Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML002W6.20ON73773739310.0
Skud_13.1526.20ON109073733200.0
Smik_13.1576.20ON109073731950.0
Suva_13.1606.20ON109073731670.0
TDEL0G044906.20ON109372614970.0
ZYRO0C07810g6.20ON109972714170.0
Sklu_YGOB_Anc_6.20b6.20ON108873313981e-179
CAGL0L07634g6.20ON113072212441e-156
Kpol_1037.256.20ON110572811601e-144
NCAS0H008206.20ON114673711581e-143
Kwal_56.224246.20ON108972411191e-138
Sklu_YGOB_Anc_6.20singletonOFF84949610821e-135
Ecym_30246.20ON107969810841e-133
ACR006C6.20ON107169510791e-132
KLTH0C11242g6.20ON109774610461e-127
TPHA0J003306.20ON110772310221e-124
KNAG0M011606.20ON113175510191e-123
NDAI0D008006.20ON11937839611e-114
KLLA0D01133g6.20ON10677209511e-114
TBLA0A072606.20ON12047918901e-104
KAFR0L004006.20ON9427417985e-93
KNAG0F008602.15ON62677771.4
TDEL0A067806.265ON20066732.0
Smik_4.4668.430ON46554708.4
ZYRO0F11000g8.616ON565122708.6
TBLA0C007301.424ON26594699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML002W
         (737 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...  1518   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...  1283   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...  1235   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...  1224   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   581   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   550   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   543   e-179
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   483   e-156
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   451   e-144
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   450   e-143
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   435   e-138
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   421   e-135
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   422   e-133
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   420   e-132
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   407   e-127
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   398   e-124
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   397   e-123
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   374   e-114
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   370   e-114
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   347   e-104
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   311   5e-93
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    34   1.4  
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    33   2.0  
Smik_4.466 Chr4 complement(849363..850760) [1398 bp, 465 aa] {ON...    32   8.4  
ZYRO0F11000g Chr6 complement(897427..899124) [1698 bp, 565 aa] {...    32   8.6  
TBLA0C00730 Chr3 complement(151239..152036) [798 bp, 265 aa] {ON...    31   9.2  

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
           protein of unknown function; expression induced by heat
           and by calcium shortage
          Length = 737

 Score = 1518 bits (3931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/737 (100%), Positives = 737/737 (100%)

Query: 1   MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60
           MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL
Sbjct: 1   MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60

Query: 61  GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120
           GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL
Sbjct: 61  GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120

Query: 121 TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180
           TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL
Sbjct: 121 TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180

Query: 181 EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240
           EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG
Sbjct: 181 EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240

Query: 241 QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300
           QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP
Sbjct: 241 QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300

Query: 301 ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360
           ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK
Sbjct: 301 ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360

Query: 361 DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420
           DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL
Sbjct: 361 DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420

Query: 421 LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480
           LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE
Sbjct: 421 LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480

Query: 481 NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540
           NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN
Sbjct: 481 NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540

Query: 541 ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600
           ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN
Sbjct: 541 ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600

Query: 601 VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660
           VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA
Sbjct: 601 VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660

Query: 661 PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720
           PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR
Sbjct: 661 PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720

Query: 721 SLVAFATTNISVLQECV 737
           SLVAFATTNISVLQECV
Sbjct: 721 SLVAFATTNISVLQECV 737

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1283 bits (3320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/737 (82%), Positives = 678/737 (91%)

Query: 1    MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60
            + SHQ ELP+GLN++TMDADTL+SLFVLVVCRSEQKHLKSHLYYLQNFSNN SSTKFGIL
Sbjct: 354  ISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGIL 413

Query: 61   GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120
            GYA+STLEAVVCYFEDF+KN  N+AKAN   +KT+ LLDKLS ENPTNE+E+LATY+D L
Sbjct: 414  GYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNL 473

Query: 121  TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180
             YRNEQGQSILSICITN KN ILLD+L+EYE+ FP+ED+LEDET+DGSTLLIESIK GN+
Sbjct: 474  QYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNI 533

Query: 181  EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240
            EAAK+LI IML NC+E ELVSY+NK DKYARTVAHYLTHEMDILKSIG+Y+DWKRKNSSG
Sbjct: 534  EAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSG 593

Query: 241  QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300
            QTPLFSIFR+YDQPNYEEMVK AF+IAN+WY+KHNS FDYLDHTD+KGNSLLH+LK+++ 
Sbjct: 594  QTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVS 653

Query: 301  ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360
            ILLQL+KLDIN  NYKGLTPLM+YVKYKR+SNIDAITKD RLILEKVQNSTFFTCFDYAK
Sbjct: 654  ILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAK 713

Query: 361  DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420
            DHSVLSKIGERG +DSLFGL+Y HSLRYHNLNATTNIT+ SN +KPF TTVINMKTIQGL
Sbjct: 714  DHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTIQGL 773

Query: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480
            LRSILKDN FTFLPLN+YIDEISHLNRSDLTIIGK DV SLLH+LTNCFNVLLFLKK+P+
Sbjct: 774  LRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833

Query: 481  NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540
            NLFTDEAS+LYWMRINTSKRNQKP  K+NPKTMEPEEINMIQSFLRFNFDEISSFKASLN
Sbjct: 834  NLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLN 893

Query: 541  ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600
            ILRK+LIF++LKS+DFED Y  L EMGRK+IN EA+ AF  I TNHNMFS+L+LA LLE+
Sbjct: 894  ILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEH 953

Query: 601  VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660
            V FLEQCTIQLS+FVQ ILF+KI  WWKHYGEFLAL K+YRKAFP++VKPKSA+DT S  
Sbjct: 954  VSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHI 1013

Query: 661  PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720
            PLG FIETKREQSEQRLAVQIKASSK+LKELGSEIF AHE+LAEELSNYMEFRKACLDQR
Sbjct: 1014 PLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQR 1073

Query: 721  SLVAFATTNISVLQECV 737
            ++VAFATTNI + QE +
Sbjct: 1074 TIVAFATTNIGIFQEYI 1090

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/737 (81%), Positives = 670/737 (90%)

Query: 1    MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60
            M SHQL++P  LNN+ MDADTLISLFVLV+CRSEQKHLKSHLYYLQNFSNNSSS+KFGIL
Sbjct: 354  MGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGIL 413

Query: 61   GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120
            GYAVSTLEAVVCYFEDF KN+ N+AKAN L +KTK L++ LSCEN TN+VE+LATYKDIL
Sbjct: 414  GYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDIL 473

Query: 121  TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180
             YRN QGQSILSICI+N+KN+ILLDILSEY++ FP+EDLLEDETIDGSTLLIESIK+GNL
Sbjct: 474  PYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNL 533

Query: 181  EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240
            EAAK+LI+IM+ NCTEEEL+SYIN+TDKY+RTVAHYLTHE+DILKSIGNY+DWKRKNS G
Sbjct: 534  EAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGG 593

Query: 241  QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300
            QTPLFSIFRSYDQPNYE MVK AF+IANTWYRK N  FDY DHTDNKGN LLHVLKT+  
Sbjct: 594  QTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDAS 653

Query: 301  ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360
            ILLQLTKLDIN ENYKGLTPLMVYVKYKRL+NI+AI KD+RL+LEK+Q STFFTCFDYAK
Sbjct: 654  ILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAK 713

Query: 361  DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420
            DH+VLSK+GERG KDSLFGLIYFHSLRYHNLNA  NIT  S+ EKPF+ TVINMKTIQGL
Sbjct: 714  DHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGL 773

Query: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480
            LRSILKDNPFTFLPLN YIDEIS L+RSD+TIIGK DV SLLH+L+NCFNVLLFLKK+P+
Sbjct: 774  LRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPK 833

Query: 481  NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540
            +LFTDEASILYWMRINTSKRNQK   KEN KTMEPEEINMIQSFLRFNFDEISSFKASL+
Sbjct: 834  SLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLS 893

Query: 541  ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600
            ILRK+LIFI+LKS+DF+D    LNEMG+ + N++A+ AF G +TNHNMF++ SLA LLE+
Sbjct: 894  ILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEH 953

Query: 601  VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660
            VRFLE+CTIQLS+ VQ+IL EKIPNWWKHYGE + LHK+YRKAFP++VKPKS +DTS   
Sbjct: 954  VRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHI 1013

Query: 661  PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720
             LGGFIETKREQSEQRLAVQIK SSK LKELGSEIFVAHE+LAEELSNYMEFRKACL+QR
Sbjct: 1014 QLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQR 1073

Query: 721  SLVAFATTNISVLQECV 737
            ++VAFA TNISVLQE +
Sbjct: 1074 NIVAFAATNISVLQENI 1090

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1224 bits (3167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/737 (81%), Positives = 671/737 (91%)

Query: 1    MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60
            M SH+ +L +G NN+TMDADTLISLFVLVVCRSEQKH++SHLYYLQNFSNNSSS+KFGIL
Sbjct: 354  MGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGIL 413

Query: 61   GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120
            GYA+STLEAVVCYFE+FNKN  NVAKAN LC KT++LLDKLSCENPTNEV DLATYKDIL
Sbjct: 414  GYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDIL 473

Query: 121  TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180
             YRNEQGQSILS+CITN+KN ILLD+LSEYE  FP+ED+LEDETIDGSTLLIESIK GNL
Sbjct: 474  AYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNL 533

Query: 181  EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240
            EA K+LI+IMLFNCT+EELV+Y+NKTDKYAR+VAHYLTHEMDILKSIG+YI+WK+KNSSG
Sbjct: 534  EATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSG 593

Query: 241  QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300
            QTPLFSIFRSYDQPNYEEMVK AF+IA++WY++HN+ F Y DHTDNKGNSLLHVLKT++ 
Sbjct: 594  QTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVS 653

Query: 301  ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360
            ILLQLTKL+IN ENYKGLTPLMVYVKYKRLSNIDAITKD RLILEKVQNSTFFTCFDYAK
Sbjct: 654  ILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAK 713

Query: 361  DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420
            D  VLSKIGERG  DS+FGLIY HSLRYHNLNAT N+TSVS  E+PF T VINMKTIQGL
Sbjct: 714  DRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGL 773

Query: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480
            LRSI+KDNPFTFLP++ YID ISHLNRSDLTIIGK DV SLLH+LTNCFNVLLFLKK+P+
Sbjct: 774  LRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833

Query: 481  NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540
            NLFTDEAS+LYWMRINTS+RNQKP  K+NPKTMEPEEINMIQSFLRFNFDEI SFKASLN
Sbjct: 834  NLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLN 893

Query: 541  ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600
            ILRK+LIF++LKS DFEDAY  L +MG K+ N +A+ AF  II NH MFS+LSL  LLE+
Sbjct: 894  ILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEH 953

Query: 601  VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660
            V+FLE+CTIQL + +Q ILF++IPNWWKHYGEFL LHK+YRKAFP+ VKPKS + TSS  
Sbjct: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHI 1013

Query: 661  PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720
            PLGGFIETKREQSEQRL+VQIKASSK+LKELGSEIF AHE LAEELSNYMEFRKACLDQR
Sbjct: 1014 PLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQR 1073

Query: 721  SLVAFATTNISVLQECV 737
            ++VAFA  NISVLQEC+
Sbjct: 1074 TIVAFAIKNISVLQECI 1090

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/726 (40%), Positives = 471/726 (64%), Gaps = 19/726 (2%)

Query: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74
            + + ADTL+SLFVLV+CR++ ++LK  L+YLQNF+ N +S  FG+LGYA+STLEA VCYF
Sbjct: 363  VAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYF 422

Query: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSIC 134
            ++  K +  +++  + CE  ++L+DKLS E+ +    +L  Y+  L+YR EQG+S+LSIC
Sbjct: 423  DEL-KGSKKMSRLESECENARSLVDKLSSESSS---VNLIHYQKTLSYRTEQGESLLSIC 478

Query: 135  ITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC 194
            I N KN IL ++LS+ E  FP+ED+LED+T +G TLL++S+K GN +AA +++ ++  +C
Sbjct: 479  IANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSC 537

Query: 195  TEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQP 254
            T+EE+ +Y N++DK  RT AHYLTHE++IL+ IGN+ DW  K+SSG T LF+IFRSYDQP
Sbjct: 538  TQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQP 597

Query: 255  NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEEN 314
            NY++M++ +F  A  WY      F +  H D K N+LLH+LK +I ILL+   +D+N  N
Sbjct: 598  NYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESVDVNARN 657

Query: 315  YKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVK 374
             KGLTPLMVY KY RL N  +I  D+R+IL K+Q+       DYAK+  +L +I ++   
Sbjct: 658  RKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAM 717

Query: 375  DSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLP 434
            D+ FG  + H+L+Y + +   NIT  ++ +  F T   ++KT+Q   R++L+  P TFLP
Sbjct: 718  DTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLP 777

Query: 435  LNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMR 494
            L++ +++++ L ++ L+ IGK +    L  LTNCFNVL+  +++P+++  +E+ +L W++
Sbjct: 778  LDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIK 837

Query: 495  INTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSD 554
            +   K  +  +     K +EPEE+++IQ FLRFN  E+S+ ++ L++++K+ IF+ LKS 
Sbjct: 838  VQY-KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSS 896

Query: 555  DFEDAYKGLNEMGRKLINSEASSAFKGIITNH-----NMFSELSLAALLENVRFLEQCTI 609
            D E + + L  +G     SE        +T+H      ++   S+  L+E++  + +CTI
Sbjct: 897  DVEQSVELLLPLG-----SEGMGDLYP-LTDHKFSCTTVYGNDSMILLVEDIDLMLKCTI 950

Query: 610  QLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETK 669
            +L   +  +L  KIP WWK YGE L   K Y + FP++V  K+   ++    +G  +E K
Sbjct: 951  RLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLV--KNGETSTDAGIIGKILEGK 1008

Query: 670  REQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTN 729
            +E+ E+RL+  I  + + + + G+ I   HE LAE+LS +MEF+ A + +  +  +   N
Sbjct: 1009 KEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVREN 1068

Query: 730  ISVLQE 735
            I  L+E
Sbjct: 1069 IKELKE 1074

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/727 (41%), Positives = 456/727 (62%), Gaps = 20/727 (2%)

Query: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74
            +TMDADTLIS FVLVVCR++ K++KSHL+YL+ FS + +S KFGILGYA+STLEAVV YF
Sbjct: 365  ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAVVFYF 424

Query: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSIC 134
            +   K T  + K      K K L   +S ++    V D++ ++  L +R  QG+S+LS C
Sbjct: 425  DGL-KGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVLSQC 483

Query: 135  ITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC 194
            I N KN +L ++L  YE+ FP+ED+L+DET+DGSTLLI+++K  N EAA+++++++  +C
Sbjct: 484  IINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQNSC 543

Query: 195  TEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQP 254
            TE+EL  Y+N+ DK  RTVAHYLTHEM+IL+SIG YI+WK ++S+G TPLF+IFR YDQ 
Sbjct: 544  TEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIFRCYDQQ 603

Query: 255  NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEEN 314
            NYE M+  AF  A  WY+ +   F + DH DNKGN+LLH++K N+ ILL    +DIN  N
Sbjct: 604  NYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDINCTN 663

Query: 315  YKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVK 374
             KGLTPLM+Y +Y R  N+  I +D+R+IL+K+Q+ +F   FDYA++  VL ++  + +K
Sbjct: 664  KKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKELVSQAIK 723

Query: 375  DSLFGLIYFHSLRYHNLNATTNITSV--SNAEKPFATTVINMKTIQGLLRSILKDNPFTF 432
             + F L + H L+Y   +   +IT    + A++ + T  +++KT+Q L + +LK +  +F
Sbjct: 724  TTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLKMHFASF 783

Query: 433  LPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYW 492
            LPL   ++++S+L +S +  I K +     + LT+CF+VLL    +   L   E+ ++ W
Sbjct: 784  LPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNL-NKLVLRESRLVSW 842

Query: 493  MR-----INTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLI 547
            +R      N SK+ QK       K +EPEEI ++ SFLRFN  E+S+ K  L  ++K+LI
Sbjct: 843  IRSQDKKCNNSKKLQK------QKNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKKLLI 896

Query: 548  FINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQC 607
            F+ LK+ D   +Y+ L+  G +   ++    FK +  N   F E +    +  + FLE C
Sbjct: 897  FLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFVREIAFLENC 956

Query: 608  TIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIE 667
            T +L   V+ +L   IP WWK YG+ L +HK Y++ FPN+ +  S +       +  F E
Sbjct: 957  TGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGT-----GIIASFFE 1011

Query: 668  TKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFAT 727
             KRE+ E +L+  +    K ++ +G  I   HE LAEELS YMEF+        L     
Sbjct: 1012 GKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVR 1071

Query: 728  TNISVLQ 734
             NI++L+
Sbjct: 1072 ENINILK 1078

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  543 bits (1398), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 293/733 (39%), Positives = 441/733 (60%), Gaps = 14/733 (1%)

Query: 7    ELPDG-LNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVS 65
            E PD  + ++T+DADTLI L VLVVCRS+ K+LKSHL+YLQNFS + ++ KFG++ YA+S
Sbjct: 352  EFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALS 411

Query: 66   TLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNE 125
            TLEAV+CYFED  +N+G +      C + K   D LSC+  +   + L +Y+DIL  R  
Sbjct: 412  TLEAVLCYFED-AENSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKSYRDILRIRTA 468

Query: 126  QGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKV 185
             G+S LS+CI       +  +L  +E++ P+ED+L+D+TI+GSTLL+++++ GN   A V
Sbjct: 469  GGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADV 528

Query: 186  LIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLF 245
            L++I+  +CT  EL  Y+N+ +++ RT AHYLT ++ +   IG + DW+ K+ SG TPLF
Sbjct: 529  LLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLF 588

Query: 246  SIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL 305
            +IFRSYD P+Y +MV  AF  A+ WY      F++  H D KGN+LLHV+KTNI ILL+ 
Sbjct: 589  AIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ 648

Query: 306  TKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVL 365
              +D+NE N KGLTPLMVYVKY RL N+  I +D RLI+EK Q S F  CFDY K+  + 
Sbjct: 649  ENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQ 708

Query: 366  SKIGERGVKDSLFGLIYFHSLRYHNLNATTNIT-SVSNAEKPFATTVINMKTIQGLLRSI 424
            +++G    + + FG +  H+ R+ N      IT    + E  F T   N++ IQGLL+  
Sbjct: 709  AELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVY 768

Query: 425  LKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFT 484
            L+ NP +FLP++  ++++  + ++ L  +GK +V   L +LT    ++   ++  + L+ 
Sbjct: 769  LRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYL 828

Query: 485  DEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK 544
              + ++ W+R +  KR          + +EPEEIN IQSFLRFN  E+S  +  ++IL+K
Sbjct: 829  PASDLVNWIRESGRKRTNV------SRRIEPEEINSIQSFLRFNLSELSLIRDKISILQK 882

Query: 545  VLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFL 604
            + IF  LK+ D   A   L     +L ++  S AF     +     +LS   L  N+ FL
Sbjct: 883  LSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFL 942

Query: 605  EQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGG 664
            ++CT +L   +  +L  K+  WWK Y E L     Y K FPN VKP    +   +   G 
Sbjct: 943  KECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDN---KGLFGT 999

Query: 665  FIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVA 724
            ++E KR + E++L+ QIK+  + L+ L  E+   HE LAEELS Y+EF+   L    +  
Sbjct: 1000 YVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQD 1059

Query: 725  FATTNISVLQECV 737
            F    I+ L++ +
Sbjct: 1060 FTVGKINTLKDTM 1072

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  483 bits (1244), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 280/722 (38%), Positives = 424/722 (58%), Gaps = 24/722 (3%)

Query: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74
            + +DAD L++LFVLV CR++ K+LK HL YLQNF NN S TKFGILGYA+STLEAVVCYF
Sbjct: 399  LAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYF 458

Query: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVED------LATYKDILTYRNEQGQ 128
            E   K   N  K    C   + L+  LS    T + E       L  Y+  L YR+  GQ
Sbjct: 459  EQL-KEKENYRKLIDFCNSNERLVKVLSS---TKKYETNAALYFLRKYEGSLRYRDSLGQ 514

Query: 129  SILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIK 188
            S+L++CI + +N  L  IL+EYE  FP+EDLL DE+IDGSTLLI+++K  N  +A +L+ 
Sbjct: 515  SLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLN 574

Query: 189  IMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIF 248
            I+  NCTE EL++YIN+ D   RT  H+LT+E+++LK +G YI+W +K+++GQTPLF+IF
Sbjct: 575  ILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIF 634

Query: 249  RSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKL 308
            RSYDQ NY+EMV  + + A  WY  +   F+YLDH D KGN+LLH+LK N+PILL    +
Sbjct: 635  RSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLLHILKCNLPILLADKHI 694

Query: 309  DINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKI 368
            ++N  N  G TPLM  ++YKR  NI  +  D RL ++  Q +   T FD++KD  +   +
Sbjct: 695  NVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLL 754

Query: 369  GERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDN 428
            GE  + +S +  +Y H+L+Y N     ++T V   + P  TT   +KT++G+LR ++K+N
Sbjct: 755  GEHELLNSPWLAVYAHTLKYTNSRWNLSLT-VKLKDAP-KTTNFTLKTLRGILRVVIKNN 812

Query: 429  PFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEAS 488
               FLP+   ++++   NR   + + +  V  +L  ++ C + L+ +K +  N+F  E +
Sbjct: 813  MTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSALVHIKVLDLNVFQTEEN 872

Query: 489  ILYWMRINTS---KRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKV 545
             + W+++N S   K NQ          + PE+I+MIQ+FL+FN  EI   K  L I  K+
Sbjct: 873  AIKWVKMNGSVDKKTNQTSD-------ITPEDISMIQNFLKFNITEIERTKNKLEIAEKL 925

Query: 546  LIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLE 605
             +F  LKS D  ++ +    +  +L +    S  K    +  + S  +  ALL  + +L+
Sbjct: 926  SLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLSVRAEKALLSKITYLK 985

Query: 606  QCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGF 665
             C  +L + +  I    I NWW  YGE L  HK Y +AFP +      ++    A     
Sbjct: 986  ICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA--NVTTENRDLALHRMI 1043

Query: 666  IETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAF 725
               KR + E+RL+ +IK  ++ L  +G +I   HE  AEE+S +++ +     + +L ++
Sbjct: 1044 SNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSY 1103

Query: 726  AT 727
             T
Sbjct: 1104 LT 1105

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  451 bits (1160), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/728 (35%), Positives = 420/728 (57%), Gaps = 18/728 (2%)

Query: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74
            + +DADTL++LF+LV+CRS+   L++HLYYLQNFS + ++ KFG+LGY +ST EA +CY 
Sbjct: 377  LMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYL 436

Query: 75   EDFNKNTGNVAKANTL-CEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSI 133
            +DF    G       L C + K L+ K+S E   +  + +  YKD   +RNE G+SIL++
Sbjct: 437  KDFQ--AGEKFNKQVLNCIRNKELISKISSEADHSTFQ-VKLYKDCFKFRNEMGESILAL 493

Query: 134  CITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFN 193
            CI + KN  L +IL  +E+ FP+ED+L+DE I+G+TLL++++K  N   AK+++ ++  +
Sbjct: 494  CIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKALKVENEVGAKLIVDVLQSS 553

Query: 194  CTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQ 253
            C+E+EL+ Y N+TD   R  AHY+T+++D+LK IG + +WK K+  G TPL +I R+YDQ
Sbjct: 554  CSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQ 613

Query: 254  PNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEE 313
              YE+M++TAF  A  WY   N   ++ DH D+K N+LLH+LK +I +LL+   ++IN  
Sbjct: 614  ECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQVLLKYDNININAH 673

Query: 314  NYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGV 373
            N K +TPLM YVKY R+SNI  I +D RLIL K Q  TF  C+D+ K+  +   +G R V
Sbjct: 674  NLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSV 733

Query: 374  KDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFL 433
            ++S+F L   +SLR  N N     T     +  + T  +++K +  +++   K  P  F+
Sbjct: 734  RNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFI 793

Query: 434  PLNTYIDEISHLNRSDL-TIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYW 492
            P    +  ++ + +++    I K    + L+ ++N F  L+        LF +  S+  W
Sbjct: 794  PHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFDTELFKNPESLTKW 853

Query: 493  MRINTSKRNQKPSGKEN-PKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINL 551
            ++    KR  K   KEN  K M  ++INMI+SF++FN +E+     +L IL+K+  F+ L
Sbjct: 854  IK--AGKRKHK---KENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLAL 908

Query: 552  KSDDFEDAYKGLNEMGRKLINSEASSAFKGI--ITNHNMFSELSLAALLENVRFLEQCTI 609
            K +D  ++YK     G  L   + S+  K I  +     F  + L  LL+ + FLE CTI
Sbjct: 909  KINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFL-ILLDQISFLEICTI 967

Query: 610  QLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETK 669
             +S     ++   IP W   +     L K Y++ F +      + +  +   L  + + K
Sbjct: 968  HMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF----DSRNGLNENILSRYTKNK 1023

Query: 670  REQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTN 729
            RE +E+R++ +I  ++ +  ++ + I+ AHE LAEE + ++ F+        L     + 
Sbjct: 1024 REAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSA 1083

Query: 730  ISVLQECV 737
            I+ L++ V
Sbjct: 1084 IATLKDQV 1091

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  450 bits (1158), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 274/737 (37%), Positives = 444/737 (60%), Gaps = 43/737 (5%)

Query: 11   GLNNMTMDADTLISLFVLVVCRSEQK--HLKSHLYYLQNFSNNSSSTKFGILGYAVSTLE 68
            G NN+ +DADTLI+L +L++CRSE     LK +++YL+ F+ + +   FGIL Y +ST E
Sbjct: 377  GANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFE 435

Query: 69   AVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQ 128
             V+  FE       N+ + + L   ++ +++KL   +   +V     ++  LT+R++ G+
Sbjct: 436  IVIYSFE-------NIVEYDKLKSYSE-IIEKLIKVDDLKKVPKTIKWEQFLTFRSDTGE 487

Query: 129  SILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIK 188
            SIL  CITN++    LD+L +YE  F ++++L+D  ++G+TLL++++   N + + VLI 
Sbjct: 488  SILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKISMVLIN 547

Query: 189  IMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIF 248
            ++L NC+ ++++ YINK DK+ R V HYL +E++ILK IG Y++WK+++  G+TPLF+IF
Sbjct: 548  LLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGRTPLFTIF 607

Query: 249  RSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTK- 307
            R YDQPNY+E++ T FDI   WY ++   F   DH D K NS+LH+L++NI IL   +K 
Sbjct: 608  RGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDILFTYSKR 667

Query: 308  ----LDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHS 363
                +DIN+ NYKG TPLM+YVKY RLSN+  I  D RL+  + Q   + TCFDYA D +
Sbjct: 668  NHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCFDYATDST 727

Query: 364  VLSKIGERGVK-DSLFGLIYFHSLRYH-NLNATTNIT-SVSNAEKPFATTVINMKTIQGL 420
            + +++G+  ++ +++FG IY HSL+   + NAT ++T  + + E    T  I +K I  L
Sbjct: 728  ISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDKENETGTVNIKVKAIISL 787

Query: 421  LRSILKDNPFTFLPLNTYIDEISHLN--RSDLTIIGKTDV---TSLLHQLTNCFNVLLFL 475
            L+ I K +  + LPL+  I  +  L    ++  I+ K ++    SLL +LT+C + LLF 
Sbjct: 788  LKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSLLRRLTDCLDTLLFF 847

Query: 476  KKIPE--NLFTDEASILYWM-RINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEI 532
                +  +L TDE  +L W+   NT  ++         K+++PE+IN+IQSFL+FN  E+
Sbjct: 848  DIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFLKFNVKEL 907

Query: 533  SSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSA----FKGIITNHNM 588
             +   ++  L K+L FI+LKS D +++      + + + N + + A     + II   ++
Sbjct: 908  YNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSL 967

Query: 589  FSELSLAALLEN-VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFP-- 645
             ++     L+ + + FL+ CT+ L+  ++ IL  +IPNWWK YGE L L+K Y K FP  
Sbjct: 968  ENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPN 1027

Query: 646  ---------NMVKPKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIF 696
                     N    + ++D ++    GG IE +R ++ ++L   I      L+ LG+EIF
Sbjct: 1028 HYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIF 1087

Query: 697  VAHERLAEELSNYMEFR 713
              HE LAEEL+ YMEF+
Sbjct: 1088 RKHEMLAEELNKYMEFK 1104

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  435 bits (1119), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 254/724 (35%), Positives = 406/724 (56%), Gaps = 20/724 (2%)

Query: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74
            +T+DADTL+SLFV+VVC ++ K L+SHL+YLQ F+ +++   FGIL Y +STLEAV+CYF
Sbjct: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420

Query: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSIC 134
            E   K    VA     C    +    +S  +     +      D+L  R   GQS L++C
Sbjct: 421  ESPEK----VASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVC 476

Query: 135  ITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC 194
            + + +      I +  E  FP+EDLL DET DGS LLI  +++G    A +LI  ++ NC
Sbjct: 477  LQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNC 536

Query: 195  TEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQP 254
            T++EL++++N T+KY R+  HYL H   ++  +G+ ++W++++ +G TPLF+I R+YD+P
Sbjct: 537  TKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRP 596

Query: 255  NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEEN 314
            +Y +MV  A+  A    +  NS F   +HTD+KGN+LLHV+K+++ ILL    +D+N  N
Sbjct: 597  DYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATN 656

Query: 315  YKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVK 374
             KGLTPLMVYV+Y R+ N+  I +D+RLI+ K Q+  + +CFDY K+ +VL ++G+    
Sbjct: 657  AKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASY 716

Query: 375  DSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVI--NMKTIQGLLRSILKDNPFTF 432
                  I  HS++         IT V+  EK     V   +++ IQ  L      +P TF
Sbjct: 717  LPFEFSINVHSVKREGDEWVLWIT-VTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTF 775

Query: 433  LPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYW 492
            +P++  + E+  L++S + I+ K D    L +   C   L  + +  E LF D  +    
Sbjct: 776  VPVDELLRELRALSQSRILILNKMDTKRFLKR---CSVTLSMVSQ--ERLFADAFTDSNL 830

Query: 493  MRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLK 552
               ++       S  +N K MEPEE+  IQS L+FN  EIS+ K ++ +++K+ +F  LK
Sbjct: 831  NLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLK 890

Query: 553  SDDFEDAYKGLNEMGRKLINSEASSAFKGI-ITNHNMFSELSLAALLENVRFLEQCTIQL 611
              D  +A        + +   +  S    + +   N+F       +  N+   E C+  L
Sbjct: 891  GKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLF---DFEGIANNIALCELCSSLL 947

Query: 612  SSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKRE 671
               +  +L + IP WW  YGE L+L + Y+K+FP+  +P  + ++      G +IETKR 
Sbjct: 948  CKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENS---GLFGSYIETKRT 1004

Query: 672  QSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNIS 731
            + EQ  A +I  +S  L E+ ++I   +ERLA EL+N++ F+   L + ++   A TNI 
Sbjct: 1005 KLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL-KSAIKEHADTNIK 1063

Query: 732  VLQE 735
             L+E
Sbjct: 1064 RLRE 1067

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  421 bits (1082), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 211/496 (42%), Positives = 319/496 (64%), Gaps = 5/496 (1%)

Query: 7   ELPDG-LNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVS 65
           E PD  + ++T+DADTLI L VLVVCRS+ K+LKSHL+YLQNFS + ++ KFG++ YA+S
Sbjct: 352 EFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALS 411

Query: 66  TLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNE 125
           TLEAV+CYFED  +N+G +      C + K   D LSC+  +   + L +Y+DIL  R  
Sbjct: 412 TLEAVLCYFED-AENSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKSYRDILRIRTA 468

Query: 126 QGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKV 185
            G+S LS+CI       +  +L  +E++ P+ED+L+D+TI+GSTLL+++++ GN   A V
Sbjct: 469 GGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADV 528

Query: 186 LIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLF 245
           L++I+  +CT  EL  Y+N+ +++ RT AHYLT ++ +   IG + DW+ K+ SG TPLF
Sbjct: 529 LLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLF 588

Query: 246 SIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL 305
           +IFRSYD P+Y +MV  AF  A+ WY      F++  H D KGN+LLHV+KTNI ILL+ 
Sbjct: 589 AIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ 648

Query: 306 TKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVL 365
             +D+NE N KGLTPLMVYVKY RL N+  I +D RLI+EK Q S F  CFDY K+  + 
Sbjct: 649 ENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQ 708

Query: 366 SKIGERGVKDSLFGLIYFHSLRYHNLNATTNIT-SVSNAEKPFATTVINMKTIQGLLRSI 424
           +++G    + + FG +  H+ R+ N      IT    + E  F T   N++ IQGLL+  
Sbjct: 709 AELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVY 768

Query: 425 LKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFT 484
           L+ NP +FLP++  ++++  + ++ L  +GK +V   L +LT    ++   ++  + L+ 
Sbjct: 769 LRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYL 828

Query: 485 DEASILYWMRINTSKR 500
             + ++ W+R +  KR
Sbjct: 829 PASDLVNWIRESGRKR 844

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  422 bits (1084), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/698 (34%), Positives = 398/698 (57%), Gaps = 14/698 (2%)

Query: 16   TMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFE 75
            T+DADTLI L ++V+CRS+ K+LKSHL YL+ F+      KFG+ GY++ST+EAV+ YFE
Sbjct: 356  TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFE 415

Query: 76   DFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSICI 135
                 T  + K  +L E  +   D +     +     L++YK+ L  R+   +S LSICI
Sbjct: 416  A-GDGTEKLKKLISLSEANRVFWDLIR----SGVAVSLSSYKNSLISRSSNCESSLSICI 470

Query: 136  TNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNCT 195
               +  ++ +IL  Y+    +EDLL D     STLLI++++ G+ E A++LI +M+ NCT
Sbjct: 471  HAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCT 530

Query: 196  EEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPN 255
              E   Y+N+++   RTVAHYL     I++ IG Y+DW++K+ +  TPLF I R+YDQ +
Sbjct: 531  NNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLH 590

Query: 256  YEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEENY 315
            Y EM+  +F+    + R+    F + DH D  GNSLLH++K  I  +L    +++N+ N 
Sbjct: 591  YSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNI 650

Query: 316  KGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKD 375
            KG+TPLM+Y KY R+ NI  I +D+RLI+ K+QN       DY K+  +L+ IG    K+
Sbjct: 651  KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710

Query: 376  SLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPL 435
            SL+GL+    +++ + N      +V  ++  ++T   ++K IQGLL+   K +P  FLP+
Sbjct: 711  SLYGLLSADGIKFED-NCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPI 769

Query: 436  NTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMRI 495
            +  +  + ++ +  +  +   + +  L  LT   +V+    +    L  +E+ +  W+R 
Sbjct: 770  DHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRT 829

Query: 496  NTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDD 555
            N    N KP   ++ + +EPEE++ IQSFL+FN  E S  K    ILRK+++F +LK+ D
Sbjct: 830  N----NFKPRANKDER-IEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQD 884

Query: 556  FEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQCTIQLSSFV 615
             E A + + +    + NS   S  K  I ++  +   SL +  + + F+  C   LSS +
Sbjct: 885  IECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENY---SLDSFQQAIEFIAMCLETLSSKI 941

Query: 616  QIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKREQSEQ 675
            Q +L  K+  WW+ YGE  +L + Y++ FP+  K    S   S+     +IE KR+++E 
Sbjct: 942  QYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTED 1001

Query: 676  RLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFR 713
            +L  +++     L+ L  E+   HE LAEE+S ++ F+
Sbjct: 1002 KLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFK 1039

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  420 bits (1079), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 240/695 (34%), Positives = 402/695 (57%), Gaps = 15/695 (2%)

Query: 17   MDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFED 76
            +DADTL+ L V+VVCR++ K+LKSHL YL+ F+ NS   KFG+LGY++STLEAVV YF D
Sbjct: 355  IDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYF-D 413

Query: 77   FNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSICIT 136
               ++  + +  T C++ K   + +    P N    L  ++++L  R    +S+LS+CI 
Sbjct: 414  IGGSSIKLERLITQCQRNKIFWNLIEQGIPIN----LKEHEEVLISRTPSCESVLSLCIQ 469

Query: 137  NHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNCTE 196
              +  +  DI++ Y++ F +ED+L+D      +LLI++++AGN +  + +I +++ NCT 
Sbjct: 470  YGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTN 529

Query: 197  EELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPNY 256
             E+ +YINK D   RTV HYL    +I+  +G ++DWKRK+ +  TPLF++ R+YD P+Y
Sbjct: 530  TEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSY 589

Query: 257  EEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEENYK 316
             E++   F     +Y      F + DH D  GN+LLH++K  I + L     ++N+ N +
Sbjct: 590  LELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTR 649

Query: 317  GLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKDS 376
            G+TPLMVY KY R+ NI  I  D+RLIL K+Q+       DY K+  +L+ IG    K+S
Sbjct: 650  GMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNS 709

Query: 377  LFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPLN 436
            L+G +  H+++Y   NA     + S + + + T+   +K IQ LL+   K +P +FLP++
Sbjct: 710  LYGCLSVHNIKYEE-NAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPID 768

Query: 437  TYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFT-DEASILYWMRI 495
             +++ +  L +S +  +   + + LL  LT   +++   ++  +N+F+  E+ +  W+R 
Sbjct: 769  HHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQ-QREDYKNVFSYTESELSTWLRA 827

Query: 496  NTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDD 555
            +  K  QKP+ ++    +EPEEI+ IQ+FL+F+  E +  +    +L+K++IF + KS D
Sbjct: 828  SMVK--QKPNKRDK---IEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHD 882

Query: 556  FEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQCTIQLSSFV 615
             E + + L   G ++I S   S         N F++  +    + V F+  C   L+S +
Sbjct: 883  IECSQRILYSQG-EIIASVVPSKRLRTSPFDNEFND-GIDPFEQAVDFMCMCLDSLTSKI 940

Query: 616  QIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKREQSEQ 675
              +L  K+  WW  YGE   L K Y++ FP   KP SAS   S+     ++E KR++ E 
Sbjct: 941  VEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLES 1000

Query: 676  RLAVQIKASSKMLKELGSEIFVAHERLAEELSNYM 710
            +L  ++   S+ L+ L +E+   HE LAEE+S ++
Sbjct: 1001 KLQSRLSVCSENLQHLDAELKHCHELLAEEISFFI 1035

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  407 bits (1046), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 261/746 (34%), Positives = 411/746 (55%), Gaps = 40/746 (5%)

Query: 3    SHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGY 62
            S  LE+ D +  +++DADTL+SL V+VVC++E K LKSHL+YLQ F+ +S+S  FGIL Y
Sbjct: 351  SRSLEINDKV--ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAY 408

Query: 63   AVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLD---KLSCENPTNEVEDLATYKDI 119
             +STLEAV+ YFE   K        ++     + L D    L   NP+ EV      KDI
Sbjct: 409  GMSTLEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPS-EV------KDI 461

Query: 120  LTYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGN 179
            L  R   G S LSIC+ N +  + L + +++E+ FP+EDLL DET++GS LLI+ +  G 
Sbjct: 462  LRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGC 521

Query: 180  LEAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSS 239
               +   I+++  +CT+ EL S++N  ++Y R+  HYL H +D++  +G +I+W++++ +
Sbjct: 522  SSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCN 581

Query: 240  GQTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNI 299
            G TPLF+I R+YD  +Y+ MV  A+  A  W       F    H DNKGN+LLHV+K+N+
Sbjct: 582  GHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNV 641

Query: 300  PILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYA 359
             ++L    +++N  N KGLTP+MVY +Y RL NI +I +D+RLI++K QN ++ TCFDY 
Sbjct: 642  SVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYI 701

Query: 360  KDHSVLSKIGERGVKDSLFGLIYFHSLRYHNLN--------ATTNITSVSNAEKPFATTV 411
            K+  VL ++G+       F L   + +R HN+           T + SV NA  P     
Sbjct: 702  KNPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNA--PAKVIQ 754

Query: 412  INMKTIQGLLRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNV 471
             ++K IQ  L S  K N  TF+P  +  +E+S L +  +  I + +    L + +   ++
Sbjct: 755  RSLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSL 814

Query: 472  LLFLKKIPENLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDE 531
            +   ++  E++F + +  L    +N ++  Q+         +EPEE+  IQ  ++FN  E
Sbjct: 815  ICRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTE 869

Query: 532  ISSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKL--INSEASSAFKGIITNHNMF 589
            I + K+   +L+K+ IF  LK  D E ++      G     I   +++ F  +   H++ 
Sbjct: 870  ILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSL--KHSL- 926

Query: 590  SELSLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVK 649
             +     L  N   LE  +  L   +  IL   IP+WWK YGE ++L   Y K FP+ V+
Sbjct: 927  PQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVR 986

Query: 650  PKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNY 709
            P+ A +T     +  +IETKR + EQ L  +I  SSK L      +  ++E LA EL+N+
Sbjct: 987  PRVAENTGF---ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNF 1043

Query: 710  MEFRKACLDQRSLVAFATTNISVLQE 735
            + F+       ++   A  NI  LQE
Sbjct: 1044 INFKAEFWVSATIKEHAAMNIKWLQE 1069

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  398 bits (1022), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 246/723 (34%), Positives = 399/723 (55%), Gaps = 10/723 (1%)

Query: 17   MDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFED 76
            +DADTL+SLF L++CR+  + +  H+ YLQ+F  + ++ KFG LGY +ST+EA + YF +
Sbjct: 376  IDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYE 435

Query: 77   FNKNTGNVAKANTLCEKTKNLLDKL-SCENPTNEVEDLATYKDILTYRNEQGQSILSICI 135
                  N  ++    +K   L D L    +  +++  +  +KD   YR + G+SILS+ I
Sbjct: 436  L----SNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRTQYGESILSLLI 491

Query: 136  TNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNCT 195
             N KN  L + L  +E+ FP++DLL D  + GSTLLI+ +K  NLEAA++LI+I   +CT
Sbjct: 492  ANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCT 551

Query: 196  EEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPN 255
              EL++Y NKTDK  RT+AHY+T E++IL+ IG YI+W  K+  G+T LF+IFRSYDQ  
Sbjct: 552  NSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGRTALFTIFRSYDQTT 611

Query: 256  YEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEENY 315
            Y   +K A D A  WY+ ++ +F   DHTD  G+SLLH+LK+ + +LL+   LDIN  N 
Sbjct: 612  YSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNL 671

Query: 316  KGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKD 375
            KG+TPLM YVKY R+ NI  I +D RLI++K+Q   +  C DY K+ +V + +  +  KD
Sbjct: 672  KGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKD 731

Query: 376  SLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPL 435
             +F   Y    RY   +    I SV   +  + T +I +K    L+ ++ K     F+P 
Sbjct: 732  VIFENAYISYARYEKSHWYLCI-SVQKDDLEYTTNIIKLKKYYNLINAMQKIYKSDFIPY 790

Query: 436  NTYIDEISH-LNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMR 494
            +  +D +   +   ++  I +  + + L+ L++  + LL+ +KI      DE  I+ W+ 
Sbjct: 791  SDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWIS 850

Query: 495  INTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSD 554
                ++ +      + K +  E+IN I++F  F+F EI      +    K+ IF  +K+ 
Sbjct: 851  SKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNT 910

Query: 555  DFEDAYKGLNEMGRKLINSEASSAFKGI--ITNHNMFSELSLAALLENVRFLEQCTIQLS 612
            D   +Y  L  +G    N+E S     +  I+ H + S +    L +++ F+++CT+ L+
Sbjct: 911  DLNTSYDILERLGSYFSNNEISRTLGDLQSISPH-VHSSMVYYELSQDILFMKKCTLILT 969

Query: 613  SFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKREQ 672
            S +   + +K+  W K   + L   K Y   F    +       ++      +  T R++
Sbjct: 970  SKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENTSVFRYAWNVTYRKE 1029

Query: 673  SEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNISV 732
             E+RL   +    + LK+LG+EI V HE LAEE S+Y+  +        +  F + N++ 
Sbjct: 1030 EERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAH 1089

Query: 733  LQE 735
            L+E
Sbjct: 1090 LKE 1092

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  397 bits (1019), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 261/755 (34%), Positives = 401/755 (53%), Gaps = 43/755 (5%)

Query: 11   GLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAV 70
            G   + + ADTL+SLF+L++ R++ K+++ HLYYLQNF  + +S KFG+LGYA+STLEAV
Sbjct: 367  GGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAV 426

Query: 71   VCYFEDFNKNTGN---VAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQG 127
            +CY E    +      + K +   E+   LL +  C   +NE  DL+ Y     YRN  G
Sbjct: 427  ICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKC--VSNEGLDLSKYSHNFRYRNGDG 484

Query: 128  QSILSICITNHKNYILLDILSE-YENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVL 186
             S LS+CI N KN I  ++LSE YE+ F  EDLLED+T +G+TLL++S++  N E  + L
Sbjct: 485  NSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYL 544

Query: 187  IKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFS 246
              IML N TEEEL  Y  K DKY R + HY+  +  +L+ IG YI W  K+ +GQTPL  
Sbjct: 545  TDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQTPLCV 604

Query: 247  IFRSYDQPNYEEMVKTAFDIANTWYRK-HNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL 305
            IFRSYDQ  Y+ MV+T+F IA  WY    NS F + DHTD+KGN+LLH++K NI  LLQ 
Sbjct: 605  IFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQS 664

Query: 306  TKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDH--- 362
              +DIN+ N +GL+PL     Y R  N++A+ KD RLI         F+ FD+ K +   
Sbjct: 665  PDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI---------FSSFDFLKQYPNT 715

Query: 363  ---SVLSKI---GERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKT 416
                +LS      E   ++ +     F      ++  T+   S  +A++   +    +K 
Sbjct: 716  KSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSR--SKEDAQELIGSEAFELKN 773

Query: 417  IQGLLRSILKDNPFTFLPLNTYIDEISHLNR--SDLTIIGKTDVTSLLHQLTNCFNVLLF 474
            ++ L R +LK +PFTF PL   +DE+S + +  S  +++  +  + +L +LT C + ++ 
Sbjct: 774  LKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSSFCSKVLKKLTYCLDSMVE 833

Query: 475  LKKIPENLFTDEASI-LYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEIS 533
            ++ +P       A +  +  +   +   +K   +   K M+PE I  I +FL++  + + 
Sbjct: 834  MELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILESLL 893

Query: 534  SFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMF-SEL 592
              K ++  LRK  I   LKS D  ++   +  +G ++ + +   A     T  N F  E 
Sbjct: 894  KLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGEQ 953

Query: 593  SLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHK---------SYRKA 643
            S   L+  + F E C   + + +  +L  KIP WWK YG+ L L K         S  K 
Sbjct: 954  SFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQ 1013

Query: 644  FPNM---VKPKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHE 700
             PN    V   +   TS    LG FIE KR ++++R    I    + LK L +EI   + 
Sbjct: 1014 TPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNT 1073

Query: 701  RLAEELSNYMEFRKACLDQRSLVAFATTNISVLQE 735
             +  E   ++ F+   +    L  +   NI++L++
Sbjct: 1074 LVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKK 1108

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  374 bits (961), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 273/783 (34%), Positives = 420/783 (53%), Gaps = 94/783 (12%)

Query: 38   LKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNL 97
            LK++LYYL+ FS + SS+ FGIL Y ++T   V    E       NV   + L EK+ +L
Sbjct: 405  LKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLE-------NVIDWDRLKEKS-DL 456

Query: 98   LDKLSCENPTNEVEDLATY-----KDILTYRNEQGQSILSICITNHKNYILLDILSEYEN 152
            +++L     T+++  L++      K +L YRN  G+S+L++ I N +N      L EYE+
Sbjct: 457  IEELIM---TDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYED 513

Query: 153  DFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC-TEEELVSYINKTDKYAR 211
               ++ +  D+++D STLL+++I++ N EAA +L+K++  NC  ++EL+SYIN+ D + R
Sbjct: 514  ILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNR 573

Query: 212  TVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPNYEEMVKTAFDIANTWY 271
             + HYL   + ILK IG +I+WK+K+ +G+TPLF+IFRSYDQ NY+E+V   F IA  WY
Sbjct: 574  NIGHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWY 633

Query: 272  RKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTK-----LDINEENYKGLTPLMVYVK 326
              +N  F   DH D+ GNSLLH+L+ NI ILL   K     +++N+ N KG TPLM+Y K
Sbjct: 634  AANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFK 693

Query: 327  YKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKDS-LFGLIYFHS 385
            YKR  NI  I K+ +LI  K Q+  F  CFDY+ D S+++ IGE  + +  LFG I   S
Sbjct: 694  YKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLS 753

Query: 386  LRYHNLNATT-------NITS-VSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPLNT 437
            L+       +       N T  +  A+K   T  +   ++   L+ + +    +FLPL+T
Sbjct: 754  LKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDT 813

Query: 438  -------YIDEISHLNRSDLTI----IGKTDVTSLLHQLTNCFNVLLFL--KKIPENLFT 484
                   ++D+ S  N +  TI    I K  +   L +L  C +VLL      I   L  
Sbjct: 814  LLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLL 873

Query: 485  DEASILYWMRINTSKRNQK---PSGK---ENP------KTMEPEEINMIQSFLRFNFDEI 532
             E  +L W+ I  SK  +    PS K   EN       K ++PE IN+IQ+FL+FN +E+
Sbjct: 874  SETELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNEL 933

Query: 533  SSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFK---GII--TNHN 587
            ++   +L +L K++IF+NLK+ D  DA    N + + L N E  S  +    +I  + ++
Sbjct: 934  NTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYD 993

Query: 588  MFSELSLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNM 647
                + L +L E++ F  +CT++L   V+ I+  KIPNWWK YGE L L+K Y K FPN 
Sbjct: 994  DDKGVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNC 1053

Query: 648  VKPKSASD---------------------------------TSSRAPLGGFIETKREQSE 674
            V     +D                                  S+       IE ++ + E
Sbjct: 1054 VVHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLE 1113

Query: 675  QRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNISVLQ 734
            ++ +  I  +  +L+ LGS +   HE LAEEL+ YMEF+     +  +  F   +I +L+
Sbjct: 1114 RKTSHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLE 1173

Query: 735  ECV 737
            E V
Sbjct: 1174 EHV 1176

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  370 bits (951), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 239/720 (33%), Positives = 386/720 (53%), Gaps = 43/720 (5%)

Query: 12   LNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVV 71
            +N ++ DADTL+SLFVL++CRS+   L   L YL NF  + +S KFG+ GY +ST EA +
Sbjct: 361  INGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAAL 420

Query: 72   CYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSIL 131
             +F     +   V      C   K +   +   +   E E L++    L  R + G+S+L
Sbjct: 421  SFF-----HQDTVDSLTKKCASNKKIWASIQKHSKV-EAELLSSN---LRIRTDSGESLL 471

Query: 132  SICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIML 191
            SICI +H N +L  +L+ +E++FP+ED+L+D     STLLI++++  N +AA +L +I+L
Sbjct: 472  SICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIIL 531

Query: 192  FNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSY 251
             +CTE E+ SY+N  + + R  AHY+  ++ +L+S+G Y +W+ K+ +G TPLF++FRSY
Sbjct: 532  KSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSY 591

Query: 252  DQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDIN 311
            D  NY+E+V    D    WY  +N  F++  H D KGN+LLHV+K+ I  LL+L  +++N
Sbjct: 592  DAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNVN 651

Query: 312  EENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGER 371
            + + KGLTPLM+Y +Y R++NI+ I KD RL+ + VQ     T  D+ K+  V      +
Sbjct: 652  KPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKV-----TK 706

Query: 372  GVKDSLFGL--IYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNP 429
             + D+ F    +  HSLR+        I S    E  F    +++  IQ  LR +    P
Sbjct: 707  TILDATFNREPVVIHSLRFEERKWKIGIFS----EGIFKKYSLDL--IQYYLRYLKIMYP 760

Query: 430  FTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASI 489
             +F P+    +E+  L    +  + +        +L   F+ +    K+   L  DE  +
Sbjct: 761  CSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLW--LGKDEEEL 818

Query: 490  LYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFI 549
               + + T       S  E    +EPEEIN IQ+FL++N  E    +  L IL+K+ I  
Sbjct: 819  KVLLDVPTPYL----SESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQ 874

Query: 550  NLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQCTI 609
             +K  D          +G ++     + +F+   TN     +LS      N+ +LE   +
Sbjct: 875  QIKHRDVITMRNSFLSLGNQMSQKGVAKSFEN--TNCAWSYDLSYYEFTRNLEYLEHSVV 932

Query: 610  QLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETK 669
             L +  + +L  K   WWKH+GE + L K ++K FPN   P S+++   R  +  +IE K
Sbjct: 933  TLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFPNDKAPPSSAN---RNFIDTYIEGK 988

Query: 670  REQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFR---------KACLDQR 720
            R +   +L+ Q+K SS  LK++G EI   HE +A  ++ ++EF+         K+ +DQR
Sbjct: 989  RSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQR 1048

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  347 bits (890), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 250/791 (31%), Positives = 403/791 (50%), Gaps = 93/791 (11%)

Query: 14   NMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCY 73
            N   DADTLI L  +V+CR + ++LKSHL+YLQNF+ + ++ KFGILGY++STLEA+  Y
Sbjct: 405  NKLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYY 464

Query: 74   FEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSI 133
            F+  +    + A     C+K  NL D +      N ++ L    DIL+YR++ G+S+LS+
Sbjct: 465  FDHISH--SHKADLIAFCDKLHNLYDTI-----LNNIKSLDN--DILSYRSQNGESLLSL 515

Query: 134  CITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFN 193
            CI N+K  I L++L+ YE+ FP+ED+L+D  ++GS+LL+++ K  N  A+++L+ I+  +
Sbjct: 516  CIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKNS 575

Query: 194  CTEEELVSYINKTDKYARTVAHY--LTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSY 251
            C EEEL  ++NKTDK+ R+VAHY  + + + IL   GN IDW+ K+    TPL +IF+ +
Sbjct: 576  CNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVH 635

Query: 252  DQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKL--- 308
                 E  +K  F +  TWY+ HN  F+   H D  GN+LLHV+K  I  L++  +L   
Sbjct: 636  KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCET 695

Query: 309  -DINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSK 367
             +IN  N KGL+P MVY K  R  NI  I K+  LI  + Q     T  +   +  V   
Sbjct: 696  ININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-NSKVNHL 754

Query: 368  IGERGVKDSLFGLIYFHSLRYHNLNATTNITSVS--------NAEKPFATT--------V 411
            +    ++   F  I  HSLR+++ +++T+ TS++          E  F T+         
Sbjct: 755  LATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRTKT 814

Query: 412  INMKTIQGLLRSILKDNPFTFLPLNTYIDEISHLNRSDLTI--------------IGKTD 457
            + +KTI+ LL   ++   ++ LPL + ++  + L +S+ +I              I K +
Sbjct: 815  LKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLE 874

Query: 458  VTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMRINTSK------------RNQKPS 505
            +   L  ++NC N L         L  DE  +  +++IN  K            +N    
Sbjct: 875  IQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQ 934

Query: 506  GKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDDFEDAY----- 560
              E  K  +PE+IN IQ+F++FN  E+ +FK ++  ++ V I I  K  D   +      
Sbjct: 935  TTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQK 994

Query: 561  ----KGLNEMGRKLINSEASSAFKGIITN---HNMFSELS--------LAALLENVRFLE 605
                 G+N +   L   +  S  K +ITN      F + +        L  LLEN+ F E
Sbjct: 995  NTLKIGINNLSEIL---KYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFE 1051

Query: 606  QCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGF 665
            +   +L    + +    I  WW HYG  L     Y K +PN        D ++       
Sbjct: 1052 KLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDINNNFESFNT 1106

Query: 666  IETKR------EQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQ 719
            +  KR         E+ + + IK +S +L+   ++I   HE LA EL+N+M F+   + +
Sbjct: 1107 MFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFI-R 1165

Query: 720  RSLVAFATTNI 730
              ++ F+T  +
Sbjct: 1166 EYIIKFSTIEV 1176

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
           YML002W
          Length = 942

 Score =  311 bits (798), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 244/741 (32%), Positives = 389/741 (52%), Gaps = 87/741 (11%)

Query: 8   LPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTL 67
           L   L  + +DAD L++  ++++ R +  +L  H +YLQNF N   +  FGIL YA+STL
Sbjct: 268 LTSKLPQLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNF-NFKQNKDFGILNYAISTL 326

Query: 68  EAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQG 127
            AV+ Y +                    N LDK   +  T+ ++D    ++ L YRNE G
Sbjct: 327 GAVLYYID--------------------NNLDKF--KRYTDAIQDSKISEEKLKYRNENG 364

Query: 128 QSILSICITNHKNYILLDIL--SEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKV 185
           +S L  CI    N  L ++L  SEY  +FP+ED+L+D+TIDGSTLL+ ++K  N  AA +
Sbjct: 365 ESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASI 424

Query: 186 LIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNS-SGQTPL 244
           LI I++ N T +E+ +Y+N  D+  R V H++T++  +L  IG Y++W  K+  +GQTPL
Sbjct: 425 LINIIINNGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPL 484

Query: 245 FSIFRSYDQP--NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPIL 302
           F+IFRSYDQ   +Y++M + +F  A       +  F    H DN  N+LLH+LKTNI ++
Sbjct: 485 FNIFRSYDQSIKSYKKMSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMI 539

Query: 303 LQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAIT----KDRRLILEKVQ-NSTFFTCFD 357
           L    L IN  N  G+TPLMV+ KY+RL NI  +     KDR  I E  Q ++ +  CF 
Sbjct: 540 LPHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFS 599

Query: 358 YAKDHSVLSKIGERGVKD-SLFGLIYFHSLR---YHNLNATTNITSVS---NAEKPFATT 410
              D  +L+ +G+  +K+ S+FG  + HSL+   + + +   N  SV      EK + T 
Sbjct: 600 LTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTI 659

Query: 411 VINMKTIQGLLRSILKDNPF--TFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNC 468
             N+KTI+ L+  +L  N    +FLPL    +E++ +     ++I        ++ L   
Sbjct: 660 RFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGI----ASMISTKSKILFINNLNVI 715

Query: 469 FNVLLFLKKIPENLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFN 528
            + +LFL+ +P   F  EA +  ++R   ++R  K    ++ K ++ E+INMI +FL+FN
Sbjct: 716 LDTILFLELVPREGFILEARLKDYLR---NQRKIKTVATKSKK-LQIEDINMISNFLKFN 771

Query: 529 FDEISSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNM 588
            +E+++FK  +  + + +  INLK  D   +Y  L      +++             +N 
Sbjct: 772 LNELNAFKNGVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHL------------NNP 819

Query: 589 FSELSLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMV 648
              L+   L+ N + LE        F+++   EKI  WWK   E +           N+ 
Sbjct: 820 LWNLNYNILISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELI-----------NLT 868

Query: 649 KPKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSN 708
           K  S SD      L  F   K     ++L+++I    + + EL  +IFV+HE LA E++N
Sbjct: 869 KLASNSDDD---LLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINN 920

Query: 709 YMEFRKACLDQRSLVAFATTN 729
           +M+F K     R+LV +A  N
Sbjct: 921 FMKF-KPLFITRTLVVWAHRN 940

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {ON}
           Anc_2.15 YNL227C
          Length = 626

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 192 FNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPL------- 244
           +N T +  VS++ K DK  +  A    +E  + K      + K++ +SG TP        
Sbjct: 243 YNKTVKRFVSFVKKLDKRMKAGAQRQENERKMQKEAAKNGNDKKQRASGHTPSNTQTDFE 302

Query: 245 FSIFRSYDQPNYEEMVK 261
           +  ++  D+PN++E+ K
Sbjct: 303 WQSWQMADEPNWDELEK 319

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 168 STLLIESIKAGNLEAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHY--LTHEMDILK 225
           ST L  +   G+ +  K L+ ++  N T EEL  Y+NK ++   T  H+  L  ++D++K
Sbjct: 51  STALHMACANGHTDVVKYLLTLVKENATSEELKDYVNKQNETGNTALHWASLNGKLDVVK 110

Query: 226 SI-GNY 230
            + G Y
Sbjct: 111 LMCGEY 116

>Smik_4.466 Chr4 complement(849363..850760) [1398 bp, 465 aa] {ON}
           YDR219C (REAL)
          Length = 465

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 414 MKTIQGLLRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTN 467
           M +    ++S L++   T LPLN     +SHL+ +DL  IGKT   +LL  L N
Sbjct: 1   MSSFSCNVQSALEEKSLTNLPLNLLFRILSHLDMNDLQSIGKT--CTLLRMLAN 52

>ZYRO0F11000g Chr6 complement(897427..899124) [1698 bp, 565 aa] {ON}
           similar to uniprot|Q08622 Saccharomyces cerevisiae
           YOR205C FMP38 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 565

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 11/122 (9%)

Query: 444 HLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMRINTSKRNQK 503
           H N+ DL   G+  +T +L ++    N+L  +  +PE  F  E S+L     NTS    K
Sbjct: 114 HRNQYDLKEFGRYTITDVLEKIPRGSNILHVV-PLPEFPFHFEKSLLEVPHFNTSLLLTK 172

Query: 504 PSGKENPK-TMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDDFEDAYKG 562
                N K T++   +   + FL++    IS+         K +    LK+ + + AY  
Sbjct: 173 GDQLANDKNTLQRRSLVFFKDFLKYQLGIISN---------KTVAVSGLKNWNIQSAYAA 223

Query: 563 LN 564
           +N
Sbjct: 224 MN 225

>TBLA0C00730 Chr3 complement(151239..152036) [798 bp, 265 aa] {ON}
           Anc_1.424 YCR009C
          Length = 265

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 220 EMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFD 279
           E++++K + N+++ + K    Q  L S+   Y  P++E +VK         Y +   +  
Sbjct: 171 ELNLVKDVFNHLNEQLKMELPQ--LVSLRVPYFDPSFEAIVKIQLRFCTDGYSRLAQIQQ 228

Query: 280 YLDHT--DNKGNSLLHVLKTNIPILL-QLTKLDI 310
           YLD    D+  N LL    T I  LL Q+T LDI
Sbjct: 229 YLDQQSRDDYANGLLD---TKIEDLLHQMTSLDI 259

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,612,762
Number of extensions: 3703739
Number of successful extensions: 13481
Number of sequences better than 10.0: 79
Number of HSP's gapped: 13944
Number of HSP's successfully gapped: 80
Length of query: 737
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 620
Effective length of database: 40,065,477
Effective search space: 24840595740
Effective search space used: 24840595740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)