Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR206W (ENT2)7.342ON6132679421e-119
Smik_12.2647.342ON6122679301e-117
Skud_12.2707.342ON6262709061e-113
Suva_10.3007.342ON6182718561e-106
NCAS0H006707.342ON4832677168e-87
KAFR0L014607.342ON5502707052e-84
TDEL0C020507.342ON5012676411e-75
CAGL0A03872g7.342ON5102686384e-75
YDL161W (ENT1)7.342ON4542056171e-72
Skud_4.947.342ON4472056161e-72
ZYRO0F11550g7.342ON5382676231e-72
Smik_4.757.342ON4601996152e-72
NDAI0D006107.342ON4862676131e-71
Suva_4.837.342ON4622056074e-71
TPHA0D045607.342ON4872695885e-68
Kwal_56.246107.342ON5082685862e-67
TBLA0E004807.342ON5991965912e-67
KLTH0H01430g7.342ON5022685825e-67
Kpol_2001.707.342ON5331315705e-65
SAKL0F10934g7.342ON4981935623e-64
KNAG0C038007.342ON4471875541e-63
KLLA0C16731g7.342ON4782085421e-61
KAFR0B008907.342ON4141275152e-58
KNAG0B026507.342ON6461315293e-58
Ecym_47317.342ON5142685189e-58
ACL157C7.342ON5151994723e-51
TBLA0E020407.342ON7012134795e-51
KLTH0D16896g4.346ON4011302113e-17
Kwal_47.168574.346ON3821302033e-16
Suva_12.2164.346ON4101302034e-16
KNAG0M003804.346ON4031302024e-16
NDAI0D032004.346ON4351302025e-16
KLLA0B04587g4.346ON4001301991e-15
SAKL0G17952g4.346ON4151301981e-15
Skud_10.3494.346ON4101301972e-15
YJR125C (ENT3)4.346ON4081301962e-15
Smik_10.4184.346ON4091301963e-15
TBLA0E047604.346ON4261311963e-15
TPHA0B004004.346ON3991311944e-15
AER155C4.346ON3641301934e-15
TDEL0D007104.346ON3751301934e-15
Kpol_1001.24.346ON4181311936e-15
KAFR0B067404.346ON3991291936e-15
NCAS0A062104.346ON4231301929e-15
ZYRO0B14784g4.346ON4241301858e-14
CAGL0H04323g4.346ON4121231821e-13
Ecym_11334.346ON3921301767e-13
SAKL0H25762g4.17ON2621121541e-10
Kwal_55.206114.17ON2541101391e-08
TBLA0B062204.346ON3391301322e-07
TDEL0G017404.17ON2571211283e-07
ZYRO0G07876g4.17ON259981265e-07
Kpol_388.54.17ON2681191212e-06
Ecym_84074.17ON2541381203e-06
KLLA0D03949g4.17ON2251201184e-06
TPHA0F002304.17ON2801211187e-06
KLTH0E05874g4.17ON2551001151e-05
YHR161C (YAP1801)5.84ON637881126e-05
CAGL0E03806g4.17ON2601261089e-05
TBLA0G006504.17ON4231071091e-04
Skud_8.2255.84ON621881082e-04
SAKL0H02530g5.84ON669961055e-04
Smik_8.2455.84ON627881047e-04
ACL061C4.17ON234115990.001
Suva_10.354.17ON247120990.001
NCAS0C058404.17ON26795960.004
KAFR0I014604.17ON275137950.005
TBLA0H012108.335ON49198950.006
NDAI0H002804.17ON31096930.009
YLL038C (ENT4)4.17ON247100910.014
Skud_12.304.17ON24799900.015
ZYRO0F13684g8.335ON40798910.019
Smik_12.194.17ON247100890.024
TBLA0B057705.84ON680120900.026
NCAS0B036608.335ON416113880.041
TPHA0A052105.84ON63296850.10
Kpol_344.88.335ON384119840.12
CAGL0E01199g8.335ON41298840.15
KLLA0D16654g8.335ON399113830.17
KAFR0B058008.335ON38297830.19
NDAI0J009308.335ON418113810.28
KNAG0A051008.335ON42198790.60
KNAG0E006105.84ON60472790.66
TPHA0C007408.335ON38597761.1
TDEL0B003208.863ON63731761.3
NDAI0A028305.84ON47377706.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR206W
         (613 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   367   e-119
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   362   e-117
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   353   e-113
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   334   e-106
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    280   8e-87
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   276   2e-84
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   251   1e-75
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   250   4e-75
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   242   1e-72
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   241   1e-72
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   244   1e-72
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   241   2e-72
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   240   1e-71
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   238   4e-71
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   231   5e-68
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   230   2e-67
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   232   2e-67
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   228   5e-67
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   224   5e-65
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   221   3e-64
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   218   1e-63
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   213   1e-61
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   202   2e-58
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   208   3e-58
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   204   9e-58
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   186   3e-51
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   189   5e-51
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    86   3e-17
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    83   3e-16
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    83   4e-16
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    82   4e-16
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    82   5e-16
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    81   1e-15
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    81   1e-15
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    80   2e-15
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    80   2e-15
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    80   3e-15
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    80   3e-15
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    79   4e-15
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    79   4e-15
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    79   4e-15
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    79   6e-15
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    79   6e-15
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    79   9e-15
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    76   8e-14
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    75   1e-13
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    72   7e-13
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    64   1e-10
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    58   1e-08
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    55   2e-07
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    54   3e-07
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    53   5e-07
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    51   2e-06
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    51   3e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    50   4e-06
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    50   7e-06
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    49   1e-05
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    48   6e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    46   9e-05
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    47   1e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    46   2e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    45   5e-04
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    45   7e-04
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    43   0.001
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    43   0.001
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    42   0.004
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    41   0.005
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    41   0.006
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    40   0.009
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    40   0.014
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    39   0.015
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    40   0.019
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    39   0.024
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    39   0.026
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    39   0.041
TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa] ...    37   0.10 
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    37   0.12 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    37   0.15 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    37   0.17 
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    37   0.19 
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    36   0.28 
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    35   0.60 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    35   0.66 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    34   1.1  
TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}...    34   1.3  
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    32   6.2  

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 189/267 (70%), Positives = 189/267 (70%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKELVS            SM                     SNPHDSSPSYQDDL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EKALEESRITAQEDEQRRRELAQYDDEDPDF                             
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 241 XXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                           AYYDIFGNPIS
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  199 bits (505), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 98/114 (85%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGXXXXXXXXXXXXXXXXGISYS 537
           VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG                GISYS
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPTNSPQQNPTGISYS 537

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 340 PLPTGSNNPFSMDN 353
           PLPTGSNNPFSMDN
Sbjct: 340 PLPTGSNNPFSMDN 353

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  362 bits (930), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/267 (70%), Positives = 189/267 (70%), Gaps = 2/267 (0%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKELVS            SM                     SNPHDSSPSYQ+DL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EKALEESRITAQEDEQRRRELAQYDDEDPDF                             
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDF--QAALQLSKEEEELKQLQELQRLQNQQQ 238

Query: 241 XXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                           AYYDIFGNPIS
Sbjct: 239 SLSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  190 bits (483), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 90/93 (96%), Positives = 91/93 (97%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PLKQTRTGNQSISDKY+DLNTLLATGTG DTFGNTGEARIPAQHTKTGTFINSQGTGYKQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V NEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 340 PLPTGSNNPFSMDN 353
           PLPTGSNNPFSMDN
Sbjct: 339 PLPTGSNNPFSMDN 352

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 186/270 (68%), Gaps = 3/270 (1%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNM+KGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKELVS            SM                     SNP DSSPSYQD+L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EK LEESRITAQEDEQRRRELAQYDDEDPDF                             
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 241 XXX---XXXXXXXXXXXXXAYYDIFGNPIS 267
                              AYYDIFGNPIS
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  188 bits (477), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 91/114 (79%), Positives = 96/114 (84%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL+QTRTGNQSISDKY+DLN LLATGTG+DTFGNTGEARIPAQHTKTGTFINSQGTGYKQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGXXXXXXXXXXXXXXXXGISYS 537
           VT+EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG                 I+YS
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYS 563

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/14 (92%), Positives = 13/14 (92%)

Query: 340 PLPTGSNNPFSMDN 353
           P PTGSNNPFSMDN
Sbjct: 340 PQPTGSNNPFSMDN 353

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 184/271 (67%), Gaps = 12/271 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYSSTQVLVRDATAND RTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXX----XXXXXXXXXXXXSNPHDSSPSY 176
           IIRVKAKELVS            +M                         SN +DS P+Y
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 177 QDDLEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 236
           Q+DLEKALEESRITAQEDE RR E+AQYDD+DPDF                         
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDF--------QAALQLSKEEEELKQLQ 232

Query: 237 XXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                               AYYDIFGNPIS
Sbjct: 233 ELQKQQQLQSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  179 bits (453), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (95%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL QTRTGNQSISDKY+DLN LLATGTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V NEPKNNPFL++QYTGLPST+IVPTQTGYGFG
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 341 LPTGSNNPFSMDN 353
           LPTGSNNPFSMDN
Sbjct: 339 LPTGSNNPFSMDN 351

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  280 bits (716), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 170/267 (63%), Gaps = 15/267 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYS+TQVLVRDAT+ND+  PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKEL S            ++                        +D     QD+L
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDED---QDEL 177

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ALEESR+TA+EDE+RRR++AQYDD+DPD                              
Sbjct: 178 QRALEESRLTAEEDERRRRQMAQYDDQDPDL------------QTALQLSKEEEELKKLQ 225

Query: 241 XXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                            Y+DIFGNPIS
Sbjct: 226 EMQRLQQQQGQMNQPQGYFDIFGNPIS 252

 Score =  171 bits (432), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 80/89 (89%), Positives = 86/89 (96%)

Query: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487
           TRTGNQSI+DKYS LNTLLATGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+QVTN+
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           PKNNPFL++QYTGLPSTNIV TQTGYGFG
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFG 457

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 169/270 (62%), Gaps = 17/270 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN+MKGYSSTQVLVRDAT+ND+R  +IDTLDD+A RSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWC+EN YVIKTLREFR+E+++G D+GQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSN---PHDSSPSYQ 177
           IIRVKAKEL S                                    +   P D      
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDD------ 174

Query: 178 DDLEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXX 237
           DDL++ +EES+ TA+EDE+RR+ELA+YD+EDP+F                          
Sbjct: 175 DDLQRVIEESKKTAEEDERRRKELARYDEEDPEF--------QAALQLSKEEEELKNLQD 226

Query: 238 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                               YYD+FGNPIS
Sbjct: 227 LQRQQQQLQMLQQQQTSANVYYDVFGNPIS 256

 Score =  155 bits (391), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 72/89 (80%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 429 RTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE- 487
           RTGN+ I++KYS+LN LLA GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQVTNE 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
            KNNPFL+ QYTGLPS+NIVP+ TGYGFG
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  251 bits (641), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 160/267 (59%), Gaps = 25/267 (9%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSS QVLVR+ATAN+S  PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR++++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKEL +             M                              + DDL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREM---------NRKGRKNGTRRRRRTTGEQDGFDDDL 171

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++AL+ESR+TA+EDE+RR+ L   DD+                                 
Sbjct: 172 QRALDESRLTAEEDERRRKMLGSEDDD----------------LQAALQLSKEEEELKRL 215

Query: 241 XXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                            YYDIFGNPIS
Sbjct: 216 QEMQKLQQQQTQQQPSQYYDIFGNPIS 242

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 70/91 (76%), Positives = 81/91 (89%)

Query: 426 KQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT 485
           K  RTG+ ++++KY +LN LLATGTGIDTFGNTG+ARIPAQHTKTGTFINSQGTGY+QVT
Sbjct: 387 KPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT 446

Query: 486 NEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
            EPK NPFL +QYTG+PS+NIVP  TGYGFG
Sbjct: 447 GEPKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  250 bits (638), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 144/268 (53%), Positives = 169/268 (63%), Gaps = 16/268 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  Q VRSAKNM+KGYSSTQV+VRDATANDS +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDD 179
           QIIRVKAKEL S            ++                     ++  +   +Y DD
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRN---AYDDD 177

Query: 180 LEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L+KALEESR+TA+E+E RRRE AQY+++DPD                             
Sbjct: 178 LQKALEESRMTAEEEEARRREQAQYENQDPDL------------LAALQLSKEEEELKKL 225

Query: 240 XXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                             YYDIFGNPIS
Sbjct: 226 QDMQRMQELQAQQQQQNVYYDIFGNPIS 253

 Score =  178 bits (451), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (97%)

Query: 427 QTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 486
           +TRTGNQSISDKYS+LN LLA+GTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 487 EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           EPKNNPFLS+QYTGLPSTNIVP+ TGYGFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  242 bits (617), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 118/205 (57%), Positives = 150/205 (73%), Gaps = 10/205 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           I+RVKAKEL +            +M                     S+ +D      DDL
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNM----NIKGRNRKGRRRRGTGRSDEND------DDL 170

Query: 181 EKALEESRITAQEDEQRRRELAQYD 205
           ++A+  SR+TA+EDE+RR++   Y+
Sbjct: 171 QRAISASRLTAEEDERRRKQDEDYE 195

 Score =  165 bits (418), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 86/92 (93%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL Q RTGNQS++DKYS LN LLATGTGIDTFGN GEARIPAQHTKTGTFINSQGTGY+Q
Sbjct: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 515
           V+++P +NPFL++QYTGLPST++VPTQTGYGF
Sbjct: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  241 bits (616), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 118/205 (57%), Positives = 149/205 (72%), Gaps = 10/205 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           I+RVKAKEL +            +M                      N  D      DDL
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNM-----NIKGRSRKGRKRRGTGRNDEDD-----DDL 170

Query: 181 EKALEESRITAQEDEQRRRELAQYD 205
           ++A++ SR+TA+EDE+RR++   Y+
Sbjct: 171 QRAIDASRMTAEEDERRRKQDEDYE 195

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 77/93 (82%), Positives = 87/93 (93%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL QTRTGNQS++DKY  LN LLATGTGIDTFGN G++R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V+N+PK NPFL++QYTGLPSTNIVPTQTGYGFG
Sbjct: 393 VSNDPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  244 bits (623), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 157/267 (58%), Gaps = 23/267 (8%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH+++   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKEL +             M                      N +DS      ++
Sbjct: 121 IIRVKAKELTN----LLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDS------EM 170

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++AL+ SR+TA+EDE+RR+ L   ++ED D                              
Sbjct: 171 QRALDASRLTAEEDERRRKTL---NNEDADL----------ETALQLSKEEEELKRLQEL 217

Query: 241 XXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                            YYDIFGNPIS
Sbjct: 218 QKAQQDQQRLSQMQPQGYYDIFGNPIS 244

 Score =  155 bits (391), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           P++  RTGNQSISDKY+DLN LLA  TG+DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ
Sbjct: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
            +NEPK NPFL  Q+TG+P++++VP+ TGYGFG
Sbjct: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  241 bits (615), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 117/199 (58%), Positives = 148/199 (74%), Gaps = 9/199 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           I+RVK+KEL +            +M                     SN +D      +DL
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNM---NIKGRNRKGRSRRGTGRSSNDND------NDL 171

Query: 181 EKALEESRITAQEDEQRRR 199
           ++AL+ SR+TA+EDE+RR+
Sbjct: 172 QRALDASRMTAEEDEKRRK 190

 Score =  173 bits (438), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 79/93 (84%), Positives = 87/93 (93%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL QTRTGNQS++DKY+ LN LLATGTGIDTFGN G+AR+PAQHTKTGTFINSQGTGYKQ
Sbjct: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V+N+PK NPFLS QYTGLPSTN+VPTQTGYGFG
Sbjct: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  240 bits (613), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 138/267 (51%), Positives = 166/267 (62%), Gaps = 6/267 (2%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYS+TQVLVRDAT+NDS  PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           IIRVKAKEL +            S+                     +N         +DL
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSI----NLKNNRRSERKNRSRRGTNATRRGTKSDEDL 175

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           +KALEESRITA+EDE+RRRELAQYD++D D+                             
Sbjct: 176 QKALEESRITAEEDERRRRELAQYDNQDTDY-QTALQLSKEEEELKKLQELQRLQQLQQQ 234

Query: 241 XXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                            YYDIFGNPIS
Sbjct: 235 QQQQMQFQQQPQQQEQVYYDIFGNPIS 261

 Score =  158 bits (399), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487
           TRTGNQSISDKY++LN LLA+GTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+ N+
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 488 P-KNNPFLSNQYTGLPSTNIVPTQTGYGF 515
           P K NPFL+NQYTGLPS+NIVP+ TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  238 bits (607), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 116/205 (56%), Positives = 146/205 (71%), Gaps = 10/205 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ VRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           I+RVKAKEL S            +M                           S    DDL
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTN----------RSSEDDDDL 170

Query: 181 EKALEESRITAQEDEQRRRELAQYD 205
           ++A++ SR+TA EDE+RR++   Y+
Sbjct: 171 QRAIDASRMTADEDERRRKQDEDYE 195

 Score =  167 bits (423), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 75/93 (80%), Positives = 86/93 (92%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL QTRTGNQS++DKYS LN LL TGTGIDTFGN G+ R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V+N+PK+NPFL++QYTGLPSTN+VP QTGYGFG
Sbjct: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGFG 440

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  231 bits (588), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 157/269 (58%), Gaps = 34/269 (12%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS QFVRS KN++KGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES--GFDE 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E+  G D+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQD 178
           GQIIRVKAKEL              ++                     +    +     +
Sbjct: 121 GQIIRVKAKELT-------------ALLMDDERLREERRLNNRRDRNRNRRPPARNGSDE 167

Query: 179 DLEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           DL++ALEESR TA+EDE++RR     + +D D                            
Sbjct: 168 DLQRALEESRRTAEEDERKRR----LNQDDSDL---------------QAALQLSKEEEE 208

Query: 239 XXXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                              YYD+FGNPIS
Sbjct: 209 LKRLQELQSSMHMQQQQPVYYDVFGNPIS 237

 Score =  153 bits (387), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%)

Query: 429 RTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 488
           RTGN+ +++KY++LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+Q + E 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 489 KNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           K NPFLSNQYTGLPS+NI+PTQTGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  230 bits (586), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/268 (45%), Positives = 155/268 (57%), Gaps = 16/268 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           I+RVKA+EL +            S+                          ++ S  +DL
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRR---------------RPTAGSEDEDL 165

Query: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ++A+EESR+TA QE+ +RRR+L  YD+   D                             
Sbjct: 166 QRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQA 225

Query: 240 XXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                             YYD+FGNPIS
Sbjct: 226 QQQMFGLSQQQTQAQQPMYYDVFGNPIS 253

 Score =  156 bits (394), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 82/89 (92%)

Query: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487
           TRTGNQSI++K+S+LN LLA+GTG+DTFGNTG+ RIPAQHTKTG FINSQGTGYKQV++ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           PK+NPFL  QYTGLPSTN+VP+ TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 138/196 (70%), Gaps = 8/196 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQF+RS KNM+KGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN----ESGF 116
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DEGQIIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXS----NPHDS 172
           D+GQI+RV+A EL S            S+                     S    N   +
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 173 SPSYQDDLEKALEESR 188
              Y DDL+KA+EES+
Sbjct: 181 DDHYDDDLQKAIEESK 196

 Score =  167 bits (424), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 77/93 (82%), Positives = 85/93 (91%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           P+ Q RTGNQ ISDKY++LNTLLATGTGIDTFGNTG+ RIPAQHT TGTFINSQGTGYKQ
Sbjct: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
             N+PKNNPF+SNQYTGLPSTN+VP+ TGYGFG
Sbjct: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  228 bits (582), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/268 (45%), Positives = 156/268 (58%), Gaps = 18/268 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDL 180
           I+RVKA+EL +             +                          +S SY DD+
Sbjct: 121 IVRVKARELTALLQDEERLREERELKGRNRRPRRRK---------------NSDSYDDDM 165

Query: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ++ALEESR+TA QE+ +RRR+L  YD+   D                             
Sbjct: 166 QRALEESRMTAEQEEAERRRKLEMYDNSADDL--QTALQLSKEEEELRRLRELQMQQQMQ 223

Query: 240 XXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                             YYD+FGNPIS
Sbjct: 224 QAQQQMFGLQQQQTQQPMYYDVFGNPIS 251

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 2/91 (2%)

Query: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487
           TRTGNQS++DK+SDLN LLA+GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV+N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 488 P--KNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           P  K+NPFL  QYTGLPST++VP+ TGYGFG
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFG 477

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  224 bits (570), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (91%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN++KGYSSTQV+VR+AT+NDS  P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELVS 131
           IIRVKAKEL S
Sbjct: 121 IIRVKAKELTS 131

 Score =  167 bits (422), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 85/89 (95%)

Query: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487
           TRTGNQ I+DK+ +LN LLA+GTGIDTFGNTGEARIPAQHTKTGTFINSQGTGY+QVTN+
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           PKNNPFL++QYTGLPSTNIVP+ TGYGFG
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  221 bits (562), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 134/193 (69%), Gaps = 15/193 (7%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R+AKN++ GYSS QVLVR+AT+N+   P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDS--SPSYQD 178
           IIRVKAKEL S            +M                       P  S     Y D
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNM-------------RKKRRGKTRRPERSRGGEEYDD 167

Query: 179 DLEKALEESRITA 191
           DL++ALEESR+TA
Sbjct: 168 DLQRALEESRLTA 180

 Score =  157 bits (396), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 84/93 (90%), Gaps = 1/93 (1%)

Query: 425 LKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 484
           L  TRTGNQSIS KY+DLN LLA+GTG+DTFGNTG+ RIPAQHT+TG FINSQGTGYKQV
Sbjct: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430

Query: 485 TN-EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           TN +PKNNPFL+ QYTGLPST++VP+ TGYGFG
Sbjct: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  218 bits (554), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 131/187 (70%), Gaps = 9/187 (4%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN++KGYS T+VLVRDATAN+S  PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDDLEKAL 184
           KAKEL S            +M                     S+         +DL++A+
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSD---------EDLQRAI 171

Query: 185 EESRITA 191
           EES+ TA
Sbjct: 172 EESKRTA 178

 Score =  165 bits (418), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 77/93 (82%), Positives = 85/93 (91%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PL QTR+GNQ+ISDKYS LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V N+ K NPFL+ QYTGLPSTNIVPTQTG+GFG
Sbjct: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  213 bits (542), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 138/208 (66%), Gaps = 13/208 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDD 179
           +I+RVKAKEL +             M                                DD
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKN------------RRDDNEDDDD 168

Query: 180 LEKALEESRITAQEDEQRRRELAQYDDE 207
           L++ALEESRITA+E+E+RR++L    D+
Sbjct: 169 LQRALEESRITAEEEERRRKQLMMQGDD 196

 Score =  157 bits (398), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 72/94 (76%), Positives = 86/94 (91%), Gaps = 1/94 (1%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           P+ + RTGNQSISDK+S+LN LLA+GTGIDTFGNTGE R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414

Query: 484 VTNE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           +TN+ PK+NPFL++QYTG+PS+ I P+ TGYGFG
Sbjct: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  202 bits (515), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 110/127 (86%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN++KGYSSTQ LVRDAT+N    P ID L +LA+ +Y++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WC+EN Y+IKTLREF +E+ESG D+GQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELVS 131
           +AKEL S
Sbjct: 121 RAKELTS 127

 Score =  164 bits (414), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 79/93 (84%), Positives = 85/93 (91%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           PLKQTRTG+QSISDKYS LNTLLATGTGIDTFGNTG  RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 310 PLKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQ 369

Query: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V+    NN FL++QYTGLPS+NIVP+QTGYGFG
Sbjct: 370 VSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFG 402

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  208 bits (529), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 94/131 (71%), Positives = 115/131 (87%), Gaps = 1/131 (0%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS+QFVRSAKN+MKGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAKELV 130
           QI+RVKA++LV
Sbjct: 121 QIVRVKARDLV 131

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 66/96 (68%), Positives = 79/96 (82%), Gaps = 3/96 (3%)

Query: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483
           P+ +  TGNQ +++KYS+LN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549

Query: 484 VTNE---PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
           V +E   P +NPFL++QYTGLPST IVP  TGYGFG
Sbjct: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 31/34 (91%)

Query: 178 DDLEKALEESRITAQEDEQRRRELAQYDDEDPDF 211
           DDL++A+EES+ T QEDE+RRR+L+ YD+EDP+F
Sbjct: 206 DDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEF 239

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  204 bits (518), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 150/268 (55%), Gaps = 14/268 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ +RSAKN+M GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSSPSYQDD 179
           Q+IRVKAKEL++            ++                     +NP    P    D
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNL-------RLGRGKKNPQNVPETNPDGVDP----D 169

Query: 180 LEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L++ALEESRITA E+E+RRR+LA+   ED +                             
Sbjct: 170 LKRALEESRITA-EEEERRRKLAE-KTEDAEELQAALQLSKEEEELRKLRELQQQREQQM 227

Query: 240 XXXXXXXXXXXXXXXXXAYYDIFGNPIS 267
                             YYDIFGNPI+
Sbjct: 228 AFWQQQQVQQVQYQQQPMYYDIFGNPIT 255

 Score =  156 bits (395), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 1/90 (1%)

Query: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487
           TRTGNQSISDKY +LN LLATGTGIDTFGNTG+ARI +QHTKT TFINS GTG+KQV+NE
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 488 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
            PK+NPFL+ QYTGLPSTNIVP+ TGYGFG
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFG 492

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  186 bits (472), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/199 (49%), Positives = 128/199 (64%), Gaps = 26/199 (13%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHDSS----PS 175
           QIIRVKA+ELV+            +M                      NP +      P 
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGR------------------NPRNRQASVPPP 162

Query: 176 YQD---DLEKALEESRITA 191
            +D   DL++ALEESRITA
Sbjct: 163 AEDLDPDLQRALEESRITA 181

 Score =  162 bits (411), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 76/93 (81%), Positives = 87/93 (93%), Gaps = 1/93 (1%)

Query: 425 LKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 484
           L+ TRTGNQSI+DKYS+LNTLLA+GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457

Query: 485 TNE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516
            NE PK+NPF++ QYTGLPSTN+VP+ TGYGFG
Sbjct: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  189 bits (479), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 131/213 (61%), Gaps = 13/213 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELVSXXXXXXXXXXXXSMXXXXXXXXXXXXXXXXXXXXXSNPHD-----SSPS 175
           +IRVKA EL+              M                       PH        P 
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRM--------GPHRRPSMPRRPE 172

Query: 176 YQDDLEKALEESRITAQEDEQRRRELAQYDDED 208
            ++D+++ALEES+ TA+EDE RRR+  + + +D
Sbjct: 173 DEEDVDRALEESKKTAEEDEARRRKDQEREKQD 205

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 61/83 (73%)

Query: 425 LKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 484
           L+   TGN  IS KYS+LN LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 485 TNEPKNNPFLSNQYTGLPSTNIV 507
           T+     P L  QYTGLP+   V
Sbjct: 651 TSSSSPIPLLPTQYTGLPAQTAV 673

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+NM+  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +A ELV
Sbjct: 135 NVRNRAHELV 144

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 75/130 (57%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +A EL 
Sbjct: 135 NVRNRAHELA 144

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R + K LV
Sbjct: 135 NVRTRVKALV 144

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 77/130 (59%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  ++  +  VR+AT N+    S   ++ +AQ +Y+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   R    +++ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKELV 130
            +R +AK++V
Sbjct: 135 NVRNRAKQIV 144

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 78/130 (60%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +AK LV
Sbjct: 135 NVRNRAKLLV 144

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YLV+ GSE  +   R N  ++K L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +A +LV
Sbjct: 135 NVRNRASQLV 144

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ ++  +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +A+ELV
Sbjct: 135 NVRNRAQELV 144

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R + K L+
Sbjct: 135 NVRTRVKTLI 144

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R + K L+
Sbjct: 135 NVRTRVKALI 144

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R + K L+
Sbjct: 135 NVRTRVKALI 144

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 76/131 (58%), Gaps = 1/131 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +L+YL+  G+E  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IIRVKAKELVS 131
            +R +A+ + S
Sbjct: 135 NVRSRAQAMTS 145

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 1/131 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT N+    S   +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KSL + DYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVS 131
            +R KA+ LV+
Sbjct: 135 NVRNKAQSLVA 145

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 74/130 (56%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT N+    S   +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KS+ +L+YLV+ GSE  +   R N  +I+ L  F + +  G D+G 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R + K LV
Sbjct: 135 NVRNRTKALV 144

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 75/130 (57%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           RL +K    WR + K+L +LDYL+R  SE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +AK L 
Sbjct: 135 NVRNRAKALA 144

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 76/131 (58%), Gaps = 1/131 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVS 131
            +R KA+ L +
Sbjct: 135 NVRNKAQSLTA 145

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 76/129 (58%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +AK L
Sbjct: 135 NVRNRAKAL 143

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 78.6 bits (192), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  V+K L+ F + +  G D+G 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R +   L+
Sbjct: 135 NVRNRVTTLI 144

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 75.9 bits (185), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 75/130 (57%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IIRVKAKELV 130
            +R +AK L 
Sbjct: 170 NVRTRAKALT 179

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IIR 123
            +R
Sbjct: 135 NVR 137

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+S       +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KS+ +L+YL+  GSE  +   R    +IK L  F + +  G D+G 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELV 130
            +R + + LV
Sbjct: 135 NVRNRTQALV 144

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 66/112 (58%), Gaps = 12/112 (10%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+RS +NM  G S+T+V V+ AT +D  + +   L ++++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREF 108
           +  G Y +       H+ K+LT++ YL+  GS + V W R+  Y++ TLREF
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 62/110 (56%), Gaps = 8/110 (7%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
            +++ +N+  G SST+V  R+AT +D    +  +L ++L+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREF 108
           +        K   H+ K+LT++ YL+  GS+  V+W R   Y+I TL+EF
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 66/130 (50%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR+AT ND    S+  +  +   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KS+ +L YL+  GS   V   + N  +IK L  F   ++ G+++  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IIRVKAKELV 130
            I    + L+
Sbjct: 135 KISKATERLI 144

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 66/121 (54%), Gaps = 6/121 (4%)

Query: 17  SSTQVLVRDAT-ANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKG-----KYW 70
           S+T++ V+ AT  N+S   +   +++++  +Y      EI+ ++ KRL   G     K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKELV 130
            H+ K+LT++ YL+  GS + + W R N  ++  L+EF  ++ +    GQ IR  +++L 
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIRAMSQDLC 132

Query: 131 S 131
           +
Sbjct: 133 T 133

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 6/98 (6%)

Query: 15  GYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRH- 72
           G SST++ VR AT  D +T +  TL ++++  +Y      EI  +L +RL+  G+   H 
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTSHK 70

Query: 73  ----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLR 106
               + K+LT++ YL+  GSE  V W R N    + L+
Sbjct: 71  NSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 64/119 (53%), Gaps = 10/119 (8%)

Query: 8   SAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N ++  S+T+  V++AT ++  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR--HENESGFDE 118
            K        H+ K++T++ YL+  GS + + W R N  + + L++F   HE++    E
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAE 122

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 73/138 (52%), Gaps = 15/138 (10%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+ S +++  G SST V V+ AT +     +  +L +++A  +Y      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRH---ENE 113
              G Y +       ++ K+LT++ +LV  GSE C+ W R +  +I++ ++F     E +
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKK 118

Query: 114 SGFDEGQIIRVKAKELVS 131
              ++ Q++  K  +L++
Sbjct: 119 QMVNQIQLLSCKLCQLLT 136

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 67/120 (55%), Gaps = 10/120 (8%)

Query: 15  GYSSTQVLVRDAT-ANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT +N+S   +   +++L+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKA 126
                 V K+LT+++YL+  GSE  VLW R +   I+ L+++   N+   D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK--DKSKVKQIKS 128

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 62/121 (51%), Gaps = 8/121 (6%)

Query: 8   SAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL--- 63
           S +N ++  S T+  VR AT +D  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 64  --NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
              +  K   H+ K+LT++ YL+  GS + + W R N  + + L+ F  +N      GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 I 122
           I
Sbjct: 124 I 124

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 6/100 (6%)

Query: 15  GYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL---NDKGKYW 70
           G S T++  ++AT +D  + +  +L ++++  +Y S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREF 108
              H+ K+LT+  YL+  GS   V W R   Y+I +L+EF
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   + +  DF+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R GS++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGSKDVALRYYSRNLEFFDIENIR 92

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 68/126 (53%), Gaps = 10/126 (7%)

Query: 8   SAKNMMKGY--SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT ++    +  TL ++++  +Y      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEG 119
                +  +   HV K+LT++ YL+  GS + + W + + YVI+ L  F  E +S  DE 
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF--EAQSSSDEP 119

Query: 120 QIIRVK 125
            + +++
Sbjct: 120 MVNQIR 125

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 8/107 (7%)

Query: 8   SAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N ++  S T++ VR AT ++  + +  TL ++++  +Y +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREF 108
           GK        H+ K+LT++ YL+  GS   + W  EN  + + ++ F
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNF 110

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   +    DF+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G ++  L  + R   F+ I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   + DS +F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            ++R G  +  +    +      LR+  H   S  D
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFHSKLSSGD 100

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   +    DF+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G+++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGAKDVALRYYSRNLEFFDIENIR 92

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 6/115 (5%)

Query: 15  GYSSTQVLVRDATA-NDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S   + ++   +Y      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIR 123
              H+ K+LT+ +YL+  GSE+ V W +    +++ L++F   NE        IR
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIR 125

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 7/120 (5%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L +F+ ++      G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRH--- 72
           S T+  V+ AT  D    +  TL ++++  +Y      EI+ +L KRL+   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTL 105
             + K+LT++ YL+  GS   V W R N  +I  L
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNL 107

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 14/137 (10%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F  S +N++  YS T++ VR AT  +    S  TL ++++  +Y +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN 112
                  N  G    K    V K+ T++ YL+  GS + + W + N  V++ L +    N
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 113 ESGFDEGQIIRVKAKEL 129
               DE   I  +A+++
Sbjct: 121 HITDDEDLHILNQAQKI 137

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   Q+ +R AT  DS  P+   LD +     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V KSL VL +L+
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 9/96 (9%)

Query: 19  TQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLND---KGKYWRH-- 72
           T+  V+ AT ++  T +  TL ++++  +Y      +I+ ++ KRL+      K   H  
Sbjct: 15  TESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSHKT 74

Query: 73  ---VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTL 105
              + K+LT++ YL+  GS   + W R NFY+++ +
Sbjct: 75  SVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENI 110

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +I+ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREF 108
              V K+LT++ YL+  GS   + W + N  +I+ L  F
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENF 111

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT  DS  P+   L+ + +  Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +++ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQ 112

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 50/120 (41%), Gaps = 20/120 (16%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   S D  DF EI+  L  R++D    W  V KSL V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  YLVRFGSENCVLWCREN---FYVIKTLREFRHENESGFDEG---------QIIRVKAKEL 129
            L+R G ++  L    N   F+ +  +      N S F  G         Q + V+AKE 
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGI------NTSKFSSGDVRALERYNQYLLVRAKEF 118

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  WR V K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa]
           {ON} Anc_5.84 YGR241C
          Length = 632

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    ++ +   + D  DF EI+  L  R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKLAPPKDKYIEPILMGTNDPHDFREIVKALHSRVNDSA--WTVVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            L+R G  +  +    N      L    H N S  D
Sbjct: 65  VLMREGDRDVAIKYFSNNLNYFGLAGIHHSNFSNGD 100

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 50/119 (42%), Gaps = 24/119 (20%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ +R AT  D+  P+   L  + +  Y SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENFYVI 102
                              G  WR + K L V++YL+   SE    N V  C EN   I
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQI 138

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT  DS  P+   L  + +  Y  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT  DS  P+   L  + +  Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV----RFGSENCVLWC 95
                               G  WR V K L +L+YL+    R    + VL C
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSC 131

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ VR AT  D+  P+   L+ + +  +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR V K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT      P    +D +   +    DF EI+  L  R+ D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRFGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A+  D+  P+   L  + +  Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}
           Anc_8.863 YML088W
          Length = 637

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 178 DDLEKALEESRITAQEDEQRRRELAQYDDED 208
           DDLE+A+EESR+ AQE++Q     A  DDED
Sbjct: 548 DDLERAIEESRL-AQENQQFVESFADEDDED 577

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 17 SSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKS 76
          +S + LV+ AT      P    +D +   + ++++F +I+  L  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,744,733
Number of extensions: 1273829
Number of successful extensions: 4314
Number of sequences better than 10.0: 89
Number of HSP's gapped: 4351
Number of HSP's successfully gapped: 141
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)