Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML007W (YAP1)5.528ON65065027690.0
Smik_13.1445.528ON63965521340.0
Skud_13.1475.528ON66567719900.0
Suva_13.1555.528ON64566918540.0
CAGL0H04631g5.528ON5884374563e-48
KAFR0C054005.528ON4813144241e-44
SAKL0G04950g5.528ON5672733883e-39
Kpol_1023.975.528ON5913863832e-38
KNAG0B036805.528ON4822413511e-34
TDEL0A039205.528ON4662153242e-31
NCAS0H025605.528ON587633212e-30
NDAI0C010605.528ON637633222e-30
ZYRO0D12584g5.528ON5791923193e-30
KLTH0G03784g5.528ON5693273009e-28
Kwal_47.186315.528ON584642892e-26
KLLA0A01760g5.528ON5831112794e-25
TBLA0G009305.528ON608592563e-22
Kpol_1004.225.528ON475632525e-22
TPHA0D023405.528ON506632509e-22
TPHA0K005205.528ON5601852456e-21
TBLA0D016405.528ON599591796e-13
Ecym_40645.528ON426681572e-10
NCAS0F011005.528ON475551521e-09
NDAI0H016105.528ON519541449e-09
CAGL0F03069g5.528ON486801377e-08
ADR195C5.528ON288671302e-07
KNAG0C032105.528ON384851313e-07
YDR423C (CAD1)5.528ON409531295e-07
KAFR0E032905.528ON265841204e-06
Smik_4.6985.528ON393801197e-06
Suva_2.600singletonOFF382531152e-05
YPR199C (ARR1)na 1ON29445761.0
Skud_16.2948.113ON120337751.9
Smik_16.2498.113ON120337752.0
YPR010C (RPA135)8.113ON120337742.8
KNAG0K011403.163ON92957733.7
CAGL0M10087g2.493ON36885724.0
Kwal_26.89328.713ON40478714.8
Suva_9.2317.115ON24586696.2
NCAS0A08020singletonON23866689.1
NOTE: 1 genes in the same pillar as YML007W were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML007W
         (650 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...  1071   0.0  
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   826   0.0  
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   771   0.0  
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   718   0.0  
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   180   3e-48
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   167   1e-44
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   154   3e-39
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   152   2e-38
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   139   1e-34
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   129   2e-31
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   128   2e-30
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   128   2e-30
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   127   3e-30
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   120   9e-28
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   115   2e-26
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   112   4e-25
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   103   3e-22
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   101   5e-22
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   100   9e-22
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    99   6e-21
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    74   6e-13
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    65   2e-10
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    63   1e-09
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    60   9e-09
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    57   7e-08
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    55   2e-07
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    55   3e-07
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    54   5e-07
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    51   4e-06
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    50   7e-06
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    49   2e-05
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    34   1.0  
Skud_16.294 Chr16 complement(541842..545453) [3612 bp, 1203 aa] ...    33   1.9  
Smik_16.249 Chr16 complement(453693..457304) [3612 bp, 1203 aa] ...    33   2.0  
YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}...    33   2.8  
KNAG0K01140 Chr11 complement(222139..224928) [2790 bp, 929 aa] {...    33   3.7  
CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} som...    32   4.0  
Kwal_26.8932 s26 (1011029..1012243) [1215 bp, 404 aa] {ON} YOR26...    32   4.8  
Suva_9.231 Chr9 (372034..372771) [738 bp, 245 aa] {ON} YIR018W (...    31   6.2  
NCAS0A08020 Chr1 (1585065..1585781) [717 bp, 238 aa] {ON}              31   9.1  

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/650 (82%), Positives = 537/650 (82%)

Query: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPXXXXXXXXXXQ 60
           MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQP          Q
Sbjct: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPKKKGSKTSKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
           DLDPETKQKRTAQNRAAQRAF              VQSLESIQQQNEVEATFLRDQLITL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITL 120

Query: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180
           VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180

Query: 181 TFQYPLXXXXXXXXSKNVGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXXXXXXX 240
           TFQYPL        SKNVGKQLPSPNDPSHSAPMPINQTQKKL                 
Sbjct: 181 TFQYPLDNDNDNDNSKNVGKQLPSPNDPSHSAPMPINQTQKKLSDATDSSSATLDSLSNS 240

Query: 241 XXXXXXTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVS 300
                 TPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVS
Sbjct: 241 NDVLNNTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVS 300

Query: 301 EFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXXXXXXPALTNTWESHSNITDNTPAN 360
           EFCSKMNQVCGTRQCPIPKKPISALDKEVFA         PALTNTWESHSNITDNTPAN
Sbjct: 301 EFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNSPALTNTWESHSNITDNTPAN 360

Query: 361 VIATDATKYENSFSGFGRLGFDMSANHYVVXXXXXXXXXXXXXXXXXXXXXXXXSDDVLP 420
           VIATDATKYENSFSGFGRLGFDMSANHYVV                        SDDVLP
Sbjct: 361 VIATDATKYENSFSGFGRLGFDMSANHYVVNDNSTGSTDSTGSTGNKNKKNNNNSDDVLP 420

Query: 421 FISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNI 480
           FISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNI
Sbjct: 421 FISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNI 480

Query: 481 QLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEXXXXXXXXXNMSDDESSLIKNQLI 540
           QLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLE         NMSDDESSLIKNQLI
Sbjct: 481 QLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEDDDDDKKAANMSDDESSLIKNQLI 540

Query: 541 NEEPELPKQYLQSVPGNESEISQKNGSSLQXXXXXXXXXXXXXXXXVVPSKEGSLLRCSE 600
           NEEPELPKQYLQSVPGNESEISQKNGSSLQ                VVPSKEGSLLRCSE
Sbjct: 541 NEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSE 600

Query: 601 IWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 650
           IWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN
Sbjct: 601 IWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 650

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/655 (67%), Positives = 475/655 (72%), Gaps = 21/655 (3%)

Query: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPXXXXXXXXXXQ 60
           MSVSTAKRSLD+VS GSLAEF+ SK  H+EIENEH   GTRD +D+EQP          Q
Sbjct: 1   MSVSTAKRSLDLVSSGSLAEFDDSKPHHEEIENEHTSNGTRDNDDNEQPKRKGTKTSKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
           DLDPETKQKRTAQNRAAQRAF              VQSLESIQQQNEVEATFLRDQL+TL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLVTL 120

Query: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180
           VNELKKYRPETRNDSKVLEYLA+RDPNLH S    NH+NS PI TPND+IQENVKQKMNF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPNDEIQENVKQKMNF 180

Query: 181 TFQYPLXXXXXXXXSKNVGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXXXXXXX 240
           TFQYPL        +KN  +QLPSPNDP+HS  +PI Q QKK                  
Sbjct: 181 TFQYPL--DNDSDENKNKERQLPSPNDPNHSVSIPIAQKQKKSSNTTDSSSATLDSLSNS 238

Query: 241 XXXXXXTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVS 300
                 TPNSS+SMDWLDNVIYTN+FVSGDDG   +TKN+DSN+FSNDFNFENQFDEQVS
Sbjct: 239 NDVLNNTPNSSSSMDWLDNVIYTNKFVSGDDGCKRETKNVDSNLFSNDFNFENQFDEQVS 298

Query: 301 EFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXXXXXXPALTNTWESHSNITDNTPAN 360
           EFCSKMNQVCGTRQCPIPKKP+S LDKEVFA         P+LTNTWESHSNIT NTPAN
Sbjct: 299 EFCSKMNQVCGTRQCPIPKKPVSTLDKEVFASSSILSANSPSLTNTWESHSNITVNTPAN 358

Query: 361 VIATDATKYENSFSGFGRLGFDMSANHYVVXXXXXXXXXXXXXXXXXXXXXXXXSDDVLP 420
           VI  D T  + SFS FG+LGF ++ANH+ V                        +DDVLP
Sbjct: 359 VIGND-TSIDTSFSSFGQLGFGVAANHHDV----NNDNTSSTGNKNGSNKNSTNNDDVLP 413

Query: 421 FISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNI 480
           FISESPFDM+QVTNFF PG T   NN A++ N + LQ+SK+DIPFINANLAFPD+NSTNI
Sbjct: 414 FISESPFDMDQVTNFFCPGPTNTINNVAASANSNFLQNSKDDIPFINANLAFPDENSTNI 473

Query: 481 QLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEXXXX-----XXXXXNMSDDESSLI 535
           QLQP SESQSQNKFDYDMFFRDSSKEGNNLF EFLE              N SDDESSLI
Sbjct: 474 QLQPISESQSQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDDDDDGNKKAYNTSDDESSLI 533

Query: 536 KNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQXXXXXXXXXXXXXXXXVVPSKEGSL 595
           KNQLINEEP       QS   NESE +Q+  S +Q                VVPSKEGSL
Sbjct: 534 KNQLINEEP-------QSTLKNESESAQRKDSYVQ--EAIDNNNGNGNDNDVVPSKEGSL 584

Query: 596 LRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 650
           LRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN
Sbjct: 585 LRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 639

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/677 (61%), Positives = 459/677 (67%), Gaps = 39/677 (5%)

Query: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPXXXXXXXXXXQ 60
           MSVSTAKRSLD+ SPGSLAEF+ S + HDEIENEHR   TRD +D+EQP          Q
Sbjct: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
           DLDPETKQKRTAQNRAAQRAF              VQ LE+IQQQNEVEATFLRDQL+TL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTL 120

Query: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180
           VNELKKYRPETRNDSKVLEYLA RDPNL  S N+ N S++ PI TP+++IQENV+QKMNF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPTSNNSTNSSSNRPIITPSEEIQENVRQKMNF 180

Query: 181 TFQYPLXXXXXXXXSKNVGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXXXXXXX 240
           TFQY L        SKN+ KQLPSPNDPSHSAP+P  Q QKK                  
Sbjct: 181 TFQYAL-----DNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKSSDATDSSTATLDSLSNS 235

Query: 241 XXXXXXTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVS 300
                 TPNSS+SMDWLDNVIYTNRFV+G DGS  + KN+DSNMFSN+FNFENQFDEQVS
Sbjct: 236 HDVLNNTPNSSSSMDWLDNVIYTNRFVAGGDGSKLEVKNVDSNMFSNNFNFENQFDEQVS 295

Query: 301 EFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXXXXXXPALTNTWESHSNITDNTPAN 360
           EFCSKMNQVCGTRQCPIPKKP+S LD+EVFA         PALTNTWESHSNIT NTPAN
Sbjct: 296 EFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHSNITANTPAN 355

Query: 361 VIATDATKYENSFSGFGRLGFDMSANHYVVXXXXXXXX--------------------XX 400
           +   D      S SGFG+LGF+++ + +                                
Sbjct: 356 ITTNDT-----SLSGFGQLGFELTTSRHAAEENSTGNTDNDNNSGDSSNNKNNNNNNNNN 410

Query: 401 XXXXXXXXXXXXXXSDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSK 460
                            V+PFIS+SPFDMNQVTNFFSPGST   N AAS+ NPSL Q++K
Sbjct: 411 NNSNNNKNNNNNGDDGGVIPFISDSPFDMNQVTNFFSPGSTNNINIAASSANPSLSQNTK 470

Query: 461 EDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNN-------LFGE 513
           +D+PFINA LAFPD+N TNIQLQPFSESQSQNKFDYDMFFRDSS+ GN+          +
Sbjct: 471 DDVPFINAGLAFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNSLFEEFLEEEED 530

Query: 514 FLEXXXXXXXXXNMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQXXX 573
             +         N SDDESSLI+NQLINEEP+   Q   S   NE E S K  S      
Sbjct: 531 DDDDDNNNEKATNASDDESSLIRNQLINEEPQPLNQNSLSSLNNEKETSPKTNSG--GTQ 588

Query: 574 XXXXXXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG 633
                        VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG
Sbjct: 589 NANDSDGNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG 648

Query: 634 VVINAEDVQLALNKHMN 650
           VVINAEDVQLALNKHMN
Sbjct: 649 VVINAEDVQLALNKHMN 665

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/669 (60%), Positives = 454/669 (67%), Gaps = 43/669 (6%)

Query: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPXXXXXXXXXXQ 60
           MS+S AKRSLD+VS  SLA+ + S S HDE+EN+H      D +D++QP          Q
Sbjct: 1   MSISAAKRSLDLVSSSSLAQSDDSVSHHDEVENDHIHDDMHDNDDNDQPRRKGSKTSKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
           DLDPETK KRTAQNRAAQRAF              V SLESIQQ+NEVEATFLRDQL+TL
Sbjct: 61  DLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLRDQLVTL 120

Query: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180
           V+ELKKYRPETRNDSKVLEYLARRDPNLH   N+  ++NSEPI TPNDDIQ+NVKQKMNF
Sbjct: 121 VSELKKYRPETRNDSKVLEYLARRDPNLH-PPNSNTNNNSEPIVTPNDDIQKNVKQKMNF 179

Query: 181 TFQYPLXXXXXXXXSKNVGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXXXXXXX 240
           TFQYPL         KN+ KQLPSPNDP+HSA +PI  TQKKL                 
Sbjct: 180 TFQYPL--DNDDNDGKNMEKQLPSPNDPNHSAHVPIAPTQKKLSDATDSSTATLDSFSNN 237

Query: 241 XXXXXXTPNSSTSMDWLDNVIYTNRFVSGDDGSN------SKTKNLDSNMFSNDFNFENQ 294
                 TPNSS+SMDWLDNV+YTN+FV+G D  N      SK K +DSNMFSNDFNFENQ
Sbjct: 238 NDVLNITPNSSSSMDWLDNVMYTNKFVAGGDQKNASNESKSKPKGVDSNMFSNDFNFENQ 297

Query: 295 FDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXXXXXXPALTNTWESHSNIT 354
           FDEQVSEFCSKMNQ CGT+QCPIPKK +  LDKEVFA         P LTNTW+SHSN+T
Sbjct: 298 FDEQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVFASSSVLSANSPVLTNTWDSHSNVT 357

Query: 355 DNTPANVIATDATKYENSFSGFGRLGFDMSANHYVVXXXXXXXXXXXXXXXXXXXXXXXX 414
            NTPAN+    +     S S FG+ GFD++ NHY                          
Sbjct: 358 TNTPANITTNGS-----SSSSFGQPGFDLNTNHYATNDKYTDNSDNNKTNNY-------- 404

Query: 415 SDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNT-NPSLLQSSKEDIPFINANLAFP 473
            +D+LPFISESPFDMNQVTNFFSPG+    N   +N+ NPSL QS+K+DIPFIN +LAFP
Sbjct: 405 -NDILPFISESPFDMNQVTNFFSPGTNNTTNANTTNSHNPSLQQSTKDDIPFINTSLAFP 463

Query: 474 DDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFL------------EXXXXX 521
           DDN TNIQLQP S+SQ QNKFDYDMFFRDSSKEGNNLF EFL            +     
Sbjct: 464 DDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDDDDDDGNDGNDND 523

Query: 522 XXXXNMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQXXXXXXXXXXX 581
               N SDDES+LIKN+LINEEP+   Q   S P N SE+ Q   SS             
Sbjct: 524 GEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSS-------NSEDVN 576

Query: 582 XXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDV 641
                VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDV
Sbjct: 577 DNDNEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDV 636

Query: 642 QLALNKHMN 650
           QLALNKHMN
Sbjct: 637 QLALNKHMN 645

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  180 bits (456), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 148/437 (33%), Positives = 196/437 (44%), Gaps = 101/437 (23%)

Query: 251 STSMDWLDNVIYTNRFVS-GDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQV 309
           ++S DWLD+V+ +++ +S G  GS                +F N FDEQVSEFC+K+NQ 
Sbjct: 214 TSSEDWLDDVMTSHKQISRGQSGSG--------------IDFNNFFDEQVSEFCTKLNQA 259

Query: 310 CGTRQCPIPKKPISALDKEVFAXXXXXXXXXPALTN----------TWESHSNITDNT-- 357
           CGT+ CPIP+   SA    +           P + N              H N T+N   
Sbjct: 260 CGTKACPIPQSK-SAATTPLPGTSSNGNSNSPMIINDTMGDVSLNMQGNEHGNATNNLVT 318

Query: 358 -PANVIAT--DATKYENSFS-----GFGRLGFDMSANHYVVXXXXXXXXXXXXXXXXXXX 409
            PA +  T  D +   N  S     GFG+LGF                            
Sbjct: 319 DPAFLSNTWDDMSPASNQHSTGGAPGFGQLGF---------------------------- 350

Query: 410 XXXXXSDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLL-------QSSKED 462
                 +D+L F   SP         +SP   G G       +P++        +S   +
Sbjct: 351 GDNLLGNDIL-FSPNSPA--------YSPSVLGSGRTQEVYRSPAVQKVVEKENESKSVN 401

Query: 463 IPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEXXXXXX 522
            PFIN++LAFP D   N     F E+   N  D D    D+    N+L  ++        
Sbjct: 402 FPFINSSLAFPGDYDNNF----FRETTDLNFDDNDQ--DDNFTNSNDLVNDYF-----TT 450

Query: 523 XXXNMSDDESSLIKNQLINEEPELPKQ----------YLQSVPGNESEISQKNGSSLQXX 572
              +  + +S+LI N L+ EEP +  +           L S    E+  +Q  G      
Sbjct: 451 NIPDTDNSDSALIANGLVKEEPSMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTTKD 510

Query: 573 XXXXXXXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSER 632
                         VVPS++  LLRCSEIWDRIT HPKYSDID+DGLCSELMAKAKCSER
Sbjct: 511 DNEDDDEDDENDNTVVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSER 570

Query: 633 GVVINAEDVQLALNKHM 649
           GVVINA+DVQ+ALNKHM
Sbjct: 571 GVVINADDVQVALNKHM 587

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 56/84 (66%)

Query: 60  QDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLIT 119
           Q+LDPET+ KR AQNRAAQ+AF              V  LE++ + NEVE  FLRDQL  
Sbjct: 21  QELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLNEVETNFLRDQLSI 80

Query: 120 LVNELKKYRPETRNDSKVLEYLAR 143
           LV EL+KYRPET+ D KVL+YL +
Sbjct: 81  LVKELRKYRPETKQDHKVLKYLEK 104

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 151/314 (48%), Gaps = 59/314 (18%)

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
           +LD E K KRTAQNRAAQRAF              V  L +IQ+QNE+E+ FLR QLITL
Sbjct: 41  ELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIESEFLRSQLITL 100

Query: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180
           V ELKKYRPET NDS+VL YLA+ +                     N +  EN+ +K NF
Sbjct: 101 VKELKKYRPETANDSQVLNYLAKHE---------------------NGNFNENLSKKSNF 139

Query: 181 TFQYPLXXXXXXXXSKN-----VGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXX 235
           +F +P           +         +PSP++       P+  +  K             
Sbjct: 140 SFAFPWDDNNATTDKSDNLNTTTNNNIPSPDN------SPVTASNDKKNYPSSVSSIEPL 193

Query: 236 XXXXXXXXXXXTPN------SSTSMDWLDNVIYT------------NRFVSGDDGSNSKT 277
                      +P+       S S++WLDN+++T            N  +S +D + SK 
Sbjct: 194 NQNNNNNISSLSPSLDDNDGISPSINWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKN 253

Query: 278 KNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXXX 337
              DS + SN+FNFE+QFDE+V++FC KMNQVCGTR  PIPKK  S L            
Sbjct: 254 PMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNL---------PST 304

Query: 338 XXXPALTNTWESHS 351
              P  TNT++S S
Sbjct: 305 ESTPLFTNTFDSPS 318

 Score =  122 bits (307), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 51/63 (80%), Positives = 59/63 (93%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           VVPSK+ +LLRCSE+WDRIT HPKYSDID+DGLC ELMAKAKCSE+GVV+NAEDVQ AL+
Sbjct: 418 VVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALS 477

Query: 647 KHM 649
           KH+
Sbjct: 478 KHL 480

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  154 bits (388), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 140/273 (51%), Gaps = 43/273 (15%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           L  E K KRTAQNRAAQRAF              V  LE++++QNEVE  FLR QL+TL+
Sbjct: 54  LGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRSQLMTLI 113

Query: 122 NELKKYRPETRNDSKVLEYLARRD--------------PNLHFSKNNVNHSNSEPIDTPN 167
           +ELKKYRPE   D++VLEYLA+R+               N      +V+HS+SE      
Sbjct: 114 SELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSSE------ 167

Query: 168 DDIQENVKQKMNFTFQYPLXXXXXXXXSKNVGKQLPSPN-DPSHSAPMPINQTQKKLXXX 226
             I++N+++KM+FTF++P           + G    S N  PS S+  P N T       
Sbjct: 168 SHIRDNIQKKMDFTFEFPWKDNAGRTQFPSPGSSSVSSNHKPSFSSNAPFNATN------ 221

Query: 227 XXXXXXXXXXXXXXXXXXXXTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFS 286
                               T ++S  M + D+ +      S + G+NS T        +
Sbjct: 222 ----------------NTPSTSSASLDMFYQDDALPKFTSSSLERGNNSGTIADAGFSIT 265

Query: 287 NDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPK 319
           NDF+FE+ FDEQVSEFC++MNQ CGTR  P+P+
Sbjct: 266 NDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQ 298

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 56/63 (88%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           VVPS++G LL+C EIWDRIT+HPKYSD+D+DGLC EL  KAKCSE+GVV+NA+DVQ AL 
Sbjct: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563

Query: 647 KHM 649
           KHM
Sbjct: 564 KHM 566

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/386 (30%), Positives = 172/386 (44%), Gaps = 89/386 (23%)

Query: 277 TKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXX 336
           T   DS++FSNDFNF++ FD+QVS FC KMNQ CGT+Q P+PK    +   +        
Sbjct: 281 TVGYDSDLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGN 340

Query: 337 XXXXPALTNTWESHS-------NITDNTPAN----VIATDATKYENSFSGFGRLGFDMSA 385
               P  ++   S S       N   ++P+N     +   +    N+ S FG+LGF   +
Sbjct: 341 PSTTPNESSNDSSLSIAKFDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLS 400

Query: 386 NHYVVXXXXXXXXXXXXXXXXXXXXXXXXSDDVLPFISESPFDMNQVTNFFSPGSTGIGN 445
           N                                  FIS      + +T+  +  S    +
Sbjct: 401 NDITFNSNDSNWND---------------------FIS---LKTDSMTSVPTTSSVATND 436

Query: 446 NAASNTNPSLLQS-SKEDIPFINANLAFPDDNSTNIQLQPFSESQSQ-NKFDYDMFFRDS 503
           +  + + PS   S  KE +PFI+ ++AFP             E+++  + FD  MFFRD 
Sbjct: 437 HPINISKPSEENSPRKEVLPFIDTSIAFP-------------ETKADFDAFDNQMFFRDD 483

Query: 504 SKEGNNLFGEFLEXXXXXXXXXNMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQ 563
                  F E L          N+SDD                       + G ES+  Q
Sbjct: 484 G------FNESL----------NISDD-----------------------IVGAESDDEQ 504

Query: 564 KNGSSLQXXXXXXXXXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSEL 623
            N +                   V+P+ +G LL+CSE+WDRIT HP+YSDID+DGLC EL
Sbjct: 505 DNNNDNDLISKNLVCEEVKEHDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQEL 564

Query: 624 MAKAKCSERGVVINAEDVQLALNKHM 649
           M  AKCS++GVV++++DVQ AL+ HM
Sbjct: 565 MHNAKCSDKGVVVDSKDVQKALSNHM 590

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%), Gaps = 17/123 (13%)

Query: 63  DPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLVN 122
           D E K KRTAQNRAAQRAF              V  LE ++QQN+VE+ FLR+QL  +++
Sbjct: 53  DHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMID 112

Query: 123 ELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFTF 182
           ELKKYRPE  +D KVLEYLA+ + N    K                 I++N+++K +F+F
Sbjct: 113 ELKKYRPEKSSDIKVLEYLAKHEENGSTEK-----------------IKKNIQRKEDFSF 155

Query: 183 QYP 185
           +YP
Sbjct: 156 EYP 158

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 120/241 (49%), Gaps = 54/241 (22%)

Query: 426 PFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKE--------------DIPFINANLA 471
           P  +N ++N +    T  G+  +  T+P L +SS                +IPFIN +LA
Sbjct: 278 PSLLNSLSNTWGTDRTDAGSATSETTSPRLTESSSSTVTTNNDLKLDADFEIPFINTSLA 337

Query: 472 FPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEXXXXXXXXXNMSDDE 531
           FP D+    Q             D ++FFRD+  E  +   +FLE             +E
Sbjct: 338 FPTDDGAVPQT-----------VDDNIFFRDTQHEQRSALDDFLEEEELTDNQQQQQHEE 386

Query: 532 SSLIKNQLINEEP---ELPKQYLQSVPGNESEISQKNGSSLQXXXXXXXXXXXXXXXXVV 588
                N LINE P   E  K+   S+  NE    Q                       VV
Sbjct: 387 KI---NLLINEVPFSIEADKEVPFSIEPNEDGDPQ-----------------------VV 420

Query: 589 PSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKH 648
           PSK+G LL+CSEIWDRIT HPKYSD+D+DGLC ELM KAKCSERGVV+NA+DV+ ALN+H
Sbjct: 421 PSKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALNRH 480

Query: 649 M 649
           +
Sbjct: 481 I 481

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 141/318 (44%), Gaps = 71/318 (22%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           LD E + KRT QNRAAQRAF              V  L  IQ+QNEVE+ FLR QL+TLV
Sbjct: 45  LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLV 104

Query: 122 NELKKYRPETRNDSKVLEYLARRDPNLHFSKNNV--NHSNSEPIDTPNDDIQENVKQKMN 179
           +ELKKYRPET NDSKVLEYLA+ D        NV  N     P            + + +
Sbjct: 105 HELKKYRPETSNDSKVLEYLAKHD--------NVPPNQQGQAPA----------ARDRGD 146

Query: 180 FTFQYPLXXXXXXXXSKNVGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXXXXXX 239
           F+F++P           N   Q  +   PS  +P   +Q  K                  
Sbjct: 147 FSFEFPWKGRTAPEFD-NSTTQETTTATPSPVSPGTKDQQGK------------------ 187

Query: 240 XXXXXXXTPNSSTSMDWLDNV-----IYTNRFVSGDDGSNSKTKNL----DSNMFSNDFN 290
                          DWLD V     +Y  +      G+ S++  L    DS   SN+  
Sbjct: 188 -------------PTDWLDEVLSSTELYAKQQQQQLQGNRSESPFLAGYDDSLTVSNEIT 234

Query: 291 FENQFDEQVSEFCSKMNQVCGTRQCPIPK-KPISALDKEVFAXXXXXXXXXPALTNTWES 349
           F+ QFDEQVS+FC +MN+ CG++  P+PK K  S     V +          +L+NTW  
Sbjct: 235 FDTQFDEQVSDFCVRMNEACGSKTNPVPKSKKGSVFSNSVLSPPSLLN----SLSNTWG- 289

Query: 350 HSNITDNTPANVIATDAT 367
               TD T A    ++ T
Sbjct: 290 ----TDRTDAGSATSETT 303

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 110/215 (51%), Gaps = 55/215 (25%)

Query: 439 GSTGIGNNAASNTNPSLLQS--SKEDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDY 496
            S   G  + + +   L ++  S+ ++PFI+  +AFP D+                  D 
Sbjct: 303 ASPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDD------------------DE 344

Query: 497 DMFFRDSSKEGNNLFGEFLEXXXXXXXXXNMSDDESSLIKNQLINEEPELPKQYLQSV-P 555
            +FFR + ++ N+LF E L+          +   +++ +   LINEEP       +   P
Sbjct: 345 GLFFR-THRDENSLFAELLD---------EVEPTDNNFVNENLINEEPSTTTAVAEETRP 394

Query: 556 GNESEISQKNGSSLQXXXXXXXXXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDID 615
             ++E                          VVPS++G LL+CSE+WDRITTHPKYS ID
Sbjct: 395 KPKTETD------------------------VVPSRDGKLLKCSEVWDRITTHPKYSAID 430

Query: 616 VDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 650
           +DGLC ELM KAKCSE+GVV+ AEDVQ  L+KHM+
Sbjct: 431 IDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHMD 465

 Score =  106 bits (265), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 75/124 (60%), Gaps = 16/124 (12%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           LD ETK KRTAQNRAAQRAF              VQSLE   +   VE+ FLR QL+TLV
Sbjct: 54  LDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQLLTLV 113

Query: 122 NELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFT 181
           NELKKYRP   ND +VL+YLA+             H  +EP D    +I+++V++KM+FT
Sbjct: 114 NELKKYRPAKANDLQVLDYLAK-------------HERTEPTDK---EIEQSVQKKMDFT 157

Query: 182 FQYP 185
           F +P
Sbjct: 158 FAFP 161

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 49/70 (70%), Gaps = 15/70 (21%)

Query: 256 WLDNVIYTN------RF-VSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQ 308
           W+DNV Y++      +F + GD  ++         +FSN+FNF++QFDEQVS+FC+KMN+
Sbjct: 217 WMDNVFYSDDAQKLPQFAIKGDSTADP--------LFSNEFNFDDQFDEQVSQFCTKMNK 268

Query: 309 VCGTRQCPIP 318
            CGTR+CPIP
Sbjct: 269 ACGTRECPIP 278

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  128 bits (321), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 59/63 (93%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           +VPS++G LLRCSEIWDRI+ HPKYSD+D+DGLCSELM KAKCSERGVV+NAEDVQLAL 
Sbjct: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583

Query: 647 KHM 649
           KHM
Sbjct: 584 KHM 586

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 85/149 (57%), Gaps = 3/149 (2%)

Query: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRR-TGTRDGED-SEQPXXXXXXXXX 58
           MS +TAKR L++  P S  +F  SK +  E+E       G+R  ++ S            
Sbjct: 1   MSTTTAKRPLEL-DPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMT 59

Query: 59  XQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLI 118
            + LD E K KRTAQNRAAQRAF              V +L  IQ+QNE+E+ FLR QLI
Sbjct: 60  KKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQLI 119

Query: 119 TLVNELKKYRPETRNDSKVLEYLARRDPN 147
           TLVNELKKYR    N+SKVLEYL++ + N
Sbjct: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGN 148

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  128 bits (322), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 51/63 (80%), Positives = 59/63 (93%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           +VPS++G LLRCSEIWDRIT HPKYS++D+DGLCSELM KAKCSERGVV+NAEDVQ+AL 
Sbjct: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALT 633

Query: 647 KHM 649
           KHM
Sbjct: 634 KHM 636

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 55/82 (67%)

Query: 60  QDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLIT 119
           Q LDPE + KRTAQNRAAQRAF              V +L  IQ+QNE+E+ FLR QLIT
Sbjct: 70  QLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFLRSQLIT 129

Query: 120 LVNELKKYRPETRNDSKVLEYL 141
           LVNELKKY+P   N SKVL Y+
Sbjct: 130 LVNELKKYKPNNENASKVLNYI 151

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 62/141 (43%), Gaps = 35/141 (24%)

Query: 281 DSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIP-----------------KKPIS 323
           DSN+ SN F+F ++FDEQVS+FC KM+  CGTR  PIP                 K PIS
Sbjct: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPIS 363

Query: 324 ALDKEVFAXXXXXXXX-------------XPALTNTW---ESHSNITDNTPANVIATDAT 367
            L+    A                        LTNTW    +  N  D++P N++ T   
Sbjct: 364 PLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIPSASPNSNDSSPNNIVPTQDN 423

Query: 368 KYENSFSGFGRLGFDMSANHY 388
              N    FG+LGF M +  +
Sbjct: 424 SNVN--MNFGQLGFMMDSPQF 442

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  127 bits (319), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 97/192 (50%), Gaps = 37/192 (19%)

Query: 462 DIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLE----X 517
           ++PFI+ +LAFP++     + QP                       +N+F EF+E     
Sbjct: 420 ELPFIDTSLAFPEEQDLFREQQP-----------------------DNMFAEFIEHDPQR 456

Query: 518 XXXXXXXXNMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQXXXXXXX 577
                   N S D+   + + ++ EEP +             E+      +++       
Sbjct: 457 DTTNGNEGNTSPDQDEFLASGMVQEEPAV----------TTGEVKDNTNDNVKDGKIQDE 506

Query: 578 XXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVIN 637
                    VVPS +G LL+CSE+WDRIT+HPKYSD+D+DGLC ELMAKAKCSERGVV+ 
Sbjct: 507 GKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQ 566

Query: 638 AEDVQLALNKHM 649
           AEDVQ ALN  +
Sbjct: 567 AEDVQYALNNRV 578

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 102/185 (55%), Gaps = 24/185 (12%)

Query: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPXXXXXXXXXXQ 60
           MS ++AKR L+       AE E   S      +E R+ G + G                +
Sbjct: 1   MSTTSAKRPLEPTVSLDFAEDEADDS---PTSDEPRKKGGKPGR---------------K 42

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
            LD E K KRTAQNRAAQRAF              V +LE + QQ+ VE  FLR QL+TL
Sbjct: 43  PLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTL 102

Query: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180
           V ELK+YRPE  NDS+VL+YLA+       SK++ +  N +  D+ + +I+E+V++KM+F
Sbjct: 103 VTELKRYRPENPNDSQVLQYLAK----TENSKSDDSSQNKK--DSESKEIEESVRRKMSF 156

Query: 181 TFQYP 185
           TF +P
Sbjct: 157 TFAFP 161

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 61/116 (52%), Gaps = 21/116 (18%)

Query: 251 STSMDWLDNVIYTNR-------FVSGDDGSNSKT--------KNLDSNMFSNDFNFENQF 295
           STS  W+DNV Y +        + S ++  NS+          + DS  FSN FNF ++F
Sbjct: 261 STSTGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKF 320

Query: 296 DEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFAXXXXXXXXXPALTNTWESHS 351
           DEQVSEFC+K+ QVCGT+ CPIP+K  S+                   +NTW++ S
Sbjct: 321 DEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI------VFSNTWDTPS 370

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  120 bits (300), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 100/327 (30%), Positives = 136/327 (41%), Gaps = 96/327 (29%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           LD E K KRTAQNRAAQRAF              V+ LE +++Q+E+E+ FLR QL  L+
Sbjct: 30  LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMESEFLRSQLQMLI 89

Query: 122 NELKKYRPETRNDSKVLEYLAR---------------------------RDPN------- 147
            E++KYRP+  +DS+VL+YLA                            RD +       
Sbjct: 90  AEIQKYRPQQSSDSQVLKYLAEAEERCKAAPVEKRTGRNAARSSISTSNRDDSENASRSR 149

Query: 148 -----------LHFSKNNVNHSNSEPIDTPN-DDIQENVKQKMNFTFQYPLXXXXXXXXS 195
                      L  S+      NS P D      I  NV++KMNFTF+YP          
Sbjct: 150 SRSTSLSEHNTLDTSRPQRYSENSSPADQDEAAKINANVQRKMNFTFEYP---------- 199

Query: 196 KNVGKQLPSPNDPSHSAPMPINQTQKKLXXXXXXXXXXXXXXXXXXXXXXXTPNSSTSMD 255
               K +P           P N                                SS S+D
Sbjct: 200 ----KDMP-----------PANGAFPSPSGSTSTTSNHSFSHRPFSQLSNTPRTSSGSLD 244

Query: 256 WLDNVIYTNRFVSGDDGSNSKT--KNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTR 313
           +L           GD  SN+++  K   S   + DF+F   FDEQVS FC++MN+VCGTR
Sbjct: 245 FL-----------GDSASNTQSLPKFPTSESGNGDFDFNTHFDEQVSVFCTQMNEVCGTR 293

Query: 314 QCPIPK------------KPISALDKE 328
           +CP+P+            +PIS + +E
Sbjct: 294 ECPLPQALPPSTAASVTPRPISPIQEE 320

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           VVP+++G LL+CSEIWDRIT HPKYSDID+DGLC EL  KAKCSE+GVV+N++DVQ AL 
Sbjct: 506 VVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALA 565

Query: 647 KHMN 650
           KHM+
Sbjct: 566 KHMS 569

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 58/64 (90%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           VVP+++G+LL+CSE+WDRIT+HPKYSDID+DGLC EL  KAKCSE+GVV+N +DVQ AL 
Sbjct: 521 VVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALT 580

Query: 647 KHMN 650
           KHM+
Sbjct: 581 KHMS 584

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 15/112 (13%)

Query: 32  ENEHRRTGTRDGEDSEQPXXXXXXXXXXQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXX 91
           E  H+R G++ G                + LD E K KRTAQNRAAQRAF          
Sbjct: 15  EELHKRKGSKPGR---------------KPLDTEAKNKRTAQNRAAQRAFRERKERKMRE 59

Query: 92  XXXXVQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLAR 143
               V+ LE +++Q+E+E+ FLR QL  L+ E++KYRP   +DS+VL +LA+
Sbjct: 60  LEEQVERLERVREQSELESEFLRSQLQKLLAEIQKYRPRQSSDSQVLNFLAK 111

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 73/168 (43%), Gaps = 41/168 (24%)

Query: 158 SNSEPIDTPND--DIQENVKQKMNFTFQY---PLXXXXXXXXSKNVGKQLPSPNDPSHSA 212
           SNS P D P++   I  NV++KMNFTF Y   P         S   G           SA
Sbjct: 175 SNSSPAD-PDEAAKINANVQRKMNFTFAYAKDPTTSTGNANHSSTSG-----------SA 222

Query: 213 PMPINQTQKKLXXXXXXXXXXXXXXXXXXXXXXXTP-NSSTSMDWLDNVIYTNRFVSGDD 271
             P                               TP  SS S+D+L           G +
Sbjct: 223 AFPSPSGSVS----------TSSSHNRPFSLSSNTPRTSSGSLDFL-----------GYN 261

Query: 272 GSNSKT--KNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPI 317
            +N+++  K + S     +F+F + FDEQVSEFC++MN+VCGTR+CP+
Sbjct: 262 SNNNQSLPKFVPSEPAKTEFDFNSHFDEQVSEFCTRMNEVCGTRECPV 309

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  112 bits (279), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 71/111 (63%), Gaps = 11/111 (9%)

Query: 539 LINEEPELPKQYLQSVPGNESEISQKNGSSLQXXXXXXXXXXXXXXXXVVPSKEGSLLRC 598
           LINEEP +P  +  +     S +S+ +  S Q                ++PS +G LL+C
Sbjct: 483 LINEEPSMPLCHDPAANAGAS-VSETDKLSNQEEIVQD----------IIPSNDGKLLKC 531

Query: 599 SEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 649
           SE+WDRIT HP+YSD+D+DGLC EL  KAKCSE+GVV+NAEDVQ AL  HM
Sbjct: 532 SEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (64%), Gaps = 2/85 (2%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           L+ E K KRTAQNRAAQRAF              V  LES+ +Q+E+E  FLR+Q+  L+
Sbjct: 49  LETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLL 108

Query: 122 NELKKYRPE--TRNDSKVLEYLARR 144
           +ELK+Y PE   + DS +L+YLA++
Sbjct: 109 SELKRYNPELPKKRDSILLDYLAKQ 133

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%), Gaps = 1/40 (2%)

Query: 285 FSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKK-PIS 323
            +++F+F++QFDE VS FCSK++  CGT+  PIPK  P+S
Sbjct: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVS 286

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/59 (67%), Positives = 52/59 (88%)

Query: 591 KEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 649
           K  + ++CSE+WDRIT+HPKYSD+D+DGLC+ELM KAKCSE+GVV+ A+DVQ AL KH+
Sbjct: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (82%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           VVPS +  L+RCSEIWDRITT+P+Y+D+D+DGLC ELM  AKCS++GVV+ ++DV   L 
Sbjct: 412 VVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLA 471

Query: 647 KHM 649
           KHM
Sbjct: 472 KHM 474

 Score = 92.0 bits (227), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/82 (54%), Positives = 57/82 (69%)

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITL 120
           D+D E + +RTAQNRAAQRAF              V SLE+I Q+NEVE  FLR Q++TL
Sbjct: 38  DIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTL 97

Query: 121 VNELKKYRPETRNDSKVLEYLA 142
           VNELKKYR ET +DSK+L+ ++
Sbjct: 98  VNELKKYRSETTSDSKILKLVS 119

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (71%)

Query: 281 DSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPK 319
           DS +FSNDFNF NQFDEQVS FC+KMN     R+  I K
Sbjct: 183 DSGLFSNDFNFNNQFDEQVSTFCAKMNNNFENRKKIIKK 221

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  100 bits (250), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646
           +VP  +G LL C EIWDRITT+P+YSDID+DGLC ELMA AKCS++GV+++++DVQ  L+
Sbjct: 443 IVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLS 502

Query: 647 KHM 649
           + +
Sbjct: 503 RRL 505

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 67  KQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLVNELKK 126
           + KR AQNRAAQ+AF              V+ LE+I ++NE+E  FLR QL++LVNELKK
Sbjct: 19  RMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKK 78

Query: 127 YRPETRNDSKV 137
           YR +  +D ++
Sbjct: 79  YRIDKNDDFRL 89

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 29/39 (74%)

Query: 281 DSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPK 319
           DSN+FS +F+F N+FDEQVS FC+KMN+    R+  I +
Sbjct: 260 DSNLFSTEFDFANEFDEQVSTFCAKMNKTFENRKEMIKQ 298

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 99.0 bits (245), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 97/185 (52%), Gaps = 41/185 (22%)

Query: 465 FINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEXXXXXXXX 524
           FI ++LAFP+           S +   N  + +++FRDS     N+              
Sbjct: 415 FIESSLAFPE-----------STASVANSMNGNLYFRDS-----NIDNTIDMLDLLADDD 458

Query: 525 XNMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQXXXXXXXXXXXXXX 584
            +  + + SLIKN L+ EE     Q        +S++  K  ++                
Sbjct: 459 DDEDEVDESLIKNNLVTEECMDDAQA-------KSQLCDKYKNT---------------- 495

Query: 585 XXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLA 644
             V+ +++GS L+CS++W R+T HPKYS++D+DGLC+ELM +AKCSE+GVV+ + DVQ A
Sbjct: 496 --VIRAEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKA 553

Query: 645 LNKHM 649
           L+K++
Sbjct: 554 LSKYL 558

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 71/149 (47%), Gaps = 26/149 (17%)

Query: 63  DPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLVN 122
           D + K KRT QNR AQRAF              V +LE + +  E+E  FLR +L ++ +
Sbjct: 37  DSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMAD 96

Query: 123 ELKKYRPETRNDSKVLEYLARRDPNLHFSKN--------------------------NVN 156
           ELKKYRP   +D +VLEYLA+++    ++ N                          + N
Sbjct: 97  ELKKYRPAQSSDLEVLEYLAKKEQLAKYNHNANPIKEEEEVKEEEEDEEGEEGGDNIHAN 156

Query: 157 HSNSEPIDTPNDDIQENVKQKMNFTFQYP 185
            S  +       +I  N+++K +FTF+YP
Sbjct: 157 QSFEQESAKQKQEILSNIEKKKDFTFEYP 185

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 24/27 (88%)

Query: 281 DSNMFSNDFNFENQFDEQVSEFCSKMN 307
           DS++FSNDFNF+++F +QVS FC K+N
Sbjct: 292 DSSLFSNDFNFDDKFSDQVSSFCDKVN 318

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 46/59 (77%), Gaps = 1/59 (1%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLAL 645
           +VP+ +  +L C++IWDRIT  PKY+  D++ LC+ELM+KAKCS++GVV+++ DV   L
Sbjct: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 37/67 (55%)

Query: 60  QDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLIT 119
           +D + E K KRTAQNRAAQRAF              V  LE + + +E E +FLR QLI 
Sbjct: 26  KDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRSQLIL 85

Query: 120 LVNELKK 126
              EL+K
Sbjct: 86  FGTELRK 92

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 3/32 (9%)

Query: 283 NMFSND---FNFENQFDEQVSEFCSKMNQVCG 311
           N F+ D   FNF+NQFDEQ+S+FC K+N  CG
Sbjct: 347 NWFNTDIETFNFDNQFDEQISKFCLKLNSACG 378

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           LD E K +RTAQNRAAQRAF              V+ LE  + Q+E E   LR+Q+++L+
Sbjct: 50  LDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLL 109

Query: 122 NELKKYRP 129
            ELKKYRP
Sbjct: 110 RELKKYRP 117

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 597 RCSEIWDRITTH-PKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 649
           +CS IW R  T  PK+SD D+D LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 39/54 (72%)

Query: 96  VQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLARRDPNLH 149
           + SLE I+ +N +E +FLR  +  L+NE+ K+RP+   DSK+L+YL+ R+ ++H
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLSMRNTHMH 61

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%), Gaps = 9/61 (14%)

Query: 597 RCSEIWDRIT--------THPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNK 647
           +CS+IW+RI         + P++ D D+D LC+ELM KA+CS  G +VI   D++ +L K
Sbjct: 458 KCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQSLMK 517

Query: 648 H 648
           H
Sbjct: 518 H 518

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 284 MFSNDFNFENQFDEQVSEF 302
           MFSNDFNF NQFDE V+  
Sbjct: 263 MFSNDFNFNNQFDEHVTNL 281

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           +D E K KRTAQNRAAQRAF              +  L+ +  +   E  +L++ L  L+
Sbjct: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76

Query: 122 NELKKYRPETRNDSKVLEYL 141
            E+ KYRP    D  +L+ L
Sbjct: 77  TEVTKYRPANEKDQGILKRL 96

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 590 SKEGS-LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG----------VVINA 638
           S EG  +LRC +I   +     Y  +D + LC+ELM KAK S+ G          VVI A
Sbjct: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473

Query: 639 EDVQLALNKHM 649
            D+Q  L KH+
Sbjct: 474 GDLQRTLAKHI 484

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 36/67 (53%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           LD E K +RTAQNRAAQRAF              V+ LE  +   E E   LR  +I LV
Sbjct: 34  LDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALV 93

Query: 122 NELKKYR 128
            EL+++R
Sbjct: 94  RELRRWR 100

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 39/85 (45%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           LD E K KRT QNR AQRA+              + +LE +   NE  A  +   L  L+
Sbjct: 23  LDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRAELMAAHLRDLL 82

Query: 122 NELKKYRPETRNDSKVLEYLARRDP 146
            E  K+R E   D  V E L  RDP
Sbjct: 83  GEANKFRGEKPRDKTVRELLTARDP 107

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAK--CSERGVVINAEDVQLA 644
           +   + GS   C+ +   +T  P Y + D++ LC ELM K K    +  + +  EDV+ A
Sbjct: 318 IAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSA 377

Query: 645 LNKHM 649
           L +H+
Sbjct: 378 LERHI 382

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 598 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 649
           C  I + I++ PKYS +D+D LCSEL+ KAKC++   +V+ A D+Q AL + +
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           +D E K +RTAQNRAAQRAF              V+ LE    QN+    FL   L +L+
Sbjct: 41  IDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTTDFLLCSLKSLL 100

Query: 122 NELKKYRPETRNDSKVLEYL 141
           +E+ KYR +  +D ++L +L
Sbjct: 101 SEITKYRAKNSDDERILAFL 120

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSL--ESIQQQNEVEATFLRDQLIT 119
           LD + K KRT QNR AQRAF              V  L  E++ +   +E  FL+  ++T
Sbjct: 17  LDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEIIE--FLKQNVMT 74

Query: 120 LVNELKKYRPETRNDSKVLEYLAR 143
           L+ E+K YR +T  D K+L+ + +
Sbjct: 75  LLGEIKNYRKQTNKDKKLLDTIGK 98

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 45/80 (56%)

Query: 62  LDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLV 121
           +D E K +RTAQNRAAQRAF              ++ LE    QN+    FL+  L +L+
Sbjct: 25  VDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLL 84

Query: 122 NELKKYRPETRNDSKVLEYL 141
           +E+ KYR +  ND ++L +L
Sbjct: 85  SEVTKYRAKNVNDERILAFL 104

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 598 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 649
           C  I   I++ PKYS +D+D LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 598 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCS-ERGVVINAEDVQLALNKHM 649
           CS I   I++ PK+S +D+D LC ELM KAKCS +  +++ A  +Q  L + +
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%)

Query: 65  ETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLVNE 123
           E K +RTAQNRAAQ+AF               + LES   Q++V   +L+  L +L+ E
Sbjct: 11  EAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLE 69

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 595 LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAE 639
           LL   +IW  +  HPK +  D++ L +EL   A CS   ++I+ +
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLK 284

>Skud_16.294 Chr16 complement(541842..545453) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%)

Query: 106 NEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLA 142
           N+V+ +FL D+L  L+   KK  P+ +N ++VL+YL 
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLG 331

>Smik_16.249 Chr16 complement(453693..457304) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%)

Query: 106 NEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLA 142
           N+V+ +FL D+L  L+   KK  P+ +N ++VL+YL 
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLG 331

>YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}
           RPA135RNA polymerase I second largest subunit A135
          Length = 1203

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 106 NEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLA 142
           N+V+ +FL D+L  L+   KK  P  +N ++VL+YL 
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLG 331

>KNAG0K01140 Chr11 complement(222139..224928) [2790 bp, 929 aa] {ON}
           Anc_3.163 YOL063C
          Length = 929

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 268 SGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISA 324
           + DD     +KN DS    ND+  E ++++Q + +   + Q+     CP+P   I+A
Sbjct: 599 ANDDRIMLSSKNEDSEFLGNDYRIEGEWEDQKAAY--DLQQIHRLTYCPVPHGRIAA 653

>CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 11/85 (12%)

Query: 69  KRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLVNELKKYR 128
           K+ AQNRAAQRAF              V+           E+   RDQL+  + +L+K+ 
Sbjct: 169 KKKAQNRAAQRAFRERKEAKFKELQRKVR-----------ESEIDRDQLLKELEKLRKWN 217

Query: 129 PETRNDSKVLEYLARRDPNLHFSKN 153
            E   +++ L    R   N  +S N
Sbjct: 218 MEINAENRKLLQKERLGNNGVYSGN 242

>Kwal_26.8932 s26 (1011029..1012243) [1215 bp, 404 aa] {ON} YOR264W
           (DSE3) - Daughter Specific Expression 3 [contig 68] FULL
          Length = 404

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 465 FINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSK-EGNNLFGEFLEXXXXXXX 523
           +I + LA P   + +  L  F  +  QN+ D++  F   +K EG  LF E L+       
Sbjct: 144 YIPSPLASPPLQNRHASLMAFPVTAVQNEVDFNSHFHQHNKSEGELLFEEILKAYSNA-- 201

Query: 524 XXNMSDDESSLIKNQLIN 541
              + D+E SL+  QL N
Sbjct: 202 ---LEDEEPSLVNTQLNN 216

>Suva_9.231 Chr9 (372034..372771) [738 bp, 245 aa] {ON} YIR018W
           (REAL)
          Length = 245

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 63  DPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEVEATFLRDQLITLVN 122
           D E  QK+  QNR AQRA+              ++SL  I +  E + T L+D       
Sbjct: 58  DDEELQKKKRQNRDAQRAYRERKNNKLQVLEDTIESLTKIIKNYESKLTRLQD------- 110

Query: 123 ELKKYRPETRNDSKVLEYLARRDPNL 148
           EL++   E R     L+ LA R P++
Sbjct: 111 ELQERNSENRALQLKLDALAPRQPSV 136

>NCAS0A08020 Chr1 (1585065..1585781) [717 bp, 238 aa] {ON} 
          Length = 238

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 64  PETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQSLESIQQQNEV-EATFLRDQLITLVN 122
           P +  KR AQNR AQ+AF              +  L+SI+    V E T LR+Q+  L N
Sbjct: 177 PISTAKRAAQNRNAQKAF-----RQRKERYIKILELKSIKYDELVRENTCLREQMDALRN 231

Query: 123 ELKKYR 128
           +L+  R
Sbjct: 232 QLQNIR 237

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,165,708
Number of extensions: 2684755
Number of successful extensions: 9221
Number of sequences better than 10.0: 74
Number of HSP's gapped: 9519
Number of HSP's successfully gapped: 114
Length of query: 650
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 534
Effective length of database: 40,180,143
Effective search space: 21456196362
Effective search space used: 21456196362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)