Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML114C (TAF8)8.838ON51051024780.0
Smik_13.208.838ON51051020680.0
Suva_13.298.838ON50951018470.0
Skud_13.278.838ON51451418240.0
NCAS0B003108.838ON5644375585e-64
ZYRO0G14146g8.838ON5073855381e-61
Kpol_1068.108.838ON6173495031e-55
TDEL0B005908.838ON5413874912e-54
Kwal_27.102728.838ON5515024552e-49
ABL128W8.838ON4743614415e-48
NDAI0E003008.838ON6645254435e-47
Ecym_46098.838ON5205324279e-46
KLTH0C03916g8.838ON5703604254e-45
TPHA0I002308.838ON6143844195e-44
SAKL0D01518g8.838ON5744014062e-42
TBLA0D032508.838ON6834803529e-35
KAFR0A028208.838ON4533453395e-34
KLLA0D01617g8.838ON5623923048e-29
KNAG0G034108.838ON5263912391e-20
CAGL0B02299g8.838ON643591501e-09
Ecym_13371.364ON67370790.46
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML114C
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   959   0.0  
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   801   0.0  
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   716   0.0  
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   707   0.0  
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   219   5e-64
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   211   1e-61
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   198   1e-55
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   193   2e-54
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   179   2e-49
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   174   5e-48
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   175   5e-47
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   169   9e-46
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   168   4e-45
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   166   5e-44
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   160   2e-42
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   140   9e-35
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   135   5e-34
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   121   8e-29
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    97   1e-20
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    62   1e-09
Ecym_1337 Chr1 complement(697548..699569) [2022 bp, 673 aa] {ON}...    35   0.46 

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/510 (93%), Positives = 477/510 (93%)

Query: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA
Sbjct: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120
           LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI
Sbjct: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120

Query: 121 KSKHSTEYEKLMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLP 180
           KSKHSTEYEKLMSWSSLAALPH                    VLLPPSNPLEKQIPSWLP
Sbjct: 121 KSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240
           NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240

Query: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300
           LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR
Sbjct: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300

Query: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360
           TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE
Sbjct: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360

Query: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420
           ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN
Sbjct: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420

Query: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDXXXXXXXXXXXXXIDA 480
           AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQD             IDA
Sbjct: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDTTNTTPVAHNTTNIDA 480

Query: 481 TTSHSPHSTPNENAPTSPPADIATDHDITM 510
           TTSHSPHSTPNENAPTSPPADIATDHDITM
Sbjct: 481 TTSHSPHSTPNENAPTSPPADIATDHDITM 510

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/510 (77%), Positives = 424/510 (83%)

Query: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MT + S S +GTQ TIVQLR LPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA
Sbjct: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120
           LDELVNLV VQMDGMFRNLHNLTLLQRRS+ASQADLKLL REFN+DA SLYQQFQ SEFI
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120

Query: 121 KSKHSTEYEKLMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLP 180
           KS H+ EY KL+  SS  AL H                    VLLPPSNPLEK IPSWLP
Sbjct: 121 KSNHAVEYGKLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240
           NFPPDHTYKFTPEFNHPITDLKTIKKEIVKES+ESEKALLNLNK LSH+SSAS+T  PP 
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPV 240

Query: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300
           LDD DA EQQLEIWGNAL+ERKPTIT  S NE+NIEQYAKYRVELARERV KFE+NQLKR
Sbjct: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300

Query: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360
           TKNPFLK+SETLY  E PHQSHKTIQ  I+LQFRKSMTLFMHNLPKVQKLKKE+IRMAKE
Sbjct: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360

Query: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420
           ERAKSL+RRQEELIS+R KREQDEGHDLELLLNNEHAR+A D+ TTPN  NNSTI+IN N
Sbjct: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPNVANNSTIIINAN 420

Query: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDXXXXXXXXXXXXXIDA 480
           A DEDDD+NLFGILGSSEDENE+SSMP ENL  ESEPPTM  QD             +DA
Sbjct: 421 ANDEDDDMNLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480

Query: 481 TTSHSPHSTPNENAPTSPPADIATDHDITM 510
           T + S HST +EN PTSPP  +ATD+DITM
Sbjct: 481 TANRSTHSTLSENTPTSPPTAMATDNDITM 510

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/510 (71%), Positives = 407/510 (79%), Gaps = 1/510 (0%)

Query: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MTS T ESG+G   T+VQL NLPDLTE+SHLEIDAPV+EILKK+VLFQLNSLNICISNFA
Sbjct: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120
           LDE+VNLV VQMDGMFRNLHNL LLQRRSQ SQADLKLL REFNL++ SL+QQ Q SE I
Sbjct: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120

Query: 121 KSKHSTEYEKLMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLP 180
           KSKHS EYEKL+  SS  A+ H                    VLLPPSNPLEK IPSWLP
Sbjct: 121 KSKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240
           NFPPDHTYKFTPEFNHPITDLKTIK+EIVKES ESE+ALLNLNK L  ISSAS+TP P  
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL 240

Query: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300
            D  DA E+ LEIWGN L ERKP I  KSFNE NIEQYAKYR+ELARERV+KFEVNQLKR
Sbjct: 241 PDASDASER-LEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKR 299

Query: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360
           TKNPFLKISE+LY  ++PHQSHK IQ++I+LQ RKS+TLFMHNLPKVQKLKKEKI++AKE
Sbjct: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359

Query: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420
           ER KSLKRRQEELISQR K+EQDEGHDLELLLNNE AR++ D+ T  NALN STI IN N
Sbjct: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTIDINAN 419

Query: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDXXXXXXXXXXXXXIDA 480
           A+ +DDD+NLFGILGSSEDENE+SS+  E +  ESEPPT  A+D             ID 
Sbjct: 420 ADGDDDDMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDTTNTTPVAQNTTNIDT 479

Query: 481 TTSHSPHSTPNENAPTSPPADIATDHDITM 510
           T + S  STPNENAPTSPP   ATD+DI +
Sbjct: 480 TANFSILSTPNENAPTSPPTATATDNDINI 509

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/514 (72%), Positives = 411/514 (79%), Gaps = 4/514 (0%)

Query: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MTS TSESG GT+ T+VQL+NLPDLTEISHL+IDAPVVEIL+KTVLFQLNSL+ICISNFA
Sbjct: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60

Query: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120
           LDELVNLV VQMDGMFRNLHNL LLQRRS+A+QADLKLL +EFNLD  SLYQQ Q SEFI
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120

Query: 121 KSKHSTEYEKLMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLP 180
           KS HS EYEKL+S SS +A  H                    VLLPPSNPLEK +PSWLP
Sbjct: 121 KSNHSVEYEKLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240
           NFPPDHTY+FTPEFNHPITDLKTIK+EIVKES+ESEKALLNLNK L HIS AS+ P P  
Sbjct: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRL 240

Query: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300
            DD DA EQQLEIWGNAL+E K T   KSFNENNIEQYAKYRVELARERV+KFEVNQLKR
Sbjct: 241 PDDADAGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300

Query: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360
           TKNPFL+ISETLY  +SPHQ H+ IQ+ I+LQFRKSM LF HNLPKVQKLKKEKIRMA E
Sbjct: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360

Query: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420
           ER++SLKRRQEELI +R KREQDEGHDLELLL+NEHAR++ ++ T PNA ++ TI IN N
Sbjct: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTIDINAN 420

Query: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDXXXXXXXXXXXXXIDA 480
           A+DEDDD+NLFGILGSS DENE  S+   N+  E EPPT T QD             IDA
Sbjct: 421 ADDEDDDMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480

Query: 481 TTSH----SPHSTPNENAPTSPPADIATDHDITM 510
           T ++    S  STPNENAPTSPP   ATDHDITM
Sbjct: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  219 bits (558), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 153/437 (35%), Positives = 243/437 (55%), Gaps = 30/437 (6%)

Query: 26  TEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMFRNLHNLTLL 85
           TEI     D  V ++L K++  QL  LN+ +S  A +EL  LV  Q+D +   LH ++++
Sbjct: 37  TEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVI 96

Query: 86  QRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSSLAALPHXXX 145
           QRR+ A++ D++LLLR  NL+   L+ Q Q S F+KSK+  +Y+ L+  SS         
Sbjct: 97  QRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTI---FDSS 153

Query: 146 XXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFNHPITDLKTIK 205
                            +L+ P+NP E  IP+WLP FPPDHTYKFTP+FN PITD   IK
Sbjct: 154 DTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIK 213

Query: 206 KEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQLEIWG-NAL--EERK 262
           +++++E ++SEK+LLNL   ++  SS  N  +    D E A E+ + I+G +A+  ++RK
Sbjct: 214 QKLIEEGKKSEKSLLNLLNDITEQSSIENE-ETSNFDSELAREENIAIYGYDAMSRKKRK 272

Query: 263 P----TI--TEKSFNEN-------NIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKIS 309
           P    +I  TE++F  +       N+  YA +RVEL R+RV +FE+ QLK  KNPFL++S
Sbjct: 273 PPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLS 332

Query: 310 ETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMA---KEERAKSL 366
             +        S   ++  I+   ++S      N PK+++ +  ++ +A   +EE+ + L
Sbjct: 333 RMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKL 389

Query: 367 KRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTNAED-ED 425
           K + E+L   +  R+      L +  + E+ +  ++ T   +   N    I TN ED ED
Sbjct: 390 KIQNEQL---KKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIATNIEDVED 446

Query: 426 DDINLFGILGSSEDENE 442
           D I LFG L SS+++N+
Sbjct: 447 DGIGLFGDLESSDEDND 463

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  211 bits (538), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/385 (33%), Positives = 219/385 (56%), Gaps = 26/385 (6%)

Query: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMF 76
           +Q+  LP L E+ H + +  VV++L K+V  QL  +N  I+ FA D L+ LV  Q++ M 
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64

Query: 77  RNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSS 136
             LH ++ LQRR   ++ D+ +L+  FN+   S+  Q + SEF   K+  E+  L S   
Sbjct: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRD 124

Query: 137 L-AALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFN 195
           L ++L H                    VL+PP+NPL+  +P WLP+FPPDHTYKFTP+++
Sbjct: 125 LQSSLAHEMVPFEDQEAVRQNVST---VLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYS 181

Query: 196 HPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQLEIWG 255
           HPITD  TI+++IV+E+++SE AL +L++  +      N  Q    D E A ++ L I+G
Sbjct: 182 HPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQ---YDSELAEQETLAIYG 238

Query: 256 NALEERK------------PTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKRTKN 303
           + L++RK              + + +F   ++E+YA  R+E+AR++V +FE  QL+  ++
Sbjct: 239 SQLKKRKTQHPQANSADLLSKLPQTNF---SVEEYAHNRIEVARKKVLEFEERQLQSQQD 295

Query: 304 PFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEERA 363
           PFLK+S   +   +   + K + +  +L  ++S    + ++P++++ K E    AKEER+
Sbjct: 296 PFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERS 355

Query: 364 KSLKRRQEELISQRTKREQDEGHDL 388
           K L    +EL +QR ++E+    D+
Sbjct: 356 KRL----QELRAQREEQEKKGERDV 376

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  198 bits (503), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/349 (35%), Positives = 188/349 (53%), Gaps = 14/349 (4%)

Query: 10  TGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNL 67
           TG  +  +QL  LP LTE  + E +  + +IL K V  QL S+N    I+ FA + L++L
Sbjct: 2   TGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSL 61

Query: 68  VTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTE 127
           V  Q+D M   LH L+ LQRR+  ++AD+ + LR FNL    L +Q Q S+++   +  +
Sbjct: 62  VVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKD 121

Query: 128 YEKLMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLPNFPPDHT 187
           YE L   ++                           L+P SNPL+K IPSWLP+FPPD+T
Sbjct: 122 YESLTKIATTTTRTLSTYQKLDLTHKDTSTAQTSK-LVPISNPLQKLIPSWLPDFPPDYT 180

Query: 188 YKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAI 247
           YKFTP++N PITD   I++++V+E ++SEKALLNL +        S   +    + E A 
Sbjct: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRG-GQEDRISRDLKFSSSEMELAT 239

Query: 248 EQQLEIWGNALEERKPTITEKSFNEN-------NIEQYAKYRVELARERVTKFEVNQLKR 300
           E+ L  +  A+  R   +T  SF E        N+E+YA+ RVE+ R++V  +E  QL+ 
Sbjct: 240 EETLATYS-AITLRNKHLT--SFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQI 296

Query: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQK 349
            +NPFLKIS  +        S       I    ++S+  F+H++PK Q+
Sbjct: 297 QRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  193 bits (491), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/387 (31%), Positives = 209/387 (54%), Gaps = 24/387 (6%)

Query: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMF 76
           +QL +LP L EI H + +A VV+IL K V  QL  +   IS FA + L+ L+  Q++ M 
Sbjct: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69

Query: 77  RNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSS 136
             LH  + +QRR   ++ D+ L L+ +NL    L +Q QAS++    +  E++ L S   
Sbjct: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKE 129

Query: 137 LAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFNH 196
                                      L+ P+NPL + IP W+P FPPDHTYKFTP++N 
Sbjct: 130 --------TFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQ 181

Query: 197 PITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAI--EQQLEIW 254
           PITD   I++ IV E ++SE ALL+L K+++  + +S+     G   ++A+  E+   I+
Sbjct: 182 PITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDA---DGASYDEALVREETAAIY 238

Query: 255 GNALEERKPTITEKSFNEN-------NIEQYAKYRVELARERVTKFEVNQLKRTKNPFLK 307
           GN  ++RK   +  S   +       +IE+YA+ RVE+AR++V ++E  Q+K  +NPF+K
Sbjct: 239 GNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIK 298

Query: 308 ISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMA---KEERAK 364
            S+      S     +   + I    ++S+   + ++P++Q  K++  R A   ++ER +
Sbjct: 299 YSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQ 358

Query: 365 SLKRRQEELISQRTKREQDEGHDLELL 391
            L+ ++ + +   T ++ + G D+ LL
Sbjct: 359 ELRDKKAQKLKNFTDQQLENG-DINLL 384

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  179 bits (455), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 244/502 (48%), Gaps = 60/502 (11%)

Query: 16  IVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNLVTVQMD 73
           +VQL+NLP L EI   ++D P+ ++L+K +  QL S+N    IS  A + L+ LV   + 
Sbjct: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77

Query: 74  GMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMS 133
            M  +LH +  +QRR   S+ DL L++  +NL +  L  + + S +++S+H  + +K+  
Sbjct: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137

Query: 134 WSSLAALPHXXXXXXXXXXXXX-----XXXXXXXVLLPPSNPLEKQIPSWLPNFPPDHTY 188
            S                                 L+PPS    K +P WLP+FPPDHTY
Sbjct: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197

Query: 189 KFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIE 248
           +FT ++N PITD + +K+++ +E+  SEKAL++L+  LSH  ++S       + +E   E
Sbjct: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKALIHLS-MLSHEEASSGPIDSDTIYEEAQQE 256

Query: 249 QQLEIWGNALEERKPTITE-----KSFNENN--IEQYAKYRVELARERVTKFEVNQLKRT 301
            QL ++G   +++   I E     ++  + N  +E+YA+ RVE+AR RV ++E +QL+  
Sbjct: 257 TQL-LFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQ 315

Query: 302 KNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEE 361
           K  F+K +  L        S K ++K I     +S    + + P +++ +K +I +A+E 
Sbjct: 316 KGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALAEEN 375

Query: 362 RAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTNA 421
           R    + R E+L  +R  R +                            +N   V++ N 
Sbjct: 376 R----RLRDEKLRKEREARSKS---------------------------SNEFDVLDLNN 404

Query: 422 EDEDDDINLFGILGSSEDENEMSS-MPAENLVAESEPPTMTAQDXXXXXXXXXXXXXIDA 480
            +ED     FG LGSS+ E+E      A + V+ESE   +T QD             + A
Sbjct: 405 LNEDP---FFGGLGSSDSEDEQQQEEKATDGVSESEKQQIT-QD-------EAALDTVKA 453

Query: 481 TTSHSPH-STPNENAPTSPPAD 501
           +    PH S  N+ AP +  AD
Sbjct: 454 SPPTEPHVSNTNDQAPEASVAD 475

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  174 bits (441), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 114/361 (31%), Positives = 192/361 (53%), Gaps = 25/361 (6%)

Query: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFALDELVNLVTVQMDG 74
           +QL+ LPDLTE++      P+ ++L + V   L ++  ++ I+    + LV  V +Q+D 
Sbjct: 19  IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75

Query: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134
           M + LH    +QRR++ S  D++L L    ++  SLY+++  S++++ +H+     +   
Sbjct: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135

Query: 135 S-SLAALPHXXXXXXXXXXXXXXXXXXXXV----LLPPSNPLEKQIPSWLPNFPPDHTYK 189
           S SL    H                    V    L+PP+N     +P WLP FPPDHTYK
Sbjct: 136 SASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYK 195

Query: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQ 249
           FT  +N PITD + +K+++ +ES+ SEKALL++  + +    A +   P  +   D  ++
Sbjct: 196 FTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIIS--DGQQE 253

Query: 250 QLEIWGNALEERKPTITEKSFNEN-NIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKI 308
            L I+G    ER+    E +     NIE YA+ RVELAR RV +FE  +L+  KNPF++ 
Sbjct: 254 NLLIYG---PERRRLAPEPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRA 310

Query: 309 SETLYLPESPHQSHKTIQKTIELQF----RKSMTLFMHNLPKVQKLKKEKIRMAKE-ERA 363
           +       SP+ + +  +K IE +F     +S    +H +P++++ K  ++  A E ERA
Sbjct: 311 AAAC----SPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAAYERERA 366

Query: 364 K 364
           +
Sbjct: 367 R 367

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  175 bits (443), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 149/525 (28%), Positives = 246/525 (46%), Gaps = 136/525 (25%)

Query: 27  EISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMFRNLHNLTLLQ 86
           EI+H  +D  + ++L+K++  QL +  +  S  A ++L  LV  Q++ +   LH L+LLQ
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79

Query: 87  RRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHST-EYEKL--MSWSSLAALPHX 143
           RR+  ++ DL+L +R FN++   L  Q+++S++I+ K S  EY  L  ++   +    H 
Sbjct: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139

Query: 144 XXXXXX--------XXXXXXXXXXXXXVLLPPSNPLEK-QIPSWLPNFPPDHTYKFTPEF 194
                                      +L+ P+NP +   I SWLP+FPPDHTYKFTP+F
Sbjct: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199

Query: 195 NHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASN-----TPQPPGLDDEDAI-- 247
           N+PITD K IK+++V+E  +SEKALLN  K++S+    ++      P  P L +E  I  
Sbjct: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259

Query: 248 --------------------------------EQQLEIWGNALE----ER----KPTI-- 265
                                           E+ L I+G   +    ER    KP I  
Sbjct: 260 TDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319

Query: 266 --------------TEKSFNENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISET 311
                         ++K F+ N   +Y+ +RVEL R++V  FE  +L+  KNPFLK+S+ 
Sbjct: 320 IHDEKIVNFFGHSSSDKKFDVN---KYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKL 376

Query: 312 LYLPE-----------------------------SPHQSHKTIQKTIELQFRKSMTLFMH 342
           + L +                             SP +    I   I    ++S    ++
Sbjct: 377 VCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILN 436

Query: 343 NLPKVQKLKKEKIRMA---KEERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARD 399
           N PK++K KK+++++A   +++R + L++ QEE   +R  +EQ      +LL  +E+   
Sbjct: 437 NYPKLKKAKKQRVKLAIEKRDQRLQELRKIQEE---ERKVKEQ------KLLTKSEN--- 484

Query: 400 AADDTTTPNALNNSTIVINTNAED-------EDDDINLFGILGSS 437
                  P   +N++IV +T+  D        +D + LF  LGSS
Sbjct: 485 -------PLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSS 522

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  169 bits (427), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 141/532 (26%), Positives = 248/532 (46%), Gaps = 81/532 (15%)

Query: 4   KTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFAL 61
           K+S+  T      +QL+ LP L E++      P+  +L ++V  QL ++  +  I+    
Sbjct: 6   KSSDGSTEGAKEFIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGF 62

Query: 62  DELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIK 121
           + ++  + +QM+ MF+ LH    +QRR++ S  DLKL L+   ++  SLY +F+ S +IK
Sbjct: 63  NNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIK 122

Query: 122 SKHSTEYEKLMSWS-SLAALPHXXXXXXXXXXXXXXXXXXXXV----LLPPSNPLEKQIP 176
             +  E++ +   S  L                         V    L+PP+N     +P
Sbjct: 123 KTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVP 182

Query: 177 SWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSL---------- 226
           +WLP FPPDHTYKFT  +N PI+D + +K+ + +E + SEKALLN+  S           
Sbjct: 183 TWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDE 242

Query: 227 -----SHISSASNTPQPPGLDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKY 281
                ++  S   T    G++ +    +   + GN+       +        NI++YA+ 
Sbjct: 243 ETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARS 302

Query: 282 RVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPH-QSHKTIQKTIELQF----RKS 336
           R+ LAR +V +FE ++L+  KNPF++ S       SP+  + KT +K  E +F    R+S
Sbjct: 303 RIGLARRKVEEFENHKLQAQKNPFIRASSIC----SPYGNAQKTTRKAAEREFNILLRRS 358

Query: 337 MTLFMHNLPKVQKLKKEKIRMAKEERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEH 396
               + ++PK+++LK  ++  A E                   RE+ +  + E+ L  +H
Sbjct: 359 YVGVLKSIPKLRQLKANEMAAAIE-------------------RERIKQKEREMELEKKH 399

Query: 397 ARDAADDTTTPNALNNSTIVINTNAEDEDDDINLFGI----LGSSEDENEMSSMPAENLV 452
            +    D    NAL+   ++ + ++ D +DD  + G     LG SE  N +    A+ ++
Sbjct: 400 LQQGVVDL---NALHEDALLADLDSTDSEDDEPMMGSKKQELGFSEIANPLQ---AKKIL 453

Query: 453 AESEPPTMTAQDXXXXXXXXXXXXXIDATTSHSPHSTPNENAP----TSPPA 500
           A+     +++               I++T+S  P S P +  P    T+PPA
Sbjct: 454 AQDSTLNVSSD--------------IESTSSARPSSKPPQQQPLQDVTTPPA 491

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  168 bits (425), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 112/360 (31%), Positives = 188/360 (52%), Gaps = 17/360 (4%)

Query: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDG 74
           VQLR+LP+L EI    +D P+ ++L+K V  QL ++N  + IS FA + L+ LV   +  
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134
           M  +LH +  +QRR   S+ DL L++  +NL    L  + + S++++S +     K+   
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREE 138

Query: 135 SSLAALPHXXXXXXXXXXXXX-----XXXXXXXVLLPPSNPLEKQIPSWLPNFPPDHTYK 189
           S +                               L+PP+    K +P WLP FPPDHTY+
Sbjct: 139 SEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198

Query: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQ 249
           FT +FN PITD + +K+++ +E+  SEKAL++L+K LSH  S S       +  E   + 
Sbjct: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-LSHEESPSEGADSDEIFKESQQDT 257

Query: 250 QLEIWGNALEERKPTITEKS-------FNENNIEQYAKYRVELARERVTKFEVNQLKRTK 302
           QL I+G A + +   I   S           N+E+YA+ RVE+AR +V ++E +QL   K
Sbjct: 258 QL-IFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQK 316

Query: 303 NPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEER 362
             F+K +  L  P +  ++ K ++K +     +S    + + P +++ +K ++ +A+E R
Sbjct: 317 GAFIKAAHLLS-PFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAEENR 375

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  166 bits (419), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 121/384 (31%), Positives = 185/384 (48%), Gaps = 26/384 (6%)

Query: 13  QSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTV 70
           Q   VQL  LP LTE  + +   P+  IL K +  QL  +N    I+ FA   L +LV  
Sbjct: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDE 101

Query: 71  QMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEK 130
           Q+  M   +  L  LQRR + ++ D+ L LR FNL    L    Q SE+IK K+  E   
Sbjct: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTL 161

Query: 131 LMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVL--LPPSNPLEKQIPSWLPNFPPDHTY 188
           L   + LA   +                     L  +P +N LE  IP WLP+FPPD+TY
Sbjct: 162 L---NRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTY 218

Query: 189 KFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIE 248
           KFTP+FN  ITD   I+K++  E ++SEKALL+L +S    +S          DD D  +
Sbjct: 219 KFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAK 278

Query: 249 QQLEIW--GNALEERKPTI-------------TEKSFNENNIEQYAKYRVELARERVTKF 293
            +++    G + + +K T                 + N+ +IE+Y   R+ + R +V ++
Sbjct: 279 LEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQY 338

Query: 294 EVNQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKE 353
           E  QL+   +PFLK++  L        S + I   IE   ++S    ++++P + + KK+
Sbjct: 339 EDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKD 398

Query: 354 KIRMAKEERAKS----LKRRQEEL 373
               A  E+ +     LKRR+E+L
Sbjct: 399 TRERAMVEKKRRHDEWLKRREEKL 422

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  160 bits (406), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 206/401 (51%), Gaps = 35/401 (8%)

Query: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDG 74
           ++L+ LP L    H  ++ P+ +IL + V  +L  +N  + +S FA + LV LV+  +  
Sbjct: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78

Query: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134
           M   LH    +QRR + S+ DL LLL+ ++L    L ++ ++S++I S H  +  K+   
Sbjct: 79  MLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQK 138

Query: 135 S----SLAALPHXXXXXXXXXXXXXXXXXXXXV-LLPPSNPLEKQIPSWLPNFPPDHTYK 189
           S    S    P                     + L+PP+N   + IP WLP FPPDHTY+
Sbjct: 139 SKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYR 198

Query: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDD------ 243
           FT ++N P+ D + +++++V+E ++SE+AL+NL   L H  S   T Q  G ++      
Sbjct: 199 FTSQYNKPVVDERQLRRKLVEEGKQSERALVNL---LKHHDS---TNQDLGNNERVEKRS 252

Query: 244 --EDAIEQQLEIWGNALEERKPTITEKS--------FNENNIEQYAKYRVELARERVTKF 293
             E+  E+   I+G   E +K   TE S            ++E+YA+ RVE+AR +V ++
Sbjct: 253 LYEETQEETFLIFGP--ERKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEY 310

Query: 294 EVNQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKE 353
           E  QL+  KNPF+K +      +    S K I K ++   ++S    + ++PK+ ++K  
Sbjct: 311 EQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKAR 370

Query: 354 KIRMAKEERAKSLKRRQEELISQRTKREQDEGHDLELLLNN 394
           +  +A E R + L++  EE    R ++ +  G D  L LNN
Sbjct: 371 ERELANERRREMLEKLNEE----RQRQAEAGGGDEVLDLNN 407

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  140 bits (352), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 130/480 (27%), Positives = 206/480 (42%), Gaps = 104/480 (21%)

Query: 12  TQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVT 69
           T S    L+NLPDL +  +    + + ++L K++  QL  +N    IS  A + L+ LV 
Sbjct: 35  TSSNTQLLKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVD 94

Query: 70  VQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEY- 128
           +Q++ M   L  L++ QRR   +  DL L LR FNL+   L    + S FIKSK + +Y 
Sbjct: 95  LQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYN 154

Query: 129 ---EKLMSWSSLAALPHXX-XXXXXXXXXXXXXXXXXXVLLPPSNPLEKQIPSWLPNFPP 184
              E L  +++                            ++PPSN + + +P WLP+ PP
Sbjct: 155 LLYELLRDYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPP 214

Query: 185 DHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDE 244
           DHTYKFTP +N PITD   +KK +V E + +E AL+ L ++ +  +S  N+   P  D E
Sbjct: 215 DHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEAST--TSEINSLPTPETDRE 272

Query: 245 DAIEQQLE---------------------------------------IWGNALEERK--- 262
           + +EQ +                                        I+G+AL+ RK   
Sbjct: 273 NDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKK 332

Query: 263 ------PTITEKSFNEN-------NIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKIS 309
                     E   +E        N+E+YA+ +V+  RE+V  +E  QL+  KNPF K S
Sbjct: 333 RFELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYS 392

Query: 310 ETLYLPES------------------------------------PHQSHKTIQKTIELQF 333
           + +  P                                         S K I   I+  F
Sbjct: 393 KMIVGPSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMF 452

Query: 334 RKSMTLFMHNLPKVQKLKKEKIRMAKEERAKS----LKRRQEELISQRTKREQDEGHDLE 389
            +S+   +++LP + K K     +A+ ER K     LK++Q+EL  +++     + HDL+
Sbjct: 453 NRSLNNLINSLPNLAKEKASAREIAENEREKKVQEMLKKKQKELNEKQSSAGALDLHDLQ 512

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  135 bits (339), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 175/345 (50%), Gaps = 40/345 (11%)

Query: 40  ILKKTVLFQLNSLNIC--ISNFALDELVNLVTVQMDGMFRNLHNLTLLQRR-SQASQADL 96
           +L K+V  +L  +N+   + N A D L+ L+ VQ++ + + L  L+LLQRR S A+++D+
Sbjct: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88

Query: 97  KLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSSLAALPHXXXXXXXXXXXXXX 156
            LLL+ FNL    L  + + S  IK  +S E EK +S  S+    H              
Sbjct: 89  LLLLKGFNLSESELNTELEISNHIKRLYS-EDEKKLSEDSIHYNQHTDFVGPVETSSFQ- 146

Query: 157 XXXXXXVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESE 216
                  LL P+NPL+  IPSW P+ PPDHTYKFTP++N+ I D K IK++   ES+  +
Sbjct: 147 -------LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199

Query: 217 KALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQLEIWGNALEERKPTITE--KSFN--- 271
            AL NL   +      SN  +     DE   + + +     +EE+  T  +  KS N   
Sbjct: 200 TALFNLINKIE-----SNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSII 254

Query: 272 ----ENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQSHKTIQK 327
               + +IE+Y+  RV +AR +V+KFE   L    NPF+ +                 Q 
Sbjct: 255 VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLIND--------------QT 300

Query: 328 TIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEERAKSLKRRQEE 372
            ++    +S  L ++++P++   KK+ IR A+ ER + + R +E+
Sbjct: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED 345

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  121 bits (304), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 107/392 (27%), Positives = 181/392 (46%), Gaps = 50/392 (12%)

Query: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDG 74
           V+L  LP+L E+ H     P+  +  + VL QL +LN  + IS  A D+L  +  +Q+D 
Sbjct: 21  VRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDD 77

Query: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134
           + ++L  +T +QRR++ S+ DL L  +   +D   L  Q + S F+  K   E   L   
Sbjct: 78  LLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNE- 136

Query: 135 SSLAALPHXXXXXXXXXXXXXXXXXXXXV-------LLPPSNPLEKQIPSWLPNFPPDHT 187
            ++  +                      V       LLP SN   K +PSWLP  PPDHT
Sbjct: 137 -TVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHT 195

Query: 188 YKFTPEFNHPITDLKTIKKEIVKESQESEKALLNL------NKSLSHISSASNTPQPPGL 241
           YKFT  +  PITD + +KK++++E + SEKALLN+         L  ++  S+       
Sbjct: 196 YKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAA 255

Query: 242 DDEDAIEQQLEI---------------WGNALEERKPTITE--KSFNEN-----NIEQYA 279
             E   E QLE                WG        T+    +SFN +     N+ +Y 
Sbjct: 256 LSEHIKESQLETDLIFDPHKTIPTDKEWGTT------TVLHGIESFNLSPVKNFNVLEYC 309

Query: 280 KYRVELARERVTKFEVNQLKRTKNPFLKISETLY-LPESPHQSHKTIQKTIELQFRKSMT 338
           K R  + + R  + E     + +NPF++ +       +   +S K+++  ++   R+S  
Sbjct: 310 KKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYL 369

Query: 339 LFMHNLPKVQKLKKEKIRMAKEERAKSLKRRQ 370
             + ++P+V+++ +E+ R   EER + L+ ++
Sbjct: 370 GLIDSIPRVKEV-RERARKEAEERERLLQEQR 400

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 103/391 (26%), Positives = 173/391 (44%), Gaps = 44/391 (11%)

Query: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           M+   S+  +G +  +V   + P   E+ H   DA V ++L  +V FQ+++         
Sbjct: 1   MSDWESDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSAGLARGGGGG 58

Query: 61  --------LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQ 112
                      L+ LV  Q+ GM   LH +  +QRR  A+  D+ LLL+ F L    + +
Sbjct: 59  GVGMAGQAFQLLLQLVEEQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEE 118

Query: 113 QFQASEFIK-SKHSTEYEKLMSWSSLAALPHXXXXXXXXXXXXXXXXXXXXVLLPPSNPL 171
           Q   S+ I  ++     E+ +                                +    P+
Sbjct: 119 QMYLSKKIGYNRMQVPREQTVQLQDATG---SYDRFKLVENQQLIASGLSGSDMSQELPI 175

Query: 172 EKQIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISS 231
            ++IP+WLP  PP+HTYKFT E+N  + D K +K++I+KES E E +L NL ++    + 
Sbjct: 176 AEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDAD 235

Query: 232 ------ASNTP--QPPGLDDE--------DAIEQQLEIWGNALEERKPTITEKSFNENNI 275
                 A  TP  +   +DDE        + I ++ E  G   + R P   +KSF   ++
Sbjct: 236 TKVDERARETPPEELKRIDDEIVALYGPLEEIAERHE--GPRTKRRTPLYLKKSF---DV 290

Query: 276 EQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRK 335
           + Y+  RV+LAR  V +FE     R +NPFL       +PE+  + +  ++ ++      
Sbjct: 291 QAYSLGRVKLARNAVQRFEWETKYRPRNPFL--CSHRAVPENSKKVYSMLENSLN----- 343

Query: 336 SMTLFMHNLPKVQKLKKEKIRMAKEERAKSL 366
              L   +LP+++  K   I  A E+R   L
Sbjct: 344 --ELVQVDLPRLESRKAAAIAHAVEQRDAKL 372

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%)

Query: 176 PSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASN 234
           P WLP+FPPDHTYK+TP + + +     I++++V+E + SEKAL+ L  +L  IS+  +
Sbjct: 198 PGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKD 256

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 101/238 (42%), Gaps = 72/238 (30%)

Query: 263 PTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQSH 322
           PT   K F+   +E YA+ R+E+AR +V  FE  QL    NP L++++  Y         
Sbjct: 391 PTSKLKDFD---VEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFE 447

Query: 323 KTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEERAKSLKRRQEELISQR----- 377
              QK I    +++M  F  N+P +    KEK +M ++E  K    R++ELI++R     
Sbjct: 448 TEYQKCI----KRTMDRFKRNIPII----KEKRKMVRKESIK----RKDELIAKRLATIK 495

Query: 378 ---TKREQDEGHD---------------------LELLLNNEHARDAADDTTT------- 406
               K+EQ+                         LE+L +  +A      TTT       
Sbjct: 496 EAKMKKEQEIVRKSREMEAIENANKFGILPGEKPLEVLQDASNASTGESSTTTAQIPQGA 555

Query: 407 PNALN--NSTI-------------------VINTNAEDEDDDINLFGILGSSEDENEM 443
           P  +N  NST+                   VI  + ED+D+D+ LFG   SS D+ E+
Sbjct: 556 PLLVNPVNSTLVPLVDSEKPKPLEEVQTIDVIAKDVEDDDEDLGLFGGFNSSSDDEEI 613

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 24  DLTEI-SHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDGMFRNLH 80
           D+ EI S   +D  + E+LK+ V  QL +++  + ++  A+D+LV     Q++ +   LH
Sbjct: 20  DIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLH 79

Query: 81  NLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKH 124
            ++LLQRR   + +DL++ +R +NL    LY   + S+FI+  +
Sbjct: 80  RISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENY 123

>Ecym_1337 Chr1 complement(697548..699569) [2022 bp, 673 aa] {ON}
           similar to Ashbya gossypii AEL034W
          Length = 673

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 42  KKTVLFQLNSLNICISNF-ALDELVNLVTVQMDGMFRNLHNLTLLQRRSQ--ASQADLKL 98
           KK  +  L  LN  I N+ +++ L N++ +++D + ++L +L     R+    S+  ++L
Sbjct: 43  KKNKMQTLKPLNFVIPNYTSVNNLANMLNIKLDKLVKDLKDLGFTNARTDFILSKDYIQL 102

Query: 99  LLREFNLDAP 108
           +L+E+N D P
Sbjct: 103 ILQEYNYDVP 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,343,433
Number of extensions: 2468462
Number of successful extensions: 14984
Number of sequences better than 10.0: 483
Number of HSP's gapped: 15403
Number of HSP's successfully gapped: 530
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)