Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML108W8.830ON105874471e-58
Suva_13.368.830ON105874299e-56
Skud_13.338.830ON105874262e-55
Smik_13.268.830ON105874253e-55
ZYRO0G13970g8.830ON112842911e-34
KLTH0C04070g8.830ON113902841e-33
Kwal_27.103288.830ON127912833e-33
Kpol_1069.38.830ON115882789e-33
TBLA0B031908.830ON1221022772e-32
AAL184W8.830ON112872711e-31
KLLA0D01661g8.830ON112862702e-31
CAGL0J06666g8.830ON112862641e-30
KNAG0G033608.830ON111902632e-30
Ecym_27118.830ON115862615e-30
TPHA0I001908.830ON138562626e-30
NCAS0B011008.830ON115972607e-30
NDAI0E003608.830ON1221062546e-29
SAKL0D01738g8.830ON178872552e-28
TDEL0B006708.830ON111872484e-28
KAFR0A027608.830ON112602346e-26
NCAS0G021602.112ON27541605.2
KNAG0C066305.706ON128137606.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML108W
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   176   1e-58
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   169   9e-56
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   168   2e-55
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   168   3e-55
ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   116   1e-34
KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   114   1e-33
Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   113   3e-33
Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   111   9e-33
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   111   2e-32
AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   108   1e-31
KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   108   2e-31
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   106   1e-30
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   105   2e-30
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   105   5e-30
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   105   6e-30
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   104   7e-30
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   102   6e-29
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   102   2e-28
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   100   4e-28
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...    95   6e-26
NCAS0G02160 Chr7 (387037..387864) [828 bp, 275 aa] {ON} Anc_2.11...    28   5.2  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...    28   6.2  

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative
          protein of unknown function whose structure defines a
          new subfamily of the split beta-alpha-beta sandwiches;
          green fluorescent protein (GFP)-fusion protein
          localizes to the cytoplasm and nucleus; YML108W is not
          an essential gene
          Length = 105

 Score =  176 bits (447), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 87/87 (100%), Positives = 87/87 (100%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF
Sbjct: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          DAEICIPNEGHIKYEISSDGLIVLMLD
Sbjct: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
          (REAL)
          Length = 105

 Score =  169 bits (429), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (97%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          M+K+NTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDEL+LPF VDELDELN WFDKF
Sbjct: 1  MAKNNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVWFDKF 60

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          DAEICIPNEGHIKYEISSDGLIVLMLD
Sbjct: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
          (REAL)
          Length = 105

 Score =  168 bits (426), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 84/87 (96%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          MSKSN YRMLVLLEDDTKI+KEDEKFLKGKPGKMHEFVDELILPF +DELDELN WFDKF
Sbjct: 1  MSKSNAYRMLVLLEDDTKISKEDEKFLKGKPGKMHEFVDELILPFEIDELDELNIWFDKF 60

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          DAEICIPNEGHIKYEISSDGLIVLMLD
Sbjct: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
          (REAL)
          Length = 105

 Score =  168 bits (425), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (97%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          MS++NTYRMLVLLEDD K+NKEDEKFLKGKPGKMHEFVDELILPF+VDELDELN WFDKF
Sbjct: 1  MSRNNTYRMLVLLEDDAKVNKEDEKFLKGKPGKMHEFVDELILPFDVDELDELNIWFDKF 60

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          DAEICIPNEGHIKYEISSDGLIVLMLD
Sbjct: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
          {ON} highly similar to uniprot|Q03759 Saccharomyces
          cerevisiae YML108W defines a new subfamily of the split
          beta-alpha-beta sandwiches.
          Length = 112

 Score =  116 bits (291), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (84%), Gaps = 8/84 (9%)

Query: 5  NTYRMLVLLEDDTKINK-EDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAE 63
          N+YRMLVLLE+    +K EDEK       K+HEF+DEL+LPFNVDE+D+LN+WFDKFD +
Sbjct: 6  NSYRMLVLLEEPVSGSKPEDEK-------KVHEFMDELVLPFNVDEIDQLNSWFDKFDEQ 58

Query: 64 ICIPNEGHIKYEISSDGLIVLMLD 87
          ICIPNEGHIKYEI+SDG+IVL+LD
Sbjct: 59 ICIPNEGHIKYEITSDGIIVLILD 82

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar
          to uniprot|Q03759 Saccharomyces cerevisiae YML108W
          defines a new subfamily of the split beta-alpha- beta
          sandwiches.
          Length = 113

 Score =  114 bits (284), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 3/90 (3%)

Query: 1  MSKSNTYRMLVLLED---DTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWF 57
          MS    YRMLVL+ED         E E   +G P   HEFVDELILPF +D++D+LN WF
Sbjct: 1  MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60

Query: 58 DKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
          DKFDA+ICIPNEG IKYEISSDGL+VL+LD
Sbjct: 61 DKFDADICIPNEGFIKYEISSDGLVVLLLD 90

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  113 bits (283), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 58/91 (63%), Positives = 67/91 (73%), Gaps = 5/91 (5%)

Query: 1   MSKSNTYRMLVLLEDDTK----INKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTW 56
           MS    YRMLVL+ED  K    ++ E E+     P   HEFVDELILPF +D++D LN W
Sbjct: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73

Query: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD
Sbjct: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLD 104

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
          [348 nt, 116 aa]
          Length = 115

 Score =  111 bits (278), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 67/88 (76%), Gaps = 5/88 (5%)

Query: 5  NTYRMLVLLED-----DTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDK 59
          + YRML+LLE+     D +  ++D      +  KMHEFVDEL+LPF VDE+D LN WFDK
Sbjct: 7  SNYRMLILLEEGMENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSLNDWFDK 66

Query: 60 FDAEICIPNEGHIKYEISSDGLIVLMLD 87
          FD EICIPNEGHIKYEI+SDG+IVL+LD
Sbjct: 67 FDEEICIPNEGHIKYEITSDGIIVLILD 94

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  111 bits (277), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 69/102 (67%), Gaps = 16/102 (15%)

Query: 2   SKSNTYRMLVLLEDD-------------TKINKEDEKFLKGK---PGKMHEFVDELILPF 45
           S S  YRM+VLLE+D             +  N   EK    K   P K HEF+DELILPF
Sbjct: 3   SNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELILPF 62

Query: 46  NVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
           +VDELD LN WFDKFD +ICIPNEGHIKYEI+SDGLI+L+LD
Sbjct: 63  HVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILD 104

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  108 bits (271), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 3/87 (3%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          M+  N YRM++LLE+  K +  D + ++      H+FVDEL+LP  VD+L+ LNTWFDKF
Sbjct: 1  MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          D EICIPNEGHIKYEISSDGLIVL+LD
Sbjct: 58 DEEICIPNEGHIKYEISSDGLIVLILD 84

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa]
          {ON} similar to uniprot|Q03759 Saccharomyces cerevisiae
          YML108W defines a new subfamily of the split
          beta-alpha- beta sandwiches.
          Length = 112

 Score =  108 bits (270), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 55/86 (63%), Positives = 63/86 (73%), Gaps = 3/86 (3%)

Query: 2  SKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFD 61
          +  N YRML+LLE+    +  D    K K    HEFVDEL LP  VDE+D LN+WFDKFD
Sbjct: 3  ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59

Query: 62 AEICIPNEGHIKYEISSDGLIVLMLD 87
           +ICIPNEGHIKYEISSDGLIVL+LD
Sbjct: 60 EKICIPNEGHIKYEISSDGLIVLILD 85

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa]
          {ON} similar to uniprot|Q03759 Saccharomyces cerevisiae
          YML108w
          Length = 112

 Score =  106 bits (264), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (75%), Gaps = 5/86 (5%)

Query: 4  SNTYRMLVLLEDDTKINKEDEKFLKGKPGK--MHEFVDELILPFNVDELDELNTWFDKFD 61
          SN YRM+VLLE+  +   ED      K  K  MHEF+DEL LPF +DE+D LN WFDKFD
Sbjct: 2  SNLYRMMVLLEEPME---EDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFD 58

Query: 62 AEICIPNEGHIKYEISSDGLIVLMLD 87
           EICIPNEGHIKYEI+SDGLIVL+LD
Sbjct: 59 DEICIPNEGHIKYEITSDGLIVLILD 84

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
          Anc_8.830 YML108W
          Length = 111

 Score =  105 bits (263), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/90 (65%), Positives = 67/90 (74%), Gaps = 12/90 (13%)

Query: 5  NTYRMLVL----LEDD---TKINKEDEKFLKGKPGK-MHEFVDELILPFNVDELDELNTW 56
          +TYRML+L    LEDD   T++  ED      +P K  HE++DEL LPF +DELD LN W
Sbjct: 7  DTYRMLILVEEPLEDDVPTTEVTSED----GSQPIKSTHEYIDELHLPFGLDELDALNEW 62

Query: 57 FDKFDAEICIPNEGHIKYEISSDGLIVLML 86
          FDKFD EICIPNEGHIKYEISSDGLIVLML
Sbjct: 63 FDKFDEEICIPNEGHIKYEISSDGLIVLML 92

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar
          to Ashbya gossypii AAL184W
          Length = 115

 Score =  105 bits (261), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 64/86 (74%), Gaps = 4/86 (4%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          MS  N YRM++LLE+    +K DE     K    H+FVDE++LP  VDELD LN WFDKF
Sbjct: 4  MSADNFYRMMILLEEAIPESK-DENI---KANATHDFVDEVVLPMQVDELDVLNKWFDKF 59

Query: 61 DAEICIPNEGHIKYEISSDGLIVLML 86
          D EIC+PNEG+IKYEISSDGLIVLM+
Sbjct: 60 DEEICLPNEGYIKYEISSDGLIVLMV 85

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  105 bits (262), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 51/56 (91%)

Query: 32  GKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
            K HEFVDELILPFNVDELD LN WFDKFD E+CIPNEGHIKYEI+SDGLIVLMLD
Sbjct: 46  SKSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLMLD 101

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
          Anc_8.830 YML108W
          Length = 115

 Score =  104 bits (260), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 67/97 (69%), Gaps = 16/97 (16%)

Query: 1  MSKSNTYRMLVL----------LEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDEL 50
          MSK N YRMLVL           ++DT  +K  E      P K HEF++EL+LPF V EL
Sbjct: 1  MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATE------PKKTHEFIEELLLPFEVSEL 54

Query: 51 DELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
          D LN WFDKFD EICIPNEGHIKYEISSDGLIVL+LD
Sbjct: 55 DALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLD 91

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  102 bits (254), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 71/106 (66%), Gaps = 24/106 (22%)

Query: 2   SKSNTYRMLVLLED--------DTKI------------NKEDEKFLKGKPGKMHEFVDEL 41
           S +N YR+++LLE+        D  I            N ++EK +K    KMHEF++EL
Sbjct: 3   STNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVK----KMHEFIEEL 58

Query: 42  ILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
           ILPF  +ELD LN WFDKFD EICIPNEGHIKYEI+SDGLIVL+LD
Sbjct: 59  ILPFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLD 104

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  102 bits (255), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 53/87 (60%), Positives = 64/87 (73%), Gaps = 2/87 (2%)

Query: 1   MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
           MS  N YRML+LLE+   I    ++  +      HEFVDEL+LP  VDE+D LN WFDKF
Sbjct: 70  MSGDNGYRMLMLLEE--AIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKF 127

Query: 61  DAEICIPNEGHIKYEISSDGLIVLMLD 87
           D +ICIPNEG+IKYEISSDGLIVL+L+
Sbjct: 128 DEQICIPNEGYIKYEISSDGLIVLILN 154

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
          YML108W
          Length = 111

 Score =  100 bits (248), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 63/87 (72%), Gaps = 4/87 (4%)

Query: 5  NTYRMLVLLEDDTKINKEDEKFLKGKPGK----MHEFVDELILPFNVDELDELNTWFDKF 60
          N Y M++ LE+  +  +E      G+  +     HEFVDEL+LPF VDE+D LN WFDKF
Sbjct: 6  NFYHMIIFLEESIENGQEGNSVDNGEDKQDVKSSHEFVDELVLPFQVDEIDALNEWFDKF 65

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          D ++CIPNEGHIKYEI+SDG++VL+LD
Sbjct: 66 DEKLCIPNEGHIKYEITSDGMMVLLLD 92

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
          Anc_8.830 YML108W
          Length = 112

 Score = 94.7 bits (234), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 43/60 (71%), Positives = 50/60 (83%)

Query: 28 KGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
          K +  K HEF++ELILPF   ELD LN WFDKFD EICIPNEG+IKYEISSDGL+VL++D
Sbjct: 35 KQESTKSHEFIEELILPFETSELDTLNEWFDKFDEEICIPNEGNIKYEISSDGLVVLLID 94

>NCAS0G02160 Chr7 (387037..387864) [828 bp, 275 aa] {ON} Anc_2.112
          YNL159C
          Length = 275

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 13 LEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDEL 53
          L ++  +N  +E  L    G MH F  EL   F   E++EL
Sbjct: 35 LNEEQGVNHIEESLLNALNGAMHTFAQELEHQFEAIEMEEL 75

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%), Gaps = 2/37 (5%)

Query: 46   NVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLI 82
            +VDELD L T+F  FDA   + +  HI Y+I+++G++
Sbjct: 1089 SVDELDRLKTFF-IFDATSWLRHFAHI-YKIATNGVL 1123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.139    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,577,723
Number of extensions: 460409
Number of successful extensions: 1456
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1441
Number of HSP's successfully gapped: 31
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)