 373

Query: 493 MAKKMGYRVGGLPHYTIWHIYE 514
           MAK++ Y V GLP+Y ++HI E
Sbjct: 374 MAKRLNYGVFGLPNYLVYHIEE 395

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  176 bits (446), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 170/345 (49%), Gaps = 51/345 (14%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           + +YD++      + L  ++ +L+  P++   D     +++L++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
              GD  +  L    + +Q+G  +Q F +I  ++   ++  +KL     DE         
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKENQRFLKI-TILRQDSQSFNKL-----DE--------- 196

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA  VQ  RR  M  ARN L  + + 
Sbjct: 197 -------------------------------KERHAFNVQKERRAAMALARNELVFSTIG 225

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTE--QPYDLNSWMES 409
           P  SW+ W DAD+   P +VIQD+ + +  ++  NV++        E  +PYD N+W ES
Sbjct: 226 PSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQES 285

Query: 410 QEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKI 469
           Q  L +A ++ +D++IVE Y E  T+R  +A + D  G P+  + LDGVGG   L KA++
Sbjct: 286 QTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQV 345

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            R+G  FP F F +  ETE F  MAK++ Y V GLP+Y ++H  E
Sbjct: 346 HRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  172 bits (437), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 164/348 (47%), Gaps = 57/348 (16%)

Query: 169 DSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           D  + EYDL+  +         + +L+  P++         + +L+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 229 VSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRV 288
           +   S G+T L  L    R +Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTGP----------------------------------- 172

Query: 289 HQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                       D+ F  + I ++DF        S RH   VQ  RR  M  ARN L  +
Sbjct: 173 -----------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 349 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQP----YDLN 404
            + PY SWV W D+D+   P ++I+D+ S N  ++  NV++    ++   +P    YDLN
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLN 278

Query: 405 SWMESQEALALAKTLDEDDVIVEGYA-EYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSI 463
           +W ES+  L +A  L ED +IVEGY  E+ T+R  +A++   +   +E + LDGVGG   
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 464 LAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
           L KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  166 bits (419), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/364 (28%), Positives = 176/364 (48%), Gaps = 60/364 (16%)

Query: 160 YQRELNMLFDSTVEE---------YDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+++ N LF+   E+         YDL+  + + N  E ++H+L+  PL++        +
Sbjct: 82  YKKKTNWLFNDRAEDTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YW 138

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTK 270
            +L+ L+YP + I+L F++    +GD +L  L +  + +Q       F +I  ++   +K
Sbjct: 139 DNLLKLSYPRDAIELGFIIPRTKKGDHSLKKLESAIKKVQTAKQGDKFSKI-TILRQNSK 197

Query: 271 GTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
           G + +     ++  ++ +           Y+K  R+                        
Sbjct: 198 GFETV----PEKKEVSEI----------EYEKQIRAE----------------------- 220

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 390
                  M  ARN L A+ L P  +W+ W D+D+   P S+IQD+   +  V+  NV+  
Sbjct: 221 -------MALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYER 273

Query: 391 LPTFLGTE---QPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEG 447
                  E   +PYD  +W+ES EAL LA  + ED++IVEG A   T R  + +    +G
Sbjct: 274 YKDRESGELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDG 333

Query: 448 DPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHY 507
            P+  + LDGVG   +L K+++ R+G  FP F F +  E+E F KMAK++ Y V GLP+Y
Sbjct: 334 SPSSEISLDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNY 393

Query: 508 TIWH 511
            ++H
Sbjct: 394 LVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  159 bits (403), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/341 (29%), Positives = 173/341 (50%), Gaps = 44/341 (12%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL+    + N LE ++H+L+  PL++  +     +++L+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
             +GD  L       + L+N    +  Q ID  + S  K      L+  D G+    H+ 
Sbjct: 159 TKKGDQIL-------KQLENAV--KNVQGIDKKLGSN-KFAKITILRQKDSGF----HK- 203

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
               F++  DK                     + + ++++  +R  M  ARN L ++ L 
Sbjct: 204 ----FNDRKDK--------------------KEMNDIELEKEKRAEMALARNELLSSTLS 239

Query: 352 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFL--GTEQPYDLNSWMES 409
              +W+ W D++V   P ++IQD+   +  V+  NV+            +PYD  +W+ES
Sbjct: 240 HSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNWIES 299

Query: 410 QEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKI 469
             AL LA  + ED++IVEG A   T R  +    +++G P E + LDG+G    L K+++
Sbjct: 300 DTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKSEV 359

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIW 510
            R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++
Sbjct: 360 HRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 88/175 (50%), Gaps = 3/175 (1%)

Query: 335 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTF 394
           RK +   +N L  + L PY SWV W D+ +   P +++QDL +    ++  +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSD-- 240

Query: 395 LGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVD 454
            G+     LN+W+ S    +LA  +    V++EG +   T R  +    DA       ++
Sbjct: 241 -GSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 455 LDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTI 509
           LD V     L KA++ R+G  FP F F +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 172 VEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  Y+L+    +P+     +HIL+ IPL N        F++L  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 232 CSEGDTTLDAL 242
                  L AL
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 90/210 (42%), Gaps = 35/210 (16%)

Query: 324 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVI 383
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  +++  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 384 VPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVH--LAY 441
           VP + R     +G+++ YD N+W+         +T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGE-------RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 442 IRDA----------EGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTF---------- 481
           ++D           E   +  V+LD VGG  +    KIF  G+QFP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 482 ENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
            +  ETE     AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 303

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           C+ G      L+   R LQN +L+ IF E       + +  D+ +++  DE  I R+ Q
Sbjct: 236 CNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDEDKIKRIAQ 294

>Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON}
           (106636..107478) [843 nt, 281 aa]
          Length = 280

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQ 290
           C+ G      LI   R LQN +L+ IF E       + +  D+ +++  D+ YI +V +
Sbjct: 213 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIELYDDIYIKKVAE 271

>TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.296
           YNL032W
          Length = 264

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRV 288
           C+ G      LI   R LQN +L+ IF E       + +  D+ +++  D+ YI  V
Sbjct: 197 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFSFPKARALDQQFIELYDDKYIKEV 253

>Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
           C+ G      LI   R LQN +L+ IF E       + +  D+ +++  D+  I R+ + 
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRIARG 273

Query: 292 FS 293
            S
Sbjct: 274 NS 275

>YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyrosine
           phosphatase that plays a role in actin filament
           organization and endocytosis; localized to the cytoplasm
          Length = 281

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRV 288
           C+ G      LI   R LQN +L+ IF E       + +  D+ +++  D+  I R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRV 288
           C+ G      LI   R LQN +L+ IF E       + +  D+ +++  D+  I R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {ON}
           Anc_2.503 YKL007W
          Length = 274

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 262 DAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQG 321
           D  +++Q  G   L + Y + G +    +      + N  +  ++++ F+ DF + +   
Sbjct: 173 DPSLNNQLTGKIDLNVHYFEGGNVTFNSEKSFKEDNVNLSEILKTIKSFESDFEKQLDVS 232

Query: 322 FSDRHAVKVQGIRRKL-MGRAR-NW 344
           F+D +  K + +RR+L + RAR NW
Sbjct: 233 FNDLNEKKFKTLRRRLPVSRARVNW 257

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 14/87 (16%)

Query: 428 GYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAET 487
            + E+P W   + Y+ + EG         G+GG     KA +FR      A  ++N  ++
Sbjct: 202 AFMEHP-WSKLVHYVINLEGT--------GIGG-----KAVLFRTSDVSTAKIYQNAVKS 247

Query: 488 EAFGKMAKKMGYRVGGLPHYTIWHIYE 514
             FG    + G+  GG+   T + IYE
Sbjct: 248 NPFGNSLFQQGFYEGGVGSETDYRIYE 274

>Kwal_55.20652 s55 complement(505826..507910) [2085 bp, 694 aa] {ON}
           YLL032C - Hypothetical ORF [contig 142] FULL
          Length = 694

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 366 LCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVI 425
           +CP         +N ++I  N+W+PLP  L   Q +D++   E +EA+ L      D+V+
Sbjct: 8   ICPLRTTIFFKPENSELISQNLWQPLP--LDQAQQFDIDG--EQKEAIGLVP----DNVV 59

Query: 426 VEGYAEY 432
           +  + ++
Sbjct: 60  IHSFEKF 66

>NDAI0G00770 Chr7 complement(162781..163800) [1020 bp, 339 aa] {ON}
           Anc_2.296
          Length = 339

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRV 288
           C+ G      L+   R LQN +L+ IF E       + +  D+ +++  D+  I R+
Sbjct: 272 CNRGKHRTGCLVGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDKEIKRI 328

>Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, 469
           aa] {ON} ANNOTATED BY YGOB -
          Length = 469

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 54/138 (39%), Gaps = 32/138 (23%)

Query: 235 GDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKL------YLKYMDEGYINRV 288
           GD TL+ +I   +   N  L+++   I  ++   T  +  L      Y  ++ E Y    
Sbjct: 237 GDVTLEQVINSCKLEVNAVLNELSIRIPELLVGTTHSSVTLAKVNDFYNSFITEYYNYTY 296

Query: 289 HQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT-- 346
           HQ+ S       DK   ++ + Q   G V             + IRRKLMG A   L+  
Sbjct: 297 HQSRS-------DKIIHTLAVSQNTSGSV------------ARIIRRKLMGFATLILSLL 337

Query: 347 -----ANALKPYHSWVYW 359
                    K  HSWV+W
Sbjct: 338 VALLEVTPAKFAHSWVFW 355

>NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296
          Length = 349

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%)

Query: 232 CSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQA 291
           C+ G      LI   R LQN +L+ IF E       + +  D+ +++  D+  I R+ ++
Sbjct: 282 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDEGIKRIAKS 341

>Suva_10.416 Chr10 (733026..737390) [4365 bp, 1454 aa] {ON} YLR320W
            (REAL)
          Length = 1454

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 185  NGLETRDHILLC--IPLRNAADVLPLMF---KHLMNLTYPHELIDLAFLVSD-CSEGDTT 238
            + L  R HI+    IP  N  ++L L+F   K L   +Y   L  L  L  + C +GD +
Sbjct: 1148 SNLLKRGHIIATDLIPASNEKELLKLVFLFSKALQKYSYQDLLFTLLALAKNHCEDGDIS 1207

Query: 239  LDALIAYSRHLQNGTLSQI 257
             D L  Y   L    L+++
Sbjct: 1208 RDFLAKYLEFLNKNCLTEL 1226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,307,940
Number of extensions: 2507651
Number of successful extensions: 8300
Number of sequences better than 10.0: 88
Number of HSP's gapped: 8411
Number of HSP's successfully gapped: 131
Length of query: 535
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 421
Effective length of database: 40,409,475
Effective search space: 17012388975
Effective search space used: 17012388975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)