Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML109W (ZDS2)8.831ON94294241040.0
Smik_13.258.831ON94995029850.0
Skud_13.328.831ON94894928600.0
Suva_13.358.831ON98298328280.0
KAFR0A027708.831ON8847106672e-73
SAKL0D01716g8.831ON9424856702e-73
TDEL0B006608.831ON9595196684e-73
KLTH0C04048g8.831ON9354496438e-70
Kpol_1069.28.831ON10016276211e-66
Smik_13.4868.831ON9234706074e-65
ZYRO0G13992g8.831ON12114246101e-64
Kwal_27.103188.831ON9254366022e-64
KLLA0D01683g8.831ON9443995722e-60
AAL185W8.831ON10184375626e-59
YMR273C (ZDS1)8.831ON9154815402e-56
TPHA0I002008.831ON10497145432e-56
Kpol_541.108.831ON10564925422e-56
NCAS0B011108.831ON9935405333e-55
KNAG0G033708.831ON10761505149e-53
NDAI0E003508.831ON11632175103e-52
Skud_13.4458.831ON8981094513e-45
Suva_13.4618.831ON931994495e-45
CAGL0F03421g8.831ON8171134387e-44
Ecym_27108.831ON896964353e-43
CAGL0J06688g8.831ON8281324253e-42
TPHA0C047208.831ON10721164123e-40
KAFR0B038608.831ON843974075e-40
TBLA0B032008.831ON1086953962e-38
TBLA0D031908.831ON16821363849e-37
Skud_14.8singletonON7480830.023
Ecym_40305.690ON81987743.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML109W
         (942 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...  1585   0.0  
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...  1154   0.0  
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...  1106   0.0  
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...  1093   0.0  
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   261   2e-73
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   262   2e-73
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   261   4e-73
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   252   8e-70
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   243   1e-66
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   238   4e-65
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   239   1e-64
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   236   2e-64
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   224   2e-60
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   221   6e-59
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   212   2e-56
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   213   2e-56
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   213   2e-56
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   209   3e-55
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   202   9e-53
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   201   3e-52
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   178   3e-45
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   177   5e-45
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   173   7e-44
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   172   3e-43
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   168   3e-42
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   163   3e-40
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   161   5e-40
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   157   2e-38
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   152   9e-37
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    37   0.023
Ecym_4030 Chr4 (71418..73877) [2460 bp, 819 aa] {ON} similar to ...    33   3.8  

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score = 1585 bits (4104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/942 (84%), Positives = 797/942 (84%)

Query: 1   MVLMEDMQNKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLD 60
           MVLMEDMQNKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLD
Sbjct: 1   MVLMEDMQNKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLD 60

Query: 61  TEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIRSEQKE 120
           TEIQNVKNLKRLSIGSMDLVIDPELEFKVN                 LHEENIIRSEQKE
Sbjct: 61  TEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQESLHEENIIRSEQKE 120

Query: 121 EQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXXXXXXXXXXXXXXXXX 180
           EQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKII                  
Sbjct: 121 EQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIRNASSSTSSSARVTSRNR 180

Query: 181 XLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI 240
            LSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI
Sbjct: 181 RLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI 240

Query: 241 STNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVD 300
           STNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVD
Sbjct: 241 STNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVD 300

Query: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGN 360
           KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGN
Sbjct: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGN 360

Query: 361 HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDN 420
           HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDN
Sbjct: 361 HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDN 420

Query: 421 RRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHA 480
           RRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHA
Sbjct: 421 RRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHA 480

Query: 481 XXXXXXXXXXXXXXXXXVLIKPHNTGSMISEKLDQHVXXXXXXXXXXXXXXXXXXXXXXX 540
                            VLIKPHNTGSMISEKLDQHV                       
Sbjct: 481 SISQESSLLSTDSSNNSVLIKPHNTGSMISEKLDQHVSSSEKSNTNNSEANHGWSWLNSS 540

Query: 541 XXXXXANEQTYQQLTXXXXXXXCVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPI 600
                ANEQTYQQLT       CVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPI
Sbjct: 541 NGSLNANEQTYQQLTDDEDDEECVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPI 600

Query: 601 FQIHSEEAKXXXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLEKRLAK 660
           FQIHSEEAK                   TAPAVVEKKVELPTDTQASTHKKNSLEKRLAK
Sbjct: 601 FQIHSEEAKSVVITPSVVSSSESQPSKPTAPAVVEKKVELPTDTQASTHKKNSLEKRLAK 660

Query: 661 LFKRKQHNGTCXXXXXXXXXXXXXXXXXXXXXXXXXXFRKSPKKKPQEAEVERPSSPTKT 720
           LFKRKQHNGTC                          FRKSPKKKPQEAEVERPSSPTKT
Sbjct: 661 LFKRKQHNGTCKSDVKVIKKSVKKELKKKASHSSLSKFRKSPKKKPQEAEVERPSSPTKT 720

Query: 721 ITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISELXXXXXXXXXXXXVNYD 780
           ITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISEL            VNYD
Sbjct: 721 ITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISELDGDDSFDISGGDVNYD 780

Query: 781 VEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFT 840
           VEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFT
Sbjct: 781 VEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFT 840

Query: 841 DSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYL 900
           DSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYL
Sbjct: 841 DSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYL 900

Query: 901 NLVNHTLYMEQVGTGDIAFNGDSALGMMDKNDSDGTILIPDI 942
           NLVNHTLYMEQVGTGDIAFNGDSALGMMDKNDSDGTILIPDI
Sbjct: 901 NLVNHTLYMEQVGTGDIAFNGDSALGMMDKNDSDGTILIPDI 942

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score = 1154 bits (2985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/950 (64%), Positives = 687/950 (72%), Gaps = 9/950 (0%)

Query: 1   MVLMEDMQNKDGHNTVENSSGGTDSNNN-IQMRRMRKTQLSKKELFEKRKSDVLIAAKSL 59
           M+L ED QN   H+TVE+   G D+NNN IQMRRMRKTQLSKKEL EKRKSDV IAAKSL
Sbjct: 1   MILTEDDQNDVSHDTVESCGNGADNNNNNIQMRRMRKTQLSKKELLEKRKSDVFIAAKSL 60

Query: 60  DTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIRSEQK 119
           DTEIQNVKNLKRLSIGSMDLVIDPELEFKVN                 L EE++I+ +Q+
Sbjct: 61  DTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQESLCEEDVIQPKQE 120

Query: 120 EEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXXXXXXXXXXXXXXXX 179
           EE+  EDNDAYEEG+ATN DDSIDITQTEYLHDEETLEKEKI                  
Sbjct: 121 EEKRGEDNDAYEEGEATNADDSIDITQTEYLHDEETLEKEKIFYNAPSSTSSARVTCRNR 180

Query: 180 XXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQ 239
             LSGVK LAHD VL+  +DH+SK VD TQNLLWVPA+QHPNVKPENYLELIQDTLQNIQ
Sbjct: 181 R-LSGVKALAHDAVLEAMDDHESKTVDFTQNLLWVPANQHPNVKPENYLELIQDTLQNIQ 239

Query: 240 ISTNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQV 299
           IST++D  E+ LE+GNNHVI NRK +GS+VRRPSRLKTSYTKFDDE  +ADKP+ G+ QV
Sbjct: 240 ISTDEDSGESTLEVGNNHVILNRKSSGSIVRRPSRLKTSYTKFDDEISVADKPEVGQEQV 299

Query: 300 DKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNG 359
           +KRI SS+++TIRSVSLKEITEELTKISNNAGLT S+AVTLARSLSMSGSFTNE+L L  
Sbjct: 300 NKRIPSSEVRTIRSVSLKEITEELTKISNNAGLTGSNAVTLARSLSMSGSFTNENLLLKS 359

Query: 360 NHTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTND 419
           N  END+EFASNMFNE+G TIPERSSLRRSKFNTYKIRLEGS LPQA  L +LMN++T+D
Sbjct: 360 NDAENDSEFASNMFNESGRTIPERSSLRRSKFNTYKIRLEGSGLPQAANLKNLMNMRTSD 419

Query: 420 NRRSASSPASYTQVPQEQASLNDFHEIFDHYRRT----STDWSTENEKYVDSTNYYSDEE 475
           +RRS SSPA Y ++PQEQ SLNDF EIFDHYRRT    STDWSTEN KY DS NY+SDEE
Sbjct: 420 DRRSTSSPACYARLPQEQGSLNDFQEIFDHYRRTSTDWSTDWSTENAKYDDSPNYHSDEE 479

Query: 476 DLTHAXXXXXXXXXXXXXXXXXVLIKPHNTGSMISEKLD-QHVXXXXXXXXXXXXXXXXX 534
           DLTHA                 VL+KPHN GSMISE+LD QHV                 
Sbjct: 480 DLTHASISQDSSLLSTDSSNNSVLVKPHNAGSMISERLDQQHVSSREDENNNISEPSHGW 539

Query: 535 XXXXXXXXXXXANEQTYQQLTXXXXXXXCVDNEKADFVNLSVSRRAKSTKRASERINHSK 594
                       N+ T++Q         CV+NEKADFVNLSVSRR KSTKRASERINHSK
Sbjct: 540 SWLNYSNENLNNNDNTHEQFIDDQDDDGCVENEKADFVNLSVSRRTKSTKRASERINHSK 599

Query: 595 NRHSPIFQIHSEEAKXXXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQASTHKKNSL 654
           NRHSPIFQ+ S+E+K                   T  +V EKK+E P D + +THKK SL
Sbjct: 600 NRHSPIFQVRSDESKSPIITPPVLSSSSSQSSDPTVLSVTEKKLESPNDDKTNTHKKKSL 659

Query: 655 EKRLAKLFKRKQHNGTCXXXXXXXXXXXXXXXXXXXXXXXXXXFRKSPKKKPQEAEV--E 712
           EKRLA LFKR+Q +G                            FRKSPKKK +EA+V  E
Sbjct: 660 EKRLAGLFKRRQQSGPSKSDVKVIKKSVRKELKKKASHSGLSKFRKSPKKKFKEAKVNQE 719

Query: 713 RPSSPTKTITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISELXXXXXXXX 772
            PS P +T +T D+DT S I+  +++ N ST+L D + SHSSEFVVETISEL        
Sbjct: 720 CPSPPVETDSTGDVDTESTIQSTIQNPNTSTILSDRNISHSSEFVVETISELDGDDSFDI 779

Query: 773 XXXXVNYDVEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDY 832
               +NY+VEVHS+I RDT AG ++ I  + E        Q   L PRKLTF DVVKP Y
Sbjct: 780 SGNDINYNVEVHSNIDRDTAAGSDDSIEQQEESIIPSPETQTPNLIPRKLTFGDVVKPKY 839

Query: 833 SNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLL 892
            NAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLL
Sbjct: 840 PNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLL 899

Query: 893 SNFMYSYLNLVNHTLYMEQVGTGDIAFNGDSALGMMDKNDSDGTILIPDI 942
           SNFMYSYLNLVNHTLYMEQ+G+ D+ FNGDSALGM+DKNDSDGTILIPDI
Sbjct: 900 SNFMYSYLNLVNHTLYMEQMGSEDVVFNGDSALGMVDKNDSDGTILIPDI 949

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/949 (62%), Positives = 678/949 (71%), Gaps = 8/949 (0%)

Query: 1   MVLMEDMQ-----NKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIA 55
           M+LM+D+Q     N  GH+TVE+++ G +SNNNIQ  RMRKTQLSKKELFEKRKSDVLIA
Sbjct: 1   MILMKDVQKERVQNDHGHDTVESNNNGMNSNNNIQQGRMRKTQLSKKELFEKRKSDVLIA 60

Query: 56  AKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIR 115
           AKSLDTEIQNVKNLKRLSIGSMDLV DPELEFK++                 LH E I +
Sbjct: 61  AKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKLSSRNSYSSDSSKESLQESLHGEEIKQ 120

Query: 116 SEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXXXXXXXXXXXX 175
            EQ+ E+  +D+D YEE DATN DDSIDITQTEYLHDEETLEKE+I              
Sbjct: 121 LEQEIEERGQDDDVYEEDDATNADDSIDITQTEYLHDEETLEKERI-SRKASSTSFPARV 179

Query: 176 XXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTL 235
                 LSGVK+  HD VLDV + HDS  V+ TQNLLWVPA+QHPNVKPENYLELIQDTL
Sbjct: 180 TSRNRRLSGVKSFPHDEVLDVVDSHDSNAVNFTQNLLWVPANQHPNVKPENYLELIQDTL 239

Query: 236 QNIQISTNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEG 295
           QNIQIS +Q+ DE+KLELGNNH   NR+R+GS+VR PSRLKTSY+KFDDEP LA +PQ+ 
Sbjct: 240 QNIQISVDQEFDESKLELGNNHAFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQPQQE 299

Query: 296 EIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESL 355
           + QV++RI SS+ K++RSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFT+ +L
Sbjct: 300 QEQVERRIPSSEFKSMRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTSGNL 359

Query: 356 HLNGNHTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNI 415
           HL+ N+ ENDNEFASNMFNE G  IPERSSLRRSKFNTYKIRLEGS L QA + NSLM+I
Sbjct: 360 HLSNNNAENDNEFASNMFNEIGGGIPERSSLRRSKFNTYKIRLEGSGLSQASRPNSLMSI 419

Query: 416 QTNDNRRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEE 475
           Q ++ RRSAS PASY Q+PQ+Q SLNDF EIFDHYR+TST+W TEN KYVD+TNYYSDEE
Sbjct: 420 QISEGRRSASLPASYAQLPQQQGSLNDFQEIFDHYRKTSTEWGTENTKYVDNTNYYSDEE 479

Query: 476 DLTHAXXXXXXXXXXXXXXXXXVLIKPHNTGSMISEKLDQHVXXXXXXXXXXXXXXXXXX 535
           DLTHA                 VL+KPHN+GSMISE+LDQ                    
Sbjct: 480 DLTHASISQDSSFLSTDSSNNSVLMKPHNSGSMISERLDQDTISNENENTGISEPNHGWS 539

Query: 536 XXXXXXXXXXANEQTYQQLTXXXXXXXCVDNEKADFVNLSVSRRAKSTKRASERINHSKN 595
                      N+  Y+ L        C++NE+A+FVNLSVSRRAKSTKR SERINHSKN
Sbjct: 540 WLNSGNENSSNNDHIYEPLMDEQDAEDCLENEEANFVNLSVSRRAKSTKRVSERINHSKN 599

Query: 596 RHSPIFQIHSEEAKXXXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLE 655
           RHSPI Q+ S+ +K                   T PA  EK+   P D +  +HKK SLE
Sbjct: 600 RHSPILQMPSDGSKSVVITSSVPSSPPLQSSEATIPAAAEKEQNCPDDNRPLSHKKQSLE 659

Query: 656 KRLAKLFKRKQHNGTCXXXXXXXXXXXXXXXXXXXXXXXXXXFRKSPKKKPQEAEV--ER 713
           KRLA+LFKRKQH                              FRKSPKKK +E EV  +R
Sbjct: 660 KRLARLFKRKQHCDGSKSDAKVLKKNVKNELKKKASHSSLSKFRKSPKKKREEEEVVHDR 719

Query: 714 PSSPTKTITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISELXXXXXXXXX 773
           PSSP +TITTED DT+S IEP V S NA  +LPDS+T+HSSEFVVETI+EL         
Sbjct: 720 PSSPVETITTEDFDTSSDIEPAVESPNACNILPDSNTNHSSEFVVETINELDGDDSFDIS 779

Query: 774 XXXVNYDVEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYS 833
               + +++V S I+RDTTAG  E +G E E      APQISTL PRKL FEDV+KP+Y 
Sbjct: 780 GGENDCNIDVRSDIARDTTAGPNESMGEEEESMVPSPAPQISTLLPRKLIFEDVIKPEYP 839

Query: 834 NAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLS 893
           NAPIKFTDSAFGFPLPMI NSTVIMFDHRL INVERAIYRLSHLKLSDPGRELRQQVLLS
Sbjct: 840 NAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVERAIYRLSHLKLSDPGRELRQQVLLS 899

Query: 894 NFMYSYLNLVNHTLYMEQVGTGDIAFNGDSALGMMDKNDSDGTILIPDI 942
           NFMYSYLNLVNHTLYMEQ+G+ D  FN D ALGM DKNDSDG I+IPDI
Sbjct: 900 NFMYSYLNLVNHTLYMEQMGSEDAVFNSDPALGMTDKNDSDGAIVIPDI 948

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/983 (60%), Positives = 676/983 (68%), Gaps = 42/983 (4%)

Query: 1   MVLMEDMQ-----NKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIA 55
           M+LME++Q     ++ GH+TVEN +   D+NNNIQ+RRMRKTQLSKKEL EKRKSDVLIA
Sbjct: 1   MILMENVQRDRVQDEHGHDTVENINNCKDNNNNIQIRRMRKTQLSKKELLEKRKSDVLIA 60

Query: 56  AKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIR 115
           AKSLDTEIQ+VKNLKRLSIGSMDLVIDPELEFKV+                 LHEEN ++
Sbjct: 61  AKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFKVSSRNSYSSDSSKESIQESLHEENAVQ 120

Query: 116 SEQKEEQ--------------------------------GSEDND-AYEEGDATNVDDSI 142
            E+K+EQ                                G ED D  YE+G+ATNVDDSI
Sbjct: 121 LEKKQEQDQYQYQYQEQEQEQEQEQEQEQEQKQEEEHGGGQEDEDYEYEDGNATNVDDSI 180

Query: 143 DITQTEYLHDEETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDS 202
           DITQTEYLHDEETLEKEK                     LSGV + AHD VLDV  DH S
Sbjct: 181 DITQTEYLHDEETLEKEKSSRNASSSTSSSARVTSSNRRLSGVNSFAHDEVLDVAEDHSS 240

Query: 203 KMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDENKLELGNNHVISNR 262
              +LTQNLLWVPA QHPNVKPENYLEL+QDTLQNIQI+T+QD DE   +L NNHV SNR
Sbjct: 241 NTANLTQNLLWVPASQHPNVKPENYLELVQDTLQNIQITTDQDPDEKNSDLSNNHVFSNR 300

Query: 263 KRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEE 322
           +R+GS+VRRPS LKTSYTKFDDEP   D+ ++G  Q +KRISS + K+IR VSLKEITEE
Sbjct: 301 QRSGSIVRRPSHLKTSYTKFDDEPSSVDRQRQGHGQAEKRISSLETKSIRCVSLKEITEE 360

Query: 323 LTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGNHTENDNEFASNMFNETGLTIPE 382
           LTKIS+NAGLTDSDA+TLARSLSMSGSFTNESLHL+ N T++DNEFASNMFN++GLTIPE
Sbjct: 361 LTKISDNAGLTDSDAITLARSLSMSGSFTNESLHLSSNKTDSDNEFASNMFNKSGLTIPE 420

Query: 383 RSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSPASYTQVPQEQASLND 442
           R SLRRSKFNTYKIRLE + L    + NSLMN+QTND+RR ASSPASYTQ PQ+Q  LND
Sbjct: 421 R-SLRRSKFNTYKIRLENNDLLPTGRPNSLMNVQTNDDRRRASSPASYTQPPQDQTPLND 479

Query: 443 FHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHAXXXXXXXXXXXXXXXXXVLIKP 502
           F EIF+HYRRTSTDW TEN KYVD+TNYYSDEEDLTHA                 VL+KP
Sbjct: 480 FQEIFEHYRRTSTDWGTENTKYVDNTNYYSDEEDLTHASISQDSSFLSTDSSNNSVLVKP 539

Query: 503 HNTGSMISEKLDQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANEQTYQQLTXXXXX-X 561
           HN GSMISE+LDQ +                              +  Y+Q+        
Sbjct: 540 HNAGSMISERLDQDIASNENEDIDINEPNHGWSWLNSANENLTNYDGAYEQVIDDEEDIG 599

Query: 562 XCVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPIFQIHSEEAKXXXXXXXXXXXX 621
            CV++EKADFVNLSVSRRAKSTKRASERINHSKNRHSPIFQ+ S+E+K            
Sbjct: 600 DCVEDEKADFVNLSVSRRAKSTKRASERINHSKNRHSPIFQMQSDESKSVVVTSSVTSLS 659

Query: 622 XXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRKQHNGTCXXXXXXXXXX 681
                   APAVVEK+   P D +   HKK+SLEKRLA+LFKRKQHN             
Sbjct: 660 PSQSTESAAPAVVEKEQGSPNDNKPPAHKKHSLEKRLARLFKRKQHNNNSKSDAKVIKKN 719

Query: 682 XXXXXXXXXXXXXXXXFRKSPKKKPQEAEV--ERPSSPTKTITTEDIDTASVIEPEVRSS 739
                           FRKSPKKK Q+ EV  +R SSP +T++T  +DT   IEP V + 
Sbjct: 720 VKQELKKKTSHSSLSKFRKSPKKKSQQVEVVQDRSSSPVETVSTRILDTPIEIEPIVENP 779

Query: 740 NASTLLPDSHTSHSSEFVVETISELXXXXXXXXXXXXVNYDVEVHSSISRDTTAGLEEDI 799
             S +    +T+HSSE VVETI+EL            +NY+VEV +++  DTTA   E +
Sbjct: 780 TNSNIFSGGNTNHSSELVVETINELDGDDSFDISGGDINYNVEVTANMDTDTTAEPNERV 839

Query: 800 GAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMF 859
           G E ED      PQ+S L P+KLTFEDV+ P+Y NAPIKFTDSAFGFPLPMITNSTVIMF
Sbjct: 840 GEEDEDTVPTLTPQLSILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMF 899

Query: 860 DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAF 919
           DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ+G+ +  F
Sbjct: 900 DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIGSENAVF 959

Query: 920 NGDSALGMMDKNDSDGTILIPDI 942
           NGDSAL M DKNDSDGTILIPDI
Sbjct: 960 NGDSALAMTDKNDSDGTILIPDI 982

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  261 bits (667), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 233/710 (32%), Positives = 327/710 (46%), Gaps = 178/710 (25%)

Query: 27  NNIQMRRMRKTQLSK--KELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPE 84
           N+IQ+R+  KT  +   + L  KRKS+VLIAA+S+D E++NVKNLKRLSIGSMDL+IDPE
Sbjct: 9   NSIQIRKRSKTDDTNNVESLRNKRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPE 68

Query: 85  LEFK---VNXXXXXXXXXXXXXXXXXLHEENIIRSEQKEEQGSEDND---------AYEE 132
           LE+K   VN                      +    + +  G+  +D         +   
Sbjct: 69  LEYKVSHVNTNDDLNKRKSWTPDSTTFTGTKVNTRPKSKSFGTHIHDPPLVRINNNSDSS 128

Query: 133 GDATNVDDSIDITQTEYLHDEETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKTLAHDV 192
                 DDSIDIT+TEYLHD+ TL+ ++ +                   LSG+ + +   
Sbjct: 129 SSDEEEDDSIDITRTEYLHDQTTLQSQRKLPKHRN--------------LSGINS-SRQS 173

Query: 193 VLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDENKLE 252
              + ND       L  NLLWVPA +HPNVKP+NY+EL+QDTLQ+I I  ++  D + + 
Sbjct: 174 SRKLSNDRTDNEDKLKNNLLWVPASKHPNVKPQNYIELVQDTLQHIHIDDSKSNDNDNIN 233

Query: 253 LGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLAD----------KPQEGEIQVDKR 302
             N+   ++  + GS+VRRPSRL+ SYT++++E    D           P  G  +   +
Sbjct: 234 KEND---AHSSKNGSLVRRPSRLRKSYTEYEEENYQDDYNRNNSNDEENPNIGNFRSSNK 290

Query: 303 ISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN--ESLHLNGN 360
                    RSVSLK+ITEELTKISN AGLTDSDA+TLAR+LSM+GSF+N  + + L  N
Sbjct: 291 G--------RSVSLKDITEELTKISNKAGLTDSDAITLARTLSMTGSFSNGTDDMELLSN 342

Query: 361 HTE--------------NDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQA 406
           +++              ND+EFASNM  + GLTIP+RSSLRRSKFNTY++R   SS P  
Sbjct: 343 YSDQQDNNFNNDEHYNKNDDEFASNMLMKNGLTIPQRSSLRRSKFNTYRVR--SSSAPSN 400

Query: 407 VK---LNSLM----------NIQTNDNRRSASSPASYTQ-VPQEQASLNDFHEIFDHYRR 452
           +    +NS +          N +T+  +   +   +YT+ V +   S++D   ++DHY  
Sbjct: 401 IHSKPINSNIKEPKTFKYPYNSKTSIKKSPVNRSNNYTEPVTESPGSISD---LYDHYAY 457

Query: 453 TSTDWSTENEKYVDSTNYYSDEEDLTHAXXXXXXXXXXXXXXXXXVLIKPHNTGSMISEK 512
           +S D  T N     +TN      D                     VL+KP ++ SMI E 
Sbjct: 458 SSVDEETSN-----ATNLQETSND---------GSIDSNESSNDSVLVKPSHSESMIHEN 503

Query: 513 LDQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANEQTYQQLTXXXXXXXCVDNEKADFV 572
            D                                                 V+NE A F+
Sbjct: 504 FDALASDTVTDGWSN------------------------------------VNNENAHFL 527

Query: 573 N-----------LSVSRRAKSTKRASERINHSKNRHSPIFQIHSEEAKXXXXXXXXXXXX 621
                       L      +ST     R NHSKNRH P+F                    
Sbjct: 528 QRNNNNGRLNDELVSKGNQESTHYNKTRSNHSKNRHKPLF-------------------- 567

Query: 622 XXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRKQHNGTC 671
                             +   T+  + KK +LE+++ KLFKRK H  T 
Sbjct: 568 ------------TSTNTPMTAKTKNVSKKKQTLEEKIVKLFKRKAHRRTS 605

 Score =  199 bits (506), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 104/141 (73%), Gaps = 12/141 (8%)

Query: 814 ISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYR 873
           IS+LPPRKLTF+DV +P+  NAPI F+DSAFGFPLPM+T STVIMFDHRLGINVERAIYR
Sbjct: 744 ISSLPPRKLTFDDVKRPEKPNAPIHFSDSAFGFPLPMLTTSTVIMFDHRLGINVERAIYR 803

Query: 874 LSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGD------------IAFNG 921
           LSHLKLSDP RELRQQVLLSNFMY+YLNLVNHTLYMEQ                     G
Sbjct: 804 LSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHTLYMEQAAVSSNESDYEEDLEEVEQETG 863

Query: 922 DSALGMMDKNDSDGTILIPDI 942
                    N SDGTI+IPD+
Sbjct: 864 GVGRYTTAHNASDGTIVIPDM 884

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  262 bits (670), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 194/485 (40%), Positives = 268/485 (55%), Gaps = 65/485 (13%)

Query: 30  QMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKV 89
           Q  ++R +  SK    EKRKS+VLIAA+SLD E+QNVKNLKRLSIGSMDL++DPE+EF++
Sbjct: 22  QASKIRNSPTSK----EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77

Query: 90  NXXXXXXXXXXXXXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEY 149
           N                   EEN      KE    E +D Y     +  +DS+DIT+TEY
Sbjct: 78  NSSLSSSPTKSLSSE----EEEN-----DKEGYAEEYDDDY-----SYSEDSMDITKTEY 123

Query: 150 LHDEETLEKEK-----------IIXXXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVEN 198
           LHD    +  +           +                    LSG  ++    VL   +
Sbjct: 124 LHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRS 183

Query: 199 D-HDSKMVD------LTQNLLWVPADQHPNVKPENYLELIQDTLQNIQIST---NQDIDE 248
                K+ D      LTQNLLWVPA+QHP+VKPENYLEL+QDTLQN+Q+     ++   E
Sbjct: 184 RLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKE 243

Query: 249 NKLEL--GNNHVISN---RKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRI 303
           N ++L  G N  +S    ++   S+VRRPSRL+ SYT+F+D      +     I  +   
Sbjct: 244 NTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFED-----TEEYNLPISGNSSS 298

Query: 304 SSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSF--TNESLHLNGNH 361
             S + T RSVSL+EIT+ELTK+SNNAGLTDSDA+TLAR+LSM+ +F   + S   N ++
Sbjct: 299 LPSSVPTPRSVSLREITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSN 358

Query: 362 TEN--DNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTND 419
           TE   ++EFASNM N+  L IP RSSLRRSKFNTY+IR    S       ++L    T +
Sbjct: 359 TEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSSTEE 418

Query: 420 NRRSASSPASYTQVPQ--------EQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYY 471
           N +     A    +P+          +++ND  +I+DHY  +S + S   +    ++NY 
Sbjct: 419 NPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPPQ----NSNYS 474

Query: 472 SDEED 476
           S ++D
Sbjct: 475 SAQQD 479

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 90/135 (66%), Positives = 105/135 (77%), Gaps = 9/135 (6%)

Query: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876
           LPPRKL FEDV +P+Y NAP+KFTDSAFGFPLP +T STVIMFDHRL INVERAIYRLSH
Sbjct: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867

Query: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAFNGDSALGMMD------- 929
           LKLSDP RELRQQVLLSNFMY+YLNLVNH+LY++QV   +    GD ++           
Sbjct: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMNEYSVGTPATD 927

Query: 930 --KNDSDGTILIPDI 942
             +ND++G I IP+I
Sbjct: 928 PIQNDNNGIINIPEI 942

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  261 bits (668), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 195/519 (37%), Positives = 277/519 (53%), Gaps = 85/519 (16%)

Query: 16  VENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIG 75
           +E   G +D+N   Q +  ++T +++ +  EKRKS+VLIAA+S+D E+QNVK+LKR+SIG
Sbjct: 1   METLDGRSDANLEEQNQVRQRTSMTESQR-EKRKSEVLIAAQSIDNEVQNVKSLKRISIG 59

Query: 76  SMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDA 135
           S+DL++DPELE++VN                   E ++     K E         +EG+A
Sbjct: 60  SIDLLMDPELEYRVNVNSPNTRKSWSSNSSSSEEEHDVAPCYDKGE---------DEGEA 110

Query: 136 T---NVDDSIDITQTEYLHDEETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKTLAHDV 192
           +     DDS D T  +YL   +T                          L+GV +L    
Sbjct: 111 SVSDGADDSFDTTGADYL---QTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGG 167

Query: 193 V------LDVENDHDSK----MVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI-- 240
           V      L   +D+ S+       +T+ LLWVPA QHP+VKPEN+LEL+QDTL NIQ+  
Sbjct: 168 VNIPTRKLSSASDNGSEDGSNSSSITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDE 227

Query: 241 ---STNQDIDENKLELGNNH----VISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQ 293
              +T+ D DE+  E    +    +   RKR  S+VRRPSRL+ SYT+F++     D+ +
Sbjct: 228 KKETTDNDNDESNKENAKAYDRLPIDITRKR-DSLVRRPSRLRKSYTEFEE----YDETE 282

Query: 294 --EGEIQVDKR----------ISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLA 341
             EG + V K              S  ++ R+VSLK+ITEEL KISNNAGLT SDA+TLA
Sbjct: 283 SLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLA 342

Query: 342 RSLSMSGSFTNE------------SLHLNGNHTEN------DNEFASNMFNETGLTIPER 383
           R+LSM+GSF +              +HL+ +  +N      DNEFASNM  + G+ IP R
Sbjct: 343 RTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPAR 402

Query: 384 SSLRRSKFNTYKIRLEGSSLP---------QAVKLNSLMNIQTNDNRRSAS----SPA-- 428
           SSLRRSKFNTY++R  GS+              KL+S +   T ++  S      SP+  
Sbjct: 403 SSLRRSKFNTYRVRSSGSTSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIK 462

Query: 429 SYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDS 467
               +    +S+NDF +I+DHYR+ S DW  E +K  +S
Sbjct: 463 GNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTES 501

 Score =  205 bits (521), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 144/382 (37%), Positives = 186/382 (48%), Gaps = 59/382 (15%)

Query: 588 ERINHSKNRHSPIFQIHSEEAKXXXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQAS 647
           +R NHSKNRH PIF  +    +                   T    V  K+   + + +S
Sbjct: 610 QRSNHSKNRHLPIFPANESSKRKDT----------------TEEPAVSTKMGRSSSSDSS 653

Query: 648 THKKNSLEKRLAKLFKRKQHN-----GTCXXXXXXXXXXXXXXXXXXXXXXXXXXFRKSP 702
              +   EK++A LF+RK        GT                             K+P
Sbjct: 654 NLTRQMFEKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTS----KTP 709

Query: 703 KKKPQEAEVE---RPSSPTKTITTEDIDTASVIEPEVRSSNASTLLP--------DSHTS 751
            K   E+ VE   R S     +    I    VI  + ++ +   L P         +H  
Sbjct: 710 VKLRSESRVEEHLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVP 769

Query: 752 HSSEFVVETISELXXXXXXXXXXXXVNYDVEVHSSISRDT-TAGLEEDIGAEREDNTSPT 810
            +S  V+E++ EL            V+ D    +SI   T T  ++E     + D   P 
Sbjct: 770 LASSVVIESVKELDGDDSQD-----VSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPA 824

Query: 811 -APQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVER 869
             P    +PPRKLTF+DV + + SNAP+KFTDSAFGFPLPM+T STVIMFDHRL INVER
Sbjct: 825 DGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVER 884

Query: 870 AIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG---------TGDIAFN 920
           AIYRLSHLKLSDP RELRQQV+LSNFMY+YLNLVNHTLYMEQV          +G  AF 
Sbjct: 885 AIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFK 944

Query: 921 GDSALGMMDKNDSDGTILIPDI 942
                   + N ++G+I IPD+
Sbjct: 945 -------TEHNSANGSICIPDM 959

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  252 bits (643), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 181/449 (40%), Positives = 245/449 (54%), Gaps = 73/449 (16%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           EKRKS+VLIAA+SLD+E+Q+VKNLKR+SIGSMD++IDPE+EF+V+               
Sbjct: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXX 165
             L+  +       +               + V+DSIDIT TEYL + E    E +    
Sbjct: 94  QQLYNSHSDHDSDDD--------------LSYVNDSIDITSTEYLQESEGTGFESL---- 135

Query: 166 XXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVD-LTQNLLWVPADQHPNVKP 224
                           LSGV+         + N+  +K  + +T NLLWVPA+QHPN+KP
Sbjct: 136 ---GSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKP 192

Query: 225 ENYLELIQDTLQNIQISTNQDIDENKLELGNNHVI-------------SNRKRTG--SVV 269
           ENYLEL+QDTL  ++I  +   +E  +E GN+  I             SN+ R+G  S+V
Sbjct: 193 ENYLELVQDTLHTLKIEPD---NEGSVEGGNDEKIVHAPAAASANLPPSNQLRSGLNSLV 249

Query: 270 RRPSRLKTSYTKFDD----------------EPPLADKPQEGEIQVDKRISSSDIKTIRS 313
           RRPS L+ S+T+ +D                E P ADK       V  RI S      RS
Sbjct: 250 RRPSGLRKSFTELEDLLLQEAQDTSGGDENAELPSADK----MPSVRPRIGS------RS 299

Query: 314 VSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGS-FTNESLHLNGN-HTENDNEFASN 371
            SLK+ITEELT+ISN AG TD DAV+LAR+LSM+ S +T+E     G+   + + E+AS+
Sbjct: 300 SSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEKEYASS 359

Query: 372 MFNETGLTIPERSSLRRSKFNTYKIR--LEGSSLPQAVKLNSLMNIQTNDNRRSASSPAS 429
           M  + GL IP RSSLRRSKFNTY+IR    GS+ P  ++  S    + N+  RS      
Sbjct: 360 MLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPS---AEHNELDRSPIRVDQ 416

Query: 430 YTQVPQEQASLNDFHEIFDHYRRTSTDWS 458
                Q   S+NDF+EI+DHYR++S D S
Sbjct: 417 KNAQLQSPTSVNDFNEIYDHYRQSSFDSS 445

 Score =  173 bits (438), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/133 (60%), Positives = 99/133 (74%), Gaps = 12/133 (9%)

Query: 792 TAGLEEDIGAEREDNT-----SPTAPQIST-------LPPRKLTFEDVVKPDYSNAPIKF 839
           TA   E+  A   D++      P AP++         LPPRKL F DV+KP+  NAP+KF
Sbjct: 783 TAYAPEETAAASADDSFTKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKF 842

Query: 840 TDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSY 899
           +DS+FGFPLP +T STV+M DHRL INVERAIYRLSHLKL DP RELRQQV+LSNFMY+Y
Sbjct: 843 SDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAY 902

Query: 900 LNLVNHTLYMEQV 912
           LNLVNH+LY++Q+
Sbjct: 903 LNLVNHSLYLQQL 915

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  243 bits (621), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 222/627 (35%), Positives = 312/627 (49%), Gaps = 71/627 (11%)

Query: 16  VENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIG 75
           +EN+SGGT          M KT+  +K   +KRKS VLIAA+SLD E+QNVKNLKRLSIG
Sbjct: 1   MENNSGGT----------MEKTRAEEKIQRDKRKSAVLIAAQSLDQEVQNVKNLKRLSIG 50

Query: 76  SMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIRSEQKEEQGSEDNDAYEEG-- 133
           SMDL+IDPELE+ VN                  +  N    E  E    +   +Y E   
Sbjct: 51  SMDLLIDPELEYTVNNPSSPPSSVNSQKS----YSSNETTYETAETSLDKKEGSYLEDSV 106

Query: 134 -DATN-----VDDSIDITQTEYLHD-EETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVK 186
            DA+N       DS D T  EYLHD  E +   + +                   LSG+ 
Sbjct: 107 VDASNSSIADASDSFDTTGVEYLHDGNEPVSSNEQLDSIKTVKENELSQPQSKRNLSGIG 166

Query: 187 TL---AHDVVLDVENDHD----SKMVD---LTQNLLWVPADQHPNVKPENYLELIQDTLQ 236
            L   + +V    EN+       K+ +    T NLLWVPA+QHP+VKP+N++EL+ DTLQ
Sbjct: 167 GLRRSSRNVTSKPENETQVLPKRKLENKKAFTNNLLWVPANQHPSVKPQNFVELVHDTLQ 226

Query: 237 NIQ---ISTNQDIDENKL--ELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADK 291
           N+    + TN+   +N++  +L N        R  S+VRRPSRL+ SYT+F++E     K
Sbjct: 227 NMSLDDVQTNESESKNEVSKDLLNTFSRDMNMRNKSLVRRPSRLRKSYTEFEEETEEEVK 286

Query: 292 PQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFT 351
           P      +++  +  +++  R+VSLK+I +ELT ISNN GL++SDA++LARSLS++GS  
Sbjct: 287 PTTSSNNINES-NKKNVQGKRAVSLKDIADELTVISNNVGLSNSDAISLARSLSIAGSIG 345

Query: 352 NESLH------LNGNHTENDNE-FASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLP 404
           + S        LN +      E FASN+  + G++IP RSSLRRSKFNTYKIR  GSS  
Sbjct: 346 STSEEEEEDKVLNTSSIGQSEEVFASNILAKNGISIPARSSLRRSKFNTYKIRTSGSS-- 403

Query: 405 QAVKLNSLMNIQTNDN------RRSASSPASYTQVPQEQASLNDFHEIFDHYRR---TST 455
           Q  +L++   I  +D       RR++SS  SY +    Q        IFDH +R   + +
Sbjct: 404 QKDELSTAPIILNSDGGNIGSLRRTSSS--SYIETKNRQEG------IFDHTQRKLSSGS 455

Query: 456 DWSTENEKYVDSTNYYSDEE-DLTHAXXXXXXXXXXXXXXXXXVLIKPHNTGSMISEKLD 514
             S++N        + SD++ DL+H+                 VLI P N+ SM+ E L 
Sbjct: 456 IGSSDNSTGALPVPHDSDKDFDLSHSSFSNDSSNISSDLSLESVLIHPSNSQSMLQENL- 514

Query: 515 QHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANEQTYQQLTXXXXXXXCVDNEKADFVNL 574
            H+                             N+     +              +DF+N 
Sbjct: 515 -HI---SSSDGYSPNKELVSASSSIQSDHDSPNDPPTNSVDPDDHVVSNKYEINSDFLNT 570

Query: 575 SVSRRAKSTKRASERINHSKNRHSPIF 601
           + + R KS K  + R NH+KNRHSPI 
Sbjct: 571 AFAERTKSQKVLANRSNHTKNRHSPII 597

 Score =  168 bits (426), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/166 (53%), Positives = 110/166 (66%), Gaps = 22/166 (13%)

Query: 797  EDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTV 856
            +D+  +  D  +   P I  LPPRKLTFEDV + D  N  + FTDSAFGFPLP++T STV
Sbjct: 838  KDVTIQNNDLANQAPPTI--LPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTV 895

Query: 857  IMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV--GT 914
            IMFDHRL +NVERAIYRLSHLKLSD  R LR+QVLLSNFMY+YL+LVNH+LYMEQV   +
Sbjct: 896  IMFDHRLPVNVERAIYRLSHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQVEEES 955

Query: 915  GDIAF----NGDSALGMMD--------------KNDSDGTILIPDI 942
             D ++    N +    + D              +ND+ G I IPD+
Sbjct: 956  MDASYSDMDNSEIETAIADNDPNKWNSNSYRTNQNDAHGAISIPDL 1001

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  238 bits (607), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 176/470 (37%), Positives = 247/470 (52%), Gaps = 104/470 (22%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL++DPEL+ K                 
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGG-------------- 69

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDS--IDITQTEYLHDEETLEKEKIIX 163
               E N  RS      G+  N A   G  T ++++   D T  E LH+   L+ E    
Sbjct: 70  ----ESNGRRS----WSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLE---- 117

Query: 164 XXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVK 223
                              +G K   H     +  +       L +NLLWVPA+QHPNVK
Sbjct: 118 ---------SSDKGRQSNYAGSKKGVHSTSRKLNANA------LKKNLLWVPANQHPNVK 162

Query: 224 PENYLELIQDTLQNIQISTNQ------------------DIDENKLELGNNHVISNRKRT 265
           P+NYLEL+QDTLQNIQ++ ++                  D  EN  E  N  +  +R  T
Sbjct: 163 PDNYLELVQDTLQNIQLNGSEDNNDDQNNGNKNSGSKVYDNKENDTENLNRAM--SRHGT 220

Query: 266 GSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRIS--SSDIKTIRSVSLKEITEEL 323
            S++RRPS L+ SYT+FDD      +   G+ +   ++   +S IK  R VSL++ITEEL
Sbjct: 221 ASLIRRPSTLRRSYTEFDD-----SEDDNGDSKTVNKVEERTSRIKE-RPVSLRDITEEL 274

Query: 324 TKISNNAGLTDSDAVTLARSLSMSGSFTN-----ESLHLNGNHTE-------------ND 365
           TKISN+AGLTD+DA+TLAR+LSM+GS+++     E  +  G+H E             +D
Sbjct: 275 TKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDD 334

Query: 366 NEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQT-------N 418
            E+ASNM     +T PERSSLRRS+FNTY+IR +            + + +T       N
Sbjct: 335 GEYASNMPINNNMTWPERSSLRRSRFNTYRIRQQEQEKEVEEDKEKIKDYETEHHLPLAN 394

Query: 419 DNRRSASSP--ASYTQVPQE------QASLNDFHEIFDHYRRTSTDWSTE 460
           +  ++A  P  + + Q  +E        S+ DF +I+DHYR++S +W  E
Sbjct: 395 NTSKTAIDPHKSPFRQQAEEPESMSSPGSIGDFQDIYDHYRQSSGEWEQE 444

 Score =  181 bits (459), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 90/106 (84%)

Query: 808 SPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINV 867
           +P     S LPPRKLTF DV KPD  NAP++FTDSAFGFPLP++T STVIMFDHRL INV
Sbjct: 807 APPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINV 866

Query: 868 ERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913
           ERAIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQV 
Sbjct: 867 ERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109W ZDS2 Protein that interacts with silencing
           proteins at the telomere involved in transcriptional
           silencing paralog of Zds1p
          Length = 1211

 Score =  239 bits (610), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 234/424 (55%), Gaps = 63/424 (14%)

Query: 34  MRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXX 93
           +R+ + +   + EKRKS+V+IAA+SLD E+Q+VKNLKR+SIGSMD+++DPELE++V+   
Sbjct: 44  LRERRSTNDTMKEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRVSSNA 103

Query: 94  XXXXXXXX---------XXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDI 144
                                  +     +R          + D   E + + +  S D+
Sbjct: 104 GKQENRKSWTSGVPARPAEEVENMQNRATVRYTYPSRAVEGEPDESFESELSEI--SFDV 161

Query: 145 TQTEYL-----HDEETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKTL---AHDVVL-- 194
           T +EYL     +D+ +++K +                     +SGV TL   A ++ L  
Sbjct: 162 TNSEYLEGLDPNDDSSIQKSEN-DTTDLRGSQKSQVSSSGRSISGVGTLKRGASNIPLRK 220

Query: 195 --DVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDI----DE 248
                +        LT+NLLWVPA+QHPNVKPENYLEL+QDTL NI++  N+D     D 
Sbjct: 221 TSTSSDASSGSNGSLTKNLLWVPANQHPNVKPENYLELVQDTLHNIRLEGNEDEQTGNDM 280

Query: 249 N----KLELGNNHVISNR----KRTGSVVRRPSRLKTSYTKFDDE-------PPLADKPQ 293
           N    K+E G N    ++    ++  S+VR+PSRL+ SYT+FD+E          + K  
Sbjct: 281 NTTTAKVEHGTNKENEDKGYLPRKNNSLVRKPSRLRKSYTEFDEENDDYLDTSGFSKKRS 340

Query: 294 EGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNE 353
             +++    ++ S   + R+VSL++IT+ELTKISNNAGLTDSDA+TLAR+LSM+GSFT++
Sbjct: 341 SEDVEDASNLTISSTNSSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSMAGSFTSD 400

Query: 354 --------SLHLNGN------------HTENDNEFASNMFNETGLTIPERSSLRRSKFNT 393
                   S    G+              E+D EFASNMF + G  IP RSSLRRSKFNT
Sbjct: 401 EPDDIIENSRGTQGDDLQYYNEADAMEKKEDDAEFASNMFMKNGFVIPARSSLRRSKFNT 460

Query: 394 YKIR 397
           Y++R
Sbjct: 461 YRVR 464

 Score =  192 bits (489), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 107/150 (71%), Gaps = 14/150 (9%)

Query: 807  TSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGIN 866
            T P   Q   LP RKLTF DV + D  NAP++FTDSAFGFPLPM+T STV+MFDHRL IN
Sbjct: 1060 TPPVQNQPQPLPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPIN 1119

Query: 867  VERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG------------T 914
            VERAIYRLSHLKLSDP RELRQQV+LSNFMY+YLNLVNHTLYMEQV             T
Sbjct: 1120 VERAIYRLSHLKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQEGGQEIPTASKT 1179

Query: 915  GDIAFNGDSALG--MMDKNDSDGTILIPDI 942
             + A    +  G    D+ND++G I IPDI
Sbjct: 1180 TNAASTAHTGSGSYTTDQNDANGAICIPDI 1209

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 564 VDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPIF 601
           V  E ADF+  S   R    + A++R NHSKNRHSPIF
Sbjct: 760 VPKENADFIKTSTHMRTDYERVAADRSNHSKNRHSPIF 797

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 22/29 (75%)

Query: 438 ASLNDFHEIFDHYRRTSTDWSTENEKYVD 466
           ++++DF +I+DHYR++S DW  E +K  D
Sbjct: 574 STISDFQDIYDHYRQSSVDWEKELKKERD 602

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  236 bits (602), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 166/436 (38%), Positives = 242/436 (55%), Gaps = 47/436 (10%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           EKRKS+VLIAA+SLD+E+Q+VKNLKR+S GSMDL +DPE+EF+++               
Sbjct: 31  EKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHSQRSS------- 83

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXX 165
                 + +  E + E+ ++D+D+  + + + ++DSI++T  EYL +      E+     
Sbjct: 84  ----SSDAVSLESQAEEPNQDDDS--DDNLSYLNDSIELTAHEYLEEPRDFLVER----- 132

Query: 166 XXXXXXXXXXXXXXXXLSGVKTLA-HDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKP 224
                           LSGV+         ++ N  D    ++TQNL WVPA+QHPNVKP
Sbjct: 133 --SSVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDD---NVTQNLFWVPANQHPNVKP 187

Query: 225 ENYLELIQDTLQNIQISTNQDIDENKLELGNNHVI---------SNRKRTG--SVVRRPS 273
           ENYLEL+QDTL  + I +  +   +K   GNN  +         S++ R+G  S+VRRPS
Sbjct: 188 ENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPS 247

Query: 274 RLKTSYTKFDD----EPPLADKPQE-GEIQVDKRISSSDIKTIRSVSLKEITEELTKISN 328
            L+ SYT+ +D    E   +D+  E  + +++  I +    T    SLK+ITEELT+ISN
Sbjct: 248 GLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISN 307

Query: 329 NAGLTDSDAVTLARSLSMSGSFTNESLH----LNGNHTENDNEFASNMFNETGLTIPERS 384
            AG TD DAV LAR+LSM+ S+  E        N +HT  D+E+AS +  + GL IP RS
Sbjct: 308 KAGFTDGDAVCLARTLSMASSYDGEQSQANQSANTDHTP-DSEYASTILTKNGLAIPARS 366

Query: 385 SLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSPASYTQVPQEQASLNDFH 444
           SLRRSKFNTY+IR    S       +       N+ R+        +   +   S+NDF+
Sbjct: 367 SLRRSKFNTYRIRTPNGS--SVTSSSLRSTSLPNEERKDPEGYIEKSDRLRSPTSVNDFN 424

Query: 445 EIFDHYRRTSTDWSTE 460
           EI+DHYR+ S   ++E
Sbjct: 425 EIYDHYRQGSVGSTSE 440

 Score =  176 bits (446), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/113 (71%), Positives = 94/113 (83%), Gaps = 4/113 (3%)

Query: 804 EDNTS--PTAPQIS--TLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMF 859
           EDN    P AP     TLPPRKLTF DVVKP+  N+P+KF+DS+FGFPLP +T STV+M 
Sbjct: 794 EDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMI 853

Query: 860 DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           DHRL INVERAIYRLSHLKL DP RELRQQV+LSNFMY+YLNLVNH+LY++Q+
Sbjct: 854 DHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQL 906

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  224 bits (572), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/399 (38%), Positives = 213/399 (53%), Gaps = 73/399 (18%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           +KRKS+VLIAA+SLD E+++VKNLKRLSIGSMDL++DPELE++V+               
Sbjct: 7   DKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRQGTGTATDQDTGT 66

Query: 106 XXLHEENI----IRSEQKE-EQGSEDND-------------------AYEEGDATN--VD 139
             +   +I     +SEQ E E G++DN                    A EE D +    D
Sbjct: 67  PYIATSSIKTETTKSEQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDDSYSFTD 126

Query: 140 DSIDITQTEYL------------HDEETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKT 187
           DS+D+T  EYL            +  E L + +++                         
Sbjct: 127 DSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRVLSGSISRSISGTSSTSDG-------- 178

Query: 188 LAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDID 247
                     ND       L QNLLWV ADQHPNVKPENYLEL+Q+TL+N+ +       
Sbjct: 179 ----------NDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTA 228

Query: 248 ENKLELGNNHVISNRKRT----GSVVRRPSRLKTSYTKF---DDEPPLADKPQEGEIQVD 300
                   + + + RKR+     S+ RRPSRL+TSYT+    D++  + D+P        
Sbjct: 229 NETQAQSLSGLKTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAA----- 283

Query: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESL--HLN 358
              ++  + + R+VSLK+ITEELTK+SN AGLTD+DAVTLAR+L ++   T +S    L+
Sbjct: 284 ---AAPTMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLS 340

Query: 359 GNHTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIR 397
            N  + + EFAS MF ++G T+P R SLRRSKFNTY+I+
Sbjct: 341 NNLADEEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379

 Score =  184 bits (467), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%), Gaps = 5/126 (3%)

Query: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876
           LPPRKLTF DV+KPD  N+P+KFTDSAFGFPLP +T STVIMFDHRL I+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAFNGDSALGMMDKNDSDGT 936
           LKLSDP R LRQQVLLSNFMY+YLNLVNH+LY++Q+    +  NG   +G     +S+  
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEEHMGNNGSMNMG-----NSNAL 938

Query: 937 ILIPDI 942
           I IPD+
Sbjct: 939 IDIPDM 944

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
           (ZDS1)
          Length = 1018

 Score =  221 bits (562), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 165/437 (37%), Positives = 228/437 (52%), Gaps = 36/437 (8%)

Query: 42  KELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXX 101
           ++  EKRKS+VLIAA+SLD E+QNVKNLKR+SIGSMDL++DPE+EF++N           
Sbjct: 67  RQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPR 126

Query: 102 XXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDA-TNVDDSIDITQTEYLHDEETLEKEK 160
                   E   + +EQ  EQG E     E  DA ++   S D  + E L    ++   +
Sbjct: 127 NSLTEESLEWFQLSAEQ--EQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSE 184

Query: 161 IIXXXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHP 220
            +                   +S    L      D  +   +     + NLLWV ADQHP
Sbjct: 185 ELSCSHPLSPPAAAKKSTL--MSSRSKLGRQHT-DTTHTKQATGEPFSSNLLWVRADQHP 241

Query: 221 NVKPENYLELIQDTLQNIQISTNQDIDENKLELGNNHVISNRKRTG---SVVRRPSRLKT 277
           NVKPENYLEL+ DTL N++I       ++ ++  N  V +    T    S+VR+ SRL+ 
Sbjct: 242 NVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASARSLVRKQSRLRK 301

Query: 278 SYTKFD--DEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDS 335
           S+T+ +  +E    D     EI V KR        +R  SLKEITEELT+ISNNAGLTDS
Sbjct: 302 SFTEVEAIEESQFTDS-IGSEIPVGKR--------MRVSSLKEITEELTRISNNAGLTDS 352

Query: 336 DAVTLARSLSMSGSFTNESLHLN---GNHTENDNEFASNMFNETGLTIPERSSLRRSKFN 392
           DA+TLAR+L +     +E    +    +    +NE+AS++  + GL IP RSSLRRSKF 
Sbjct: 353 DAITLARTLGIGSQSADEHATFSECVPSAEAEENEYASSILAKNGLAIPARSSLRRSKFT 412

Query: 393 TYKIRLEGS-SLPQAVKLNSLMNIQTNDNRRS-------ASSPASYTQVPQEQASL---- 440
           TY+IR  GS S P   K  S  ++     R S       A+   S+ ++  E  SL    
Sbjct: 413 TYRIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQS 472

Query: 441 -NDFHEIFDHYRRTSTD 456
            N  ++I+DHY  + TD
Sbjct: 473 PNSINDIYDHYNTSDTD 489

 Score =  175 bits (443), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (90%)

Query: 816 TLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLS 875
           +LPPRKL F+DV++P+  N+P+KFT SAFGFPLP +T STVIMFDHRL I VERAIYRLS
Sbjct: 895 SLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLS 954

Query: 876 HLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           HLKLSDP RELRQQVLLSNFMYSYLNLVNH+LY++Q+
Sbjct: 955 HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 991

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  212 bits (540), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 178/481 (37%), Positives = 241/481 (50%), Gaps = 119/481 (24%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K                 
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGES------------ 71

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDS--IDITQTEYLHDEETLEKEKIIX 163
                     S ++   G+  + A    D T V+++   D T  E LH       E    
Sbjct: 72  ----------SGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIE---- 117

Query: 164 XXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLL-----WVPADQ 218
                               G+K   H           S    L  N+L     WVPA+Q
Sbjct: 118 ---------SSNKTKQGNYLGIKKGVH-----------SPSRKLNANVLKKNLLWVPANQ 157

Query: 219 HPNVKPENYLELIQDTLQNIQIS-----------TNQDIDEN-------KLELGNNHVIS 260
           HPNVKP+N+LEL+QDTLQNIQ+S            N DI++N         E   N+ I+
Sbjct: 158 HPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTIN 217

Query: 261 -----NRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDK---RISSSDIKTIR 312
                +R    S++RRPS L+ SYT+FDD     +K       V+K   RIS   IK  R
Sbjct: 218 LNRGLSRHGNASLIRRPSTLRRSYTEFDDNEDDDNKGDSASETVNKVEERISK--IKE-R 274

Query: 313 SVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN-------ESLHLNGN----- 360
            VSL++ITEELTKISN+AGLTD+DA+TLAR+LSM+GS+++       E  +  G+     
Sbjct: 275 PVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFST 334

Query: 361 ---HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQT 417
              +T +D EFASNM     +T PERSSLRRS+FNTY+IR    S  Q  ++   ++   
Sbjct: 335 SQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR----SQEQEKEVEQSVDEMK 390

Query: 418 NDNRRSASSPASYTQV-------PQEQ-----------ASLNDFHEIFDHYRRTSTDWST 459
           ND+        +  +V       P  Q            S+ DF +I++HYR++S +W  
Sbjct: 391 NDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQ 450

Query: 460 E 460
           E
Sbjct: 451 E 451

 Score =  182 bits (461), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 3/109 (2%)

Query: 808 SPTAPQI---STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLG 864
           +P AP +   S LPPRKLTF DV KPD  N+P++FTDSAFGFPLP++T STVIMFDHRL 
Sbjct: 794 APAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLP 853

Query: 865 INVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913
           INVERAIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQV 
Sbjct: 854 INVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  213 bits (543), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 224/714 (31%), Positives = 324/714 (45%), Gaps = 129/714 (18%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           EKRKS VLIAA+SLD E+QNVK LKRLS+GSMDL++DPE E+ +                
Sbjct: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGSTNDSNSNTNTNTNT 74

Query: 106 XX-LHEENIIRSEQK--EEQGSEDNDAYEEGDAT------NV-----DDSIDITQTEYLH 151
              L +  +  ++    E + SE+ D     D+T      NV     D+S D T  EYLH
Sbjct: 75  KKNLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIEYLH 134

Query: 152 DEE------------TLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKTL----AHDVVLD 195
           +E+            TL +E  I                   LSGV +L    +  +   
Sbjct: 135 NEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRG--LSGVHSLNRGNSKQLKPK 192

Query: 196 VENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDENKLELGN 255
           ++N        +TQNLLWVPA++HP VKPENY+EL+QDTLQNI ++ N+   +N +E  +
Sbjct: 193 IQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDTLQNINLNLNE--TQNNVEDTS 250

Query: 256 N----------HVISNRKRT-------GSVVRRPSRLKTSYTK--------FDDEPPL-A 289
           N           VI  R+ +        S+VRRP+ L+ SY++         + E  L +
Sbjct: 251 NKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNS 310

Query: 290 DKPQE--------GEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLA 341
           DK +E          I +D +  S+        SLK+ITEELTKISN AGL++SDA++LA
Sbjct: 311 DKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLA 370

Query: 342 RSLSMSGSF--TNESLHLN---GNHTENDNE----------FASNMFNETGLTIPERSSL 386
           RSLS++GS   T+ S+  N        +DN+          +ASN+    G+T+P R SL
Sbjct: 371 RSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTR-SL 429

Query: 387 RRSKFNTYKIRLEGSSLPQAVKLN----SLMNIQTNDNRRSASSPASYTQVPQEQASLND 442
           RRSKFNTYKIR    ++ +  +++    S  N+  + NR S+        V +E A L  
Sbjct: 430 RRSKFNTYKIRNPSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDVLRESAPLT- 488

Query: 443 FHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEE-DLTHAXXXXXXXXXXXXXXXXXVLIK 501
           F  I +   +   D S +    +D +   SD++ D +H                  VL++
Sbjct: 489 FETISEEQVQ---DKSLDAIDILDKSLDISDKDFDSSHLSFSQGNITQSSDSSNDSVLVR 545

Query: 502 PHNTGSMISEKLDQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANEQTYQQLTXXXXXX 561
           P  + S+I EKLD                               A E   Q         
Sbjct: 546 PAYSHSIIQEKLD------------TDRGGDLEFSSNKFSETLFAKESDIQ--------- 584

Query: 562 XCVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPIFQIHSE------EAKXXXXXX 615
                +  DFVNLS+  R KS +  +E+ NHSK+RHSPI  I  E        K      
Sbjct: 585 -----DDPDFVNLSIPERTKSQRVRAEKSNHSKHRHSPIITISEETPFKINNKKQLSQPL 639

Query: 616 XXXXXXXXXXXXXTAPAVVEKKVEL----PTDTQASTHKKNSLEKRLAKLFKRK 665
                          P  ++ K  +      + + ST+KK   +K++  +FKRK
Sbjct: 640 LNESEINKGDHGSIIPENLKHKASVKEASSKEKEPSTNKKQRFDKKIVSIFKRK 693

 Score =  177 bits (450), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 95/112 (84%), Gaps = 4/112 (3%)

Query: 801 AEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFD 860
            E+E NT P     S+LP RKLTF+DVVKP+  N P++FTDSAFGFPLP +T STVIMFD
Sbjct: 873 VEQEANTLPE----SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFD 928

Query: 861 HRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           HRL +NVERAIYRLSHLKLSDP RELR+Q+LLSNFMY+YL+LVNH+LY+EQ 
Sbjct: 929 HRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQA 980

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  213 bits (542), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 168/492 (34%), Positives = 248/492 (50%), Gaps = 99/492 (20%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           +KRKS VLIAAKSLD E++++K+LKR SIGSMD+++DPELE++V+               
Sbjct: 32  DKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDPELEYRVSNINKQSTDTYSKR-- 89

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXX 165
                    RS   + Q  + ND +        DD + I  TE+L          +I   
Sbjct: 90  ---------RSITSDLQPLDANDDFS-------DDPLGIKSTEFL-------PSSVIRSS 126

Query: 166 XXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPE 225
                           LSG ++L  + + D    ++SK     +NLLWVPAD+HPNV P+
Sbjct: 127 NPSGNRSDKYTRRK--LSGSRSL--NTIPDSMA-YNSKASTTKKNLLWVPADKHPNVMPD 181

Query: 226 NYLELIQDTLQNIQISTNQDID-----------ENKLELGNNHVISNRKRTGSVVRRPSR 274
           NY+++IQ++L N+ + +N+D+D           EN  E      ++ ++R  S+VRRPS+
Sbjct: 182 NYIQMIQNSLNNLSLESNEDVDKDSKVLPQENKENIYEDRERLSVAYKRRNRSLVRRPSQ 241

Query: 275 LKTSYTKFDDEPPLADKPQEGEIQVDKR--------ISSSDIKTIR-------SVSLKEI 319
           L+ SYT+F++     D   E  +  + +         S   IKT +       S+SLK+I
Sbjct: 242 LRKSYTEFNNSDDEEDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDI 301

Query: 320 TEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGNHTENDN---------EFAS 370
           T ELTKISN+ GL+DSDAV+LARSLS++G + +E+          DN         EF S
Sbjct: 302 TAELTKISNSVGLSDSDAVSLARSLSITGPYQDETESDGAGDIMLDNPSDEESLNDEFVS 361

Query: 371 NMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLN-------SLMNIQTNDNRRS 423
           NM    GL IP RSSLRRSKF TY+ R   S      K N       S+ + + N+N   
Sbjct: 362 NMVLRNGLMIPTRSSLRRSKFTTYRSRTSSSDSLSPKKQNFDDKQETSVSSSKANENE-- 419

Query: 424 ASSPASYTQVPQ----------------EQASLNDFHEIFDHYRRTSTDWSTENEKYVDS 467
             +P  + ++P+                   + +DF +I+DHYR+ S+DW  E +K+ D+
Sbjct: 420 IKNP--FGKLPEVNLKAEESNEDDESLKTSPAASDFQDIYDHYRQPSSDWDMEFKKHDDT 477

Query: 468 -------TNYYS 472
                  TN YS
Sbjct: 478 SFTDSSITNSYS 489

 Score =  171 bits (434), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 84/97 (86%)

Query: 815  STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 874
            S LPPRKL F DV K D  N PI+FTDSAFGFPLP++T STVIMFDHRL +NVERAIYRL
Sbjct: 928  SVLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRL 987

Query: 875  SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 911
            SHLKLS+P R LR QVLLSNFMY+YL+LVNHTLYMEQ
Sbjct: 988  SHLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQ 1024

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  209 bits (533), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 182/540 (33%), Positives = 258/540 (47%), Gaps = 142/540 (26%)

Query: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI------------------------- 240
           DLT+NLLWVPA+QHPNVKPENYLEL+QDTLQNI +                         
Sbjct: 195 DLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISK 254

Query: 241 ---STNQDIDENKLELGNNHV-ISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGE 296
              S  + ID +   L    + I+NR R  S+VRRPSRL+TSYT+F+++       +E E
Sbjct: 255 SNMSEEEPIDRHPQSLDKTFLEITNRNR--SLVRRPSRLRTSYTEFEEDD--YSNSEESE 310

Query: 297 IQVDK-RISSSDIKTI----------------RSVSLKEITEELTKISNNAGLTDSDAVT 339
            + ++ ++SS + K                  RSVSLK+ITEELT ISN AGLTDSDA+T
Sbjct: 311 AKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAIT 370

Query: 340 LARSLSMSGSFTNESLHLNGNHTEN----DNEFASNMFNETGLTIPERSSLRRSKFNTYK 395
           LAR+LSM+ SF++ +++L  +  +N    ++EFASNMF + GLTIPERSSLRRSKFNTY+
Sbjct: 371 LARTLSMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTYR 430

Query: 396 IRLEGSSLPQAVKLNSLMN--------IQTNDNRRSASSPASYTQ----VPQEQASLNDF 443
           IR   SS     K + L+           T+D +R   SP S+T     +    +S    
Sbjct: 431 IRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQR---SPVSFTNRDSYLATTTSSPGSI 487

Query: 444 HEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHAXXXXXXXXXXXXXXXXXVLIKPH 503
            +++DHY+  +     E+++  D+ N  + + DL+HA                 +L+KP 
Sbjct: 488 SDLYDHYQDNA-----ESKQGNDNDN-EARQGDLSHASISQESSFLSNESSNDSILVKPL 541

Query: 504 NTGSMISEKLDQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANEQTYQQLTXXXXXXXC 563
            + SMI E LD                                ++  YQ+++        
Sbjct: 542 GSKSMIHENLDN-------------------------GQDHDDDQPAYQKVSKLNPTIPD 576

Query: 564 VDNEKADFVNLSVS-RRAKSTKRASERIN------------HSKNRHSPIFQIHSEEAKX 610
               K      S S  RA S + A+  +N             SK+RH PI     +  K 
Sbjct: 577 TSRSKHKRNGWSWSGNRANSEEDATVLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLK- 635

Query: 611 XXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRKQH-NG 669
                                  + K+ ELP +    +HK+ ++EKR  KLF+RK H NG
Sbjct: 636 -----------------------INKEAELPKE----SHKRETIEKRFVKLFRRKGHDNG 668

 Score =  195 bits (496), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 109/144 (75%), Gaps = 18/144 (12%)

Query: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876
           LP RKLTF DV +PD  NAPI+FTDSAFGFPLPM+T STVIMFDHRLGINVERAIYRLSH
Sbjct: 850 LPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSH 909

Query: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTG----DIAFNG----------D 922
           LKLSD  RELRQQVLLSNFMY+YLNLVNHTLYMEQV       D+A  G           
Sbjct: 910 LKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTDVIDSDIHES 969

Query: 923 SALG----MMDKNDSDGTILIPDI 942
           S+ G      ++N+++GTILIP+I
Sbjct: 970 SSYGTGVYTTEQNNANGTILIPEI 993

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 10/125 (8%)

Query: 28  NIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEF 87
           N  +  +RKT  S +   +KRKS+VLIAA+SLD E+Q+VKNLKRLSIGSMDL+IDPELEF
Sbjct: 4   NTNLLPLRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEF 63

Query: 88  KVNXXXXXXXXXXXXXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQT 147
           +VN                        RS +  EQ +E  D   +  + ++DDSI++TQT
Sbjct: 64  RVNNDKSNQSTPIGSYE----------RSNENLEQINEPEDNENDESSVSIDDSIELTQT 113

Query: 148 EYLHD 152
           EYLHD
Sbjct: 114 EYLHD 118

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  202 bits (514), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 113/150 (75%), Gaps = 22/150 (14%)

Query: 814  ISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYR 873
            ISTLPPRKLT+ DV +P+  NAPI+FTDSAFGFPLPM+T STVIMFDHRLGINVERAIYR
Sbjct: 927  ISTLPPRKLTYADVKRPEKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYR 986

Query: 874  LSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGT-----------GDIAFNG- 921
            LSHLKLSD  RELRQQVLLSNFMY+YLNLVNHTLYMEQV +           G+   NG 
Sbjct: 987  LSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVSSTETAPKDSVPGGNGVQNGS 1046

Query: 922  ---------DSALGMMDKNDSDGTILIPDI 942
                     +SA    ++N SDGTILIPDI
Sbjct: 1047 CNNVDQMSSNSAFA-TNQNKSDGTILIPDI 1075

 Score =  191 bits (484), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 178/547 (32%), Positives = 248/547 (45%), Gaps = 95/547 (17%)

Query: 202 SKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQ-----------ISTNQD----- 245
           S   DL  NLLWVPA+QHPNVKPENYLEL+ DTLQ I            I T+ D     
Sbjct: 226 SGTADLKSNLLWVPANQHPNVKPENYLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAA 285

Query: 246 --IDENKLELGNNHVISNRKRTG---SVVRRPSRLKTSYTKFDDEP------PLADKPQE 294
             +DE+  E  NN  +  R R G   S+VRRPSRL+ SY + D++          D  +E
Sbjct: 286 DSVDESDKE-NNNTRLRVRYRNGKASSLVRRPSRLRRSYIETDEDEDSNTSNAKIDDIEE 344

Query: 295 GEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN-- 352
           G   +D+R  +      +SVSL++ITEELTK+SN+ GLTD DAVTLAR+L+M+ ++T+  
Sbjct: 345 GGRSLDERKPTRTNGDRKSVSLRDITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTD 404

Query: 353 -ESL---------HLNGNHTEN------------DNEFASNMFNETGLTIPERSSLRRSK 390
            E L          L    +EN            +N+FASNMF + GL+IP RSSLRRSK
Sbjct: 405 SEGLDNLRTDSKEQLRAEESENPPGTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSK 464

Query: 391 FNTYKIRLEGSSLPQAVK------LNSLMNIQTNDNRRSAS--SPASYTQ--VPQEQASL 440
           FNTY+IR   +  P   K       ++ ++    D+   AS  SPA+     V  ++A +
Sbjct: 465 FNTYRIRTTSAPTPLVEKPKRNNSRHARLSFVHLDDEEFASHESPAALQSPTVNNDEAGV 524

Query: 441 ----NDFHEIFDHYRRT-----STDWSTENEKYVDSTNYYSDEEDLTHAXXXXXXXXXXX 491
                   +++DHY  T     S D S + E   D +  YS +++               
Sbjct: 525 IESPGSISDLYDHYTGTASEPGSPDVSEDKELKEDMSREYSTDDNDFSTNTSHDSSFLSN 584

Query: 492 XXXXXXVLIKPHNTGSMISEKLD---QHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANE 548
                 VL +P N   MISE  D   Q                              A +
Sbjct: 585 ESSNDSVLYRPTNIKPMISENFDAVEQEDEETISTAVAEPTKNDNNNNTNSMPWSWLAKD 644

Query: 549 QTYQQLTXXXXXXXCVDNEKAD-FVNLSVSRRAKSTKRASERINHSKNRHSPIFQIHSEE 607
            T             V   +A+   N  VS  A  +K   +R NHSKNRH PIF ++S  
Sbjct: 645 GTDIDDQPMDLKGEIVQEGEANTHTNDFVSVNAAPSKHPIDRGNHSKNRHMPIFTLNSAS 704

Query: 608 AKXXXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQ---ASTHKKNSLEKRLAKLFKR 664
                                  P + +K+ + P  ++   ++  KK +LE++  KLFKR
Sbjct: 705 TNQDD-----------------TPQMEQKEKKEPYVSKKEPSAGPKKKTLEEKFVKLFKR 747

Query: 665 KQHNGTC 671
           K H+   
Sbjct: 748 KHHSANA 754

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 43/44 (97%)

Query: 47 KRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVN 90
          KRKS+VLIAA+SLD E+QNVK+LKRLSIGSMDL+IDPELEF+VN
Sbjct: 26 KRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRVN 69

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  201 bits (510), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/217 (52%), Positives = 139/217 (64%), Gaps = 27/217 (12%)

Query: 753  SSEFVVETISELXXXXXXXXXXXXVNY-DVEVHSSISRDTTAGLEED--------IGAER 803
            SS+  VET+ E+            ++Y D  + + +  D +    ED        I AE 
Sbjct: 947  SSKEFVETVREIEGDDSQELSGGDISYEDNNIKNQLQEDESVVSPEDHFELSQESIEAED 1006

Query: 804  ED---NTSPTAP--QISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIM 858
            +    N S T P  Q   LPPRKLTF+DV +P+  NAP++FTDSAFGFPLP +T STVIM
Sbjct: 1007 QTQSFNDSATQPLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIM 1066

Query: 859  FDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG----T 914
            FDHRLGINVERAIYRLSHLKLSD  RELR+QVLLSNFMY+YLNLVNHTLYMEQV      
Sbjct: 1067 FDHRLGINVERAIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQQETI 1126

Query: 915  GDIAFNGDSA----LGMMDK-----NDSDGTILIPDI 942
             ++ F GD A    + M+       NDS+G+ILIPDI
Sbjct: 1127 DNVEFTGDDANDHQMNMVTGNGGIYNDSNGSILIPDI 1163

 Score =  195 bits (496), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 238/508 (46%), Gaps = 132/508 (25%)

Query: 138 VDDSIDITQTEYLHDEETLEK--EKIIXXXXXXXXXXXXXXXXXXXLSGVKTLAHD---- 191
           ++DSID+TQ+EYLHDE TL+K  +  +                   +SGV +L  +    
Sbjct: 163 IEDSIDVTQSEYLHDEATLKKKTQNDMNIETSNDQPNSLQRSSHRSMSGVGSLKRNGLNR 222

Query: 192 -------------------VVLDVENDHDSKMV------DLT-QNLLWVPADQHPNVKPE 225
                               +L  +++ D          +LT QNLLWVPA+QHPN+KPE
Sbjct: 223 RKLPFLSSSYASTSSTSKQSILSSQSEKDPTFTSSSSSDNLTPQNLLWVPANQHPNIKPE 282

Query: 226 NYLELIQDTLQNI------------QISTNQDI------DE-NKLELGNNHVISN----- 261
           +YLEL+QDTL NI            ++ST+ D+      DE NK  L  +++        
Sbjct: 283 SYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETNKENLNIDYLTKPSTSEL 342

Query: 262 RKRTGSVVRRPSRLKTSYTKF------DDEPPLADKPQEGEIQVDKR------------- 302
           R++  S+VRRPS L+ SYT+F      D+E   +D  +E ++  D               
Sbjct: 343 RRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLSTDNSTNNANHHQDIIIN 402

Query: 303 -------ISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESL 355
                  I   + ++ R VSLK+ITEELTKISNNAGLTDSDA+TLAR+LSM+GSF + S 
Sbjct: 403 NKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAITLARTLSMAGSFQDNSN 462

Query: 356 HL----------NGNHTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQ 405
           +           NGN T  D+E+ASNMF + GLTIP RSSLRRS+FNTY+IR   SS   
Sbjct: 463 NNHNSDNFNEEQNGN-TPEDDEYASNMFMKNGLTIPTRSSLRRSRFNTYRIRSGSSSTSA 521

Query: 406 AVKLNSLMNIQ---TNDNRR-----SASSPASYTQVPQEQ----------ASLNDFHEIF 447
               +S        TN+N+        + P  +   P              S     +++
Sbjct: 522 QSSSSSRTTSGSQMTNNNKTVTEPGRGNQPEDHNNTPASHYTARLSYMSTTSPGSISDLY 581

Query: 448 DHYRRTSTDWS----TENEKYVD-----------------STNYYSDEEDLTHAXXXXXX 486
           DHY+ + +D +     +N   +D                 +   Y+   DL+HA      
Sbjct: 582 DHYQNSDSDVTPKAEQQNNNNIDKLTASNSNNTNTNNINSNNEQYNISSDLSHASVSQDS 641

Query: 487 XXXXXXXXXXXVLIKPHNTGSMISEKLD 514
                      +LIKP ++ SM+ E +D
Sbjct: 642 SFLSNESSNNSILIKPQSSQSMLQENID 669

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 9/71 (12%)

Query: 19 SSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMD 78
          S G  + NN   +++ RK         EKRKSD+ IAAKSLD E+Q+V+NLKRLSIGSMD
Sbjct: 18 SYGNDNINNAASIQQARK---------EKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMD 68

Query: 79 LVIDPELEFKV 89
          L+IDPELEF+V
Sbjct: 69 LLIDPELEFRV 79

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 3/109 (2%)

Query: 808 SPTAPQI---STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLG 864
           +P AP +   S LPPRKLTF DV KP+  NAP++F+DSAFGFPLP++T STVIMFDHRL 
Sbjct: 773 APVAPPLRHTSVLPPRKLTFADVKKPEKPNAPVQFSDSAFGFPLPLLTVSTVIMFDHRLP 832

Query: 865 INVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913
           INVERAIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ  
Sbjct: 833 INVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQAA 881

 Score =  170 bits (431), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 171/318 (53%), Gaps = 82/318 (25%)

Query: 207 LTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQD------------IDENKLELG 254
           L +NLLWVPA+QHPNVKP+NYLEL+QDTLQNI++  N D            + E     G
Sbjct: 146 LKKNLLWVPANQHPNVKPDNYLELVQDTLQNIRLGDNDDNDDENDKNENNRVTEETESHG 205

Query: 255 N----NHVISNRK--RTG--SVVRRPSRLKTSYTKFDDEPPLADKPQEGEI-----QVDK 301
           N    N V  NR   R G  S++RRPS L+ SYT+FDD     D  Q  E      +V++
Sbjct: 206 NKENMNTVDLNRGMLRHGNASLIRRPSTLRRSYTEFDDIE--DDNGQRNEASKTVNRVEE 263

Query: 302 RISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN--------- 352
           R  +S IK  R VSL++ITEELTKISN+AGLT++D +TLAR+LSM+GS+++         
Sbjct: 264 R--TSRIKE-RPVSLRDITEELTKISNSAGLTNNDTITLARTLSMAGSYSDGGNEAGPKD 320

Query: 353 -------ESLHLNGNH--TENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIR------ 397
                  ES+ +  +     +D E+ASNM     +T PERSSL+RS+FNTY+IR      
Sbjct: 321 LKDDYEGESIGVASSQRKASDDGEYASNMPTNNDMTGPERSSLKRSRFNTYRIRSQEQEK 380

Query: 398 ------------------LEGSSLPQAVKLNSLMNIQTNDNRRSASSPASYTQVPQEQAS 439
                             L   +L   ++       Q +D    ASSP           S
Sbjct: 381 EEEQNVEETKNEEAGRLHLTDKTLKTEIESPKSPFGQEDDESEYASSP----------GS 430

Query: 440 LNDFHEIFDHYRRTSTDW 457
           + DF +I+DHYR+ S DW
Sbjct: 431 VGDFQDIYDHYRQFSGDW 448

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%)

Query: 46 EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFK 88
          +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  177 bits (449), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 79/99 (79%), Positives = 88/99 (88%)

Query: 815 STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 874
           S LPPRKLTF DV K +  NAP++FTDSAFGFPLP++T STV+MFDHRL INVERAIYRL
Sbjct: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878

Query: 875 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913
           SHLKLS+  RELR+QVLLSNFMY+YLNLVNHTLYMEQ G
Sbjct: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 168/305 (55%), Gaps = 51/305 (16%)

Query: 207 LTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDE-----------------N 249
           L  NLLWVPA+QHPNVKP+NYLEL+QDTLQNI++  N D ++                 N
Sbjct: 146 LKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLGDNDDDNDNNDNEGDEAHGETESYGN 205

Query: 250 KLELGNNHVISNRKRTG--SVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSD 307
           K  L   +V     R G  S++RRPS L+ SYT+FDD      +  +  + V+K    + 
Sbjct: 206 KENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTS 265

Query: 308 IKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN--------------- 352
               R +SL++ITEELTKISN+AGLTD DA+TLAR+L+M+GS+++               
Sbjct: 266 RIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYE 325

Query: 353 -ESLHLNGNHTE--NDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKL 409
            E+  + G+ TE  +D E+ASNM      T PERSSL+RS+FNTY+IR       +   L
Sbjct: 326 EENAKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHTEEQEEEQVL 385

Query: 410 N-------SLMNIQTNDNRRSASSPAS-YTQVPQEQ------ASLNDFHEIFDHYRRTST 455
                   S +++  N      +SP S + Q   E        S+ DF +I+DHY ++S 
Sbjct: 386 EETKKEDVSRLHLAENTIEIGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQSSG 445

Query: 456 DWSTE 460
           DW  E
Sbjct: 446 DWEKE 450

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%)

Query: 46 EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFK 88
          +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  173 bits (438), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (1%)

Query: 801 AEREDNT--SPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIM 858
           ++RE+ T  S TA +    PPRKLTF DV K D +NAPI+FTDSAFGFPLP +T STVIM
Sbjct: 703 SQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIM 762

Query: 859 FDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 911
           FDHRL I+VERAIYRLSHLKLS+  R LR+QVLLSNFMYSYLNLVNHTLYMEQ
Sbjct: 763 FDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 157/290 (54%), Gaps = 54/290 (18%)

Query: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDE---NKLELGNNHVISNR 262
           ++ QNLLWV ADQHPNVKPENY+EL+QD L NIQI   ++ D+   + L+  + +  SN 
Sbjct: 149 EVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNN 208

Query: 263 KRT---GSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEI 319
           KR+     +VRRPS L+ SYT+FD+   + D   + +   +  + S+     +  +LK+I
Sbjct: 209 KRSPNNTGLVRRPSLLRKSYTEFDE---VKDSDIKEQSSTNNNVDSTPHN--KKFTLKDI 263

Query: 320 TEELTKISNNAGLTDSDAVTLARSLSMSG-SFTNESLHLN----------GNHTENDNEF 368
           TEELT+ISN AGLT++DAVTLAR+LSM+  +  +E+  L                ND+ +
Sbjct: 264 TEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNY 323

Query: 369 ASNMFNET-GLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSP 427
           AS M   T  L   E S+L+RSK+ TY IR +    P                    + P
Sbjct: 324 ASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDP--------------------TIP 362

Query: 428 ASYTQVPQE--QASLNDFHEIFDHYRRTSTDWST--------ENEKYVDS 467
            S     Q+  +AS    ++I+DHYR  S DWS+        EN+K  D+
Sbjct: 363 VSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDT 412

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 35/38 (92%)

Query: 50 SDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEF 87
          S+V IAA+SLD E+++VKNLKRLSIGSMDL++DPE++ 
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  172 bits (435), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (90%)

Query: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876
           LPPR+LTF+DV++P+  N+P+KFT SAFGFPLP +T STVIMFDHRL I  ERAIYRLSH
Sbjct: 791 LPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIYRLSH 850

Query: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           LKLSDP RELRQQVLLSNFMYSYLNLVNH+LY++Q+
Sbjct: 851 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 886

 Score =  167 bits (422), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 145/420 (34%), Positives = 211/420 (50%), Gaps = 71/420 (16%)

Query: 77  MDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIRSE-----QKEEQGSEDNDAYE 131
           MDL++DPE+EF+                   L EE+I R +     + +   ++ +D+Y 
Sbjct: 1   MDLLVDPEMEFRFGGSASMSSAPRRS-----LSEESIDRFQFSVENEPDPYVTDADDSY- 54

Query: 132 EGDATNVDDSIDITQTEYLHD---EETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKTL 188
               +  +DS +IT  ++L     ++  EK+                          K+L
Sbjct: 55  ----SFTEDSAEITCEDHLQSTFADKAAEKDSKYTRNISRSFTVKKSSLSSSRSKFGKSL 110

Query: 189 AHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDE 248
             D     END +      + NLLWVPADQHPNVK ENYLEL+ DTL N+Q+   + +++
Sbjct: 111 -KDSPPTSENDENEP---FSSNLLWVPADQHPNVKLENYLELVTDTLHNLQLVGREQLEK 166

Query: 249 NKLELGNNHVISNRKRTG---------SVVRRPSRLKTSYTKFDD-EPPLADKPQEGEIQ 298
           N     +N+ +S    T          S+VR+PSRL+ S+T+ ++ + P +D+    E  
Sbjct: 167 NP---NSNYQLSQTNSTSAHEAIPSKNSLVRKPSRLRKSFTEAENIDDPNSDEDLNTETP 223

Query: 299 VDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSG-------SFT 351
           + KR         R  SLKEITEELT+ISNNAGLTDSDA+TLAR+L +         +FT
Sbjct: 224 ISKR--------KRVSSLKEITEELTRISNNAGLTDSDAITLARTLGIGTPAATDRRNFT 275

Query: 352 NESLHLNGNHTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIR---------LE-GS 401
           N  +  N    E D E+ASN+  + GL+I + SSLRRSKF TY+IR         LE GS
Sbjct: 276 NTDVASND---EIDEEYASNILTKNGLSISQGSSLRRSKFATYRIRSPSGDSLPLLESGS 332

Query: 402 ---SLPQAVKLNSLMNIQTNDNRRSASSPASY--TQVPQEQASLNDFHEIFDHYRRTSTD 456
              SLP+  +     +++     +    P S+  +  PQ   S+ND   I+DHY  T TD
Sbjct: 333 LLPSLPEYAQEQVANHLKDAHVFKEGQPPQSWDASITPQSPNSIND---IYDHYNTTDTD 389

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  168 bits (425), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/132 (62%), Positives = 102/132 (77%), Gaps = 8/132 (6%)

Query: 819 PRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLK 878
           P+KLTF+DV KP+ +NAP++FTDSAFGFPLP +T STVIM DHRLGINVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 879 LSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAFNG-DSALGMMDK------- 930
           LS+  RELRQQVLLSNFMY+YLNLV HTL +E+      + +  D+ +  ++        
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQSTSSPDNKVVELEGSNYNTAH 815

Query: 931 NDSDGTILIPDI 942
           N SDGTILIP++
Sbjct: 816 NQSDGTILIPEL 827

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 207/377 (54%), Gaps = 54/377 (14%)

Query: 50  SDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLH 109
           S+ L AA+SLD E+QNVKNLKRLSIGS+DL+ DPEL   V                    
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTE---------------R 65

Query: 110 EENIIRSEQKEEQGSEDNDAYEEGDATNVDD---SIDITQTEYL--HD---EETLEKEKI 161
           E+    ++      +E++D   E D ++ D+   SID T+ EYL  +D   E + E  K 
Sbjct: 66  EDTSYDADLSNGSFTEEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQESSNESPKG 125

Query: 162 IXXXXX-----XXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPA 216
           +                        L G ++L++  +   +N+  S    ++  L WVPA
Sbjct: 126 VARTRSLNLNYHANSNSDISIKERTLRGSRSLSN--LKKPKNEEQS----VSDKLFWVPA 179

Query: 217 DQHPNVKPENYLELIQDTLQNIQ-ISTN---QDIDENKLELGNNHVIS-NRKRTGSVVRR 271
           +QHPNVKPENYLEL+++TL  I+ I+T+   +  + ++ E+ N   I+ N +  GS+VRR
Sbjct: 180 NQHPNVKPENYLELVKETLNKIRDINTDGKEKSENNSEEEVSNKENINENGRLRGSIVRR 239

Query: 272 PSRLKTSYTKFDDEP-PLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNA 330
           PS+L+ SYT+F  E   L DK     +  ++ IS+ +    + +SLKEIT EL K SN A
Sbjct: 240 PSKLRKSYTEFSSEDLELLDKA----LSNNRIISTRNTTNSKRLSLKEITNELVKHSNKA 295

Query: 331 GLTDSDAVTLARSLSMSGSFT--NESLHLNGNHTE--------NDNEFASNMFNETGLTI 380
           GLTD +AVTLAR+LS++ S T  NE+   + ++TE        +D+ FA+ +   +    
Sbjct: 296 GLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTFATAVVGNSHSLA 355

Query: 381 PERSSLRRSKFNTYKIR 397
              SSLRRSKFNTY+++
Sbjct: 356 SNTSSLRRSKFNTYRVK 372

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  163 bits (412), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 90/116 (77%)

Query: 800  GAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMF 859
            G +   N +  AP  STLP RKLTF DV     +N P++F DS FGFPLP++T ST+IMF
Sbjct: 921  GQQASTNGNGPAPVTSTLPLRKLTFADVPPTGRANGPVQFMDSTFGFPLPLLTRSTIIMF 980

Query: 860  DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTG 915
            ++RL I+VERAIYRLSHLKL D  +ELRQQVLLSNFMY+YL+LVNH+LY+EQ G G
Sbjct: 981  ENRLPISVERAIYRLSHLKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYLEQYGLG 1036

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 164/360 (45%), Gaps = 117/360 (32%)

Query: 200 HDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDENKLELGNNHVI 259
           ++ + VD T  + WV ADQHPNV P   L    + L+N+ I   Q   +++L       I
Sbjct: 137 YNEEKVDSTNAVKWVRADQHPNVSPSKQL---NEVLENLHIEDKQVTKKDRLS------I 187

Query: 260 SNRKRTGSVVRRPSRLK--------------TSYTK------FDDEPPLADKPQEGEIQV 299
           + +K   S+VRRPS+L+               S+TK      F++E   +   Q  +I +
Sbjct: 188 TYKKNKSSIVRRPSKLRHSSNDESFDSDIEDPSFTKDHDTFSFENESSFSTNDQT-DISI 246

Query: 300 DKRISSSDIKTIRS-------VSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN 352
             R  S D  TI S       +SLK IT+ELT+ISN+AGL DSDA+ LA+SL ++ S+ N
Sbjct: 247 -TRFDSRD--TINSNGNSNHRLSLKNITDELTRISNDAGLVDSDAINLAQSLGLTSSYQN 303

Query: 353 ESLHLNGNHTENDNEFA---------SNM--FNE-------------------TGLTIPE 382
                N N   +D   A         SNM  FNE                    G+ +P 
Sbjct: 304 -----NINDFYDDKNLAIYDSTINESSNMETFNEQDKILNLNSENSKGGTFAVNGMKVPM 358

Query: 383 RSSLRRSKFNTYKI---RLEGSSLPQAVKL----------------------------NS 411
           RSSLRRSKFNTY+      + S +P+  ++                            N+
Sbjct: 359 RSSLRRSKFNTYRYSRNNQKDSDIPEKKEIENPYMGSQHISEEKSDVTEIQVALSNNQNA 418

Query: 412 LMNIQTNDNRRS-ASSPASYTQVPQEQAS----------LNDFHEIFDHYRRTSTDWSTE 460
           L++ + N+++ S   S   Y   P E+ +          ++DF +I+DHYR+ S++W  E
Sbjct: 419 LVSPERNNDKISFKDSQKDYLTKPIEEKADADEQSGSSPVSDFQDIYDHYRQPSSEWEDE 478

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 34/45 (75%)

Query: 45 FEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKV 89
           E R   +L A + LD EI+NV +LKR SIGSMD++IDPELE+++
Sbjct: 11 IESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRI 55

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  161 bits (407), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (86%)

Query: 815 STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 874
           S LPPRKLTF+DV KP+  N P+++TDSAFGFPLP++T STVIM+D RL  NVERAIYRL
Sbjct: 714 SILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVERAIYRL 773

Query: 875 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 911
           SHLKL +  R LR+QVL+SNFMY+YLNLVNHTL+MEQ
Sbjct: 774 SHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 168/356 (47%), Gaps = 47/356 (13%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVI--DPELEF-KVNXXXXXXXXXXXX 102
           E+R S + +AA+SL  E+QNV +LKRLS+GS+D++   D E  F K+             
Sbjct: 9   EQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFSFNKLQRNISAKKTQEIL 68

Query: 103 XXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKII 162
                  E   +      E     +DA +E + T  + SI           ET +K   +
Sbjct: 69  SQKRTSTETESVSYNTLLEGFYGSDDAEDESEKTTRNTSIS----------ETRDKSPSV 118

Query: 163 XXXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNV 222
                              +  V   +    L  +  +D    ++++ LLWV AD HPNV
Sbjct: 119 PARARGRK-----------VGAVSRSSRTANLGKKGGYDK---EISKGLLWVSADVHPNV 164

Query: 223 KPENYLELIQDTLQNIQISTNQDIDENKLELGNNHVISNR-KRTGSVVRRPSRLKTSYTK 281
           KPENY+EL+QDTL+    S++  I E   E     + + R K++ S+VR+PS+L+ SY  
Sbjct: 165 KPENYIELVQDTLEQYN-SSDYSISERLPEDKQVLLSAFRAKKSHSLVRKPSKLRKSYIS 223

Query: 282 FDDEPPLADKPQEGEIQVDKR--ISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVT 339
            +      + P E       R  + SS    + ++SLKE++EEL KIS++AGLT  DA+T
Sbjct: 224 IESN----NTPAENNDANAHRKPLGSSRDPVVSTISLKELSEELAKISSSAGLTKDDAIT 279

Query: 340 LARSLSMSGSFTNESLHLNGNHTEND--------NEFASNMFNETGLTIPERSSLR 387
           LA +L ++ S     LH +   T           N FA++      L IP+RS LR
Sbjct: 280 LATTLWLTHSL----LHSDNVTTIKSSQDIDGYINSFATSFSRSGPLEIPKRSVLR 331

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 70/95 (73%), Positives = 81/95 (85%)

Query: 819  PRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLK 878
            P KL+F DV + D  N  + FTDSAFGFPLP++TNSTVIMFD+RL I+VERAIYRLSHLK
Sbjct: 968  PHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIYRLSHLK 1027

Query: 879  LSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913
            LS+P R LRQQVLLSNFMY+YL+LVNHTLYME+  
Sbjct: 1028 LSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKYA 1062

 Score =  132 bits (332), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 151/284 (53%), Gaps = 63/284 (22%)

Query: 196 VENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI--STNQDIDENKLEL 253
           +++D D++ V +++NLLWVPA QHPN KP+N   + QD+L N  +   +N D+D  +   
Sbjct: 144 LDDDIDNENVPISKNLLWVPASQHPNAKPKN---INQDSLLNNGLVQDSNSDLDTQEELQ 200

Query: 254 GNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKR-ISSSDIKTIR 312
            N   +++R++  S+VR+PS L+ SYT F D+    ++ +E     + R  S +++  ++
Sbjct: 201 RNKSYLNSRRKNNSLVRKPSTLRKSYTDFTDDDSDYNRSREANTSNNSRNTSDNEMNNLK 260

Query: 313 S-----------VSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESL------ 355
           +            SL +I EEL+KISN+AGLT+++A TLARSLS++G + N  L      
Sbjct: 261 ASHGNSPSADSTFSLNDIKEELSKISNSAGLTETNAATLARSLSITGKYINRELLEEDDE 320

Query: 356 ---------------------------HLNGNHTENDNEFASNMFNETGLTIPERSSLRR 388
                                       LN    E D EFAS++     + +P RSSLRR
Sbjct: 321 ASTSDDNNDANDINTSIEDKSTLKQIPDLN----EVDGEFASHILLTKNVNVPVRSSLRR 376

Query: 389 SKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNR-RSASSPASYT 431
            KFNTY++R   ++        S +  + NDN+ R  SSPA Y+
Sbjct: 377 KKFNTYRVRSSSTT--------SHLTEKKNDNKLRQVSSPAYYS 412

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%)

Query: 48 RKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVN 90
          R+ ++LIAA++LD E+Q+VK LKR SIGS DLV DPELEF+VN
Sbjct: 36 REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEFRVN 78

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  152 bits (384), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 98/136 (72%), Gaps = 17/136 (12%)

Query: 787  ISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGF 846
            +S DT+  +E   G ERE       P+++     KLTF DV +    N+ + F +SAFGF
Sbjct: 1409 LSNDTS--IESAEGTERE-------PEVN----YKLTFADVKRNLQPNSSMIFQESAFGF 1455

Query: 847  PLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHT 906
            PLP +TNST+IM D+RL INVERAIYRLSHLKLSDP RELR+QVLLSNFMYSYL+LVNHT
Sbjct: 1456 PLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLSDPKRELREQVLLSNFMYSYLHLVNHT 1515

Query: 907  LYMEQVGTGDIAFNGD 922
            LY+EQV  G    NGD
Sbjct: 1516 LYLEQVTQG----NGD 1527

 Score = 95.1 bits (235), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 90/334 (26%), Positives = 157/334 (47%), Gaps = 92/334 (27%)

Query: 211 LLWVPADQHPNVKPENYLELIQDTLQ---NIQISTNQDIDENKLELGNNH---VISNRK- 263
           L W   ++  ++KP+NY+EL+ D +    N+ ++TN     NK+E G+++   +  +RK 
Sbjct: 368 LSWSSVNKRSSLKPDNYIELVNDAINSSNNVSVTTNSTPTANKIEQGDSYYDNIPDSRKV 427

Query: 264 --RTGSVVRRPSRLKTSYTKFD-------------------DEPPLADK--PQEGEIQVD 300
             R  S VRRPS L+ SYT  D                   DE    D     +     D
Sbjct: 428 KYRRNSNVRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNNDHQLTPDDSFNFD 487

Query: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMS------------- 347
             ++++ + +  +++LK++T+ELTK+SNNAGLTDSDA+TLA++LS++             
Sbjct: 488 ANVTNNSVAS--NLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERLLDNTTTVNSN 545

Query: 348 ---GSFTNESLHL---------------NGNHTENDNEFASNMFNETGLTIPERSSLRRS 389
                + +  ++L               +    E+D E+ASN+  +  + I  RS+L+R+
Sbjct: 546 TNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNINISNRSTLKRN 605

Query: 390 KFNTYKIRLEGS------------------SLPQ------AVKLN-SLMNIQTNDNRRSA 424
           KF +   R   S                  ++P        + +N S+ N ++N+ +   
Sbjct: 606 KFKSATSRGNSSEESNLQLDLETIKRDPSNNMPNIIISKSTIDVNDSIDNAESNNKKFLD 665

Query: 425 SSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWS 458
           S+     Q+    ++     EI+DHYR+TS DW+
Sbjct: 666 SNEMLNNQLNVSPSA----SEIYDHYRQTSGDWT 695

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 2/57 (3%)

Query: 35 RKTQLSKKELF--EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKV 89
          R    ++K L   +KR SDV IAA+SLD ++QNVK LKR SIGS+DL+ DP+LE  V
Sbjct: 20 RSKSQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLELVV 76

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 270 RRPSRLKTSYTKFDD---EPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKI 326
           RR S L++SYT+FDD   E    +K  +   +V++R S      IR     E T +  KI
Sbjct: 1   RRSSTLRSSYTEFDDIEDENGQRNKDSKFVNKVEERTSR-----IRENECHE-TLKNKKI 54

Query: 327 SNNAGLTDSDAVTLARSLSM 346
           SN+A LTD   + L R+LS+
Sbjct: 55  SNSASLTDIGVIALVRTLSI 74

>Ecym_4030 Chr4 (71418..73877) [2460 bp, 819 aa] {ON} similar to
           Ashbya gossypii ADR231C
          Length = 819

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 831 DYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQV 890
           +++++ IKF D +    LP+   S +   DH +   V   ++    L LS  G E+  + 
Sbjct: 409 EWNSSSIKFVDGSVDNDLPIAKLSEMFNVDHIIACQVNIHVFPFLKLSLSCVGGEVEDEF 468

Query: 891 ---LLSNFMYSYLNLVNHTLYMEQVGT 914
              L  N    Y  + N  ++M +VGT
Sbjct: 469 SARLKQNLSTVYNFMANEVIHMLEVGT 495

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,670,762
Number of extensions: 3900490
Number of successful extensions: 19362
Number of sequences better than 10.0: 179
Number of HSP's gapped: 19912
Number of HSP's successfully gapped: 237
Length of query: 942
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 823
Effective length of database: 39,836,145
Effective search space: 32785147335
Effective search space used: 32785147335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)