Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR205C (HMX1)7.344ON31731716890.0
Skud_12.2687.344ON31831815430.0
Smik_12.2637.344ON31831815340.0
Suva_10.2997.344ON32032015080.0
KLLA0D12474g7.344ON31230710071e-137
TDEL0C020307.344ON3113069951e-135
ZYRO0F11594g7.344ON3092719521e-129
SAKL0F11242g7.344ON3093079421e-127
Kwal_56.246247.344ON3073089171e-123
KLTH0H01386g7.344ON3073078971e-120
NCAS0E028907.344ON3153168891e-119
Ecym_47297.344ON3263198681e-116
NDAI0E045007.344ON3273317891e-104
Kpol_530.367.344ON3113147548e-99
TPHA0F029207.344ON3202887281e-94
CAGL0A03905g7.344ON2822637162e-93
ACL154W7.344ON3192776792e-87
KAFR0L014707.344ON3003076373e-81
KNAG0B026407.344ON3023105871e-73
KNAG0M008106.115ON117477721.7
TPHA0B014607.448ON48591721.8
YPL058C (PDR12)8.517ON151132702.9
Smik_16.1798.517ON151132702.9
Skud_16.2258.517ON151132703.0
Skud_6.638.67ON78158703.2
NDAI0B027703.116ON10144653.8
Suva_6.518.67ON76357686.0
TDEL0D012101.256ON77268668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR205C
         (317 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   655   0.0  
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   598   0.0  
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   595   0.0  
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   585   0.0  
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   392   e-137
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   387   e-135
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   371   e-129
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   367   e-127
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   357   e-123
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   350   e-120
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   347   e-119
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   338   e-116
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   308   e-104
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   295   8e-99
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   285   1e-94
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   280   2e-93
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   266   2e-87
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   249   3e-81
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   230   1e-73
KNAG0M00810 Chr13 (138732..142256) [3525 bp, 1174 aa] {ON} Anc_6...    32   1.7  
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    32   1.8  
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    32   2.9  
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    32   2.9  
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    32   3.0  
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    32   3.2  
NDAI0B02770 Chr2 (697765..698070) [306 bp, 101 aa] {ON} Anc_3.11...    30   3.8  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    31   6.0  
TDEL0D01210 Chr4 complement(225620..227938) [2319 bp, 772 aa] {O...    30   8.3  

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/317 (100%), Positives = 317/317 (100%)

Query: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL
Sbjct: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240
           PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300
           EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300

Query: 301 IAIWVLYFLVKSFLSIV 317
           IAIWVLYFLVKSFLSIV
Sbjct: 301 IAIWVLYFLVKSFLSIV 317

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/318 (90%), Positives = 306/318 (96%), Gaps = 1/318 (0%)

Query: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           MEDS+NTIIPSPTDVGALANRINF TRDAHNKINTFMGI+MAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VFDAIEQEIDRLL+DPVTE+ELQTSTILKQFWLEDFRRSTQIYKDLKLLYSN FKSTESL
Sbjct: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120

Query: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLA F+KPPLLQQF+N+IHENI KEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240
           PNFE+LSQKELVKKGTNFFTFSDLGPTEETRLK EYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300
            GIFDWNF+IVAEIGELNRRELMGKFSFKC+TY+YEEWM +KDSA R+A +T MLL+LSI
Sbjct: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300

Query: 301 IAIWVLYFLV-KSFLSIV 317
           IA+WV+Y LV K+FLSIV
Sbjct: 301 IAVWVIYLLVKKNFLSIV 318

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/318 (92%), Positives = 309/318 (97%), Gaps = 1/318 (0%)

Query: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           MEDS+N IIPSPTD+GALANRINF TRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VFDAIEQEIDRLLNDPVT +ELQTS ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL
Sbjct: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLATF+KPP+LQQF+NNIHENI KEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240
           PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLK EYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300
           EGIFDWNFNIVAEIGELNRRELMGKFSFKC+TY+YEEWMFNK+SATR++ +TV+LL+LSI
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI 300

Query: 301 IAIWVLYFLV-KSFLSIV 317
           IAIW LYFLV KSFLSIV
Sbjct: 301 IAIWTLYFLVKKSFLSIV 318

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/320 (86%), Positives = 304/320 (95%), Gaps = 3/320 (0%)

Query: 1   MEDSSNT--IIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY 58
           MEDS++T  IIPSPTD+GALANRINF TRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY
Sbjct: 1   MEDSTSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY 60

Query: 59  YYVFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 118
           YYVFDAIEQEIDRLLND V+E+ELQ   ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE
Sbjct: 61  YYVFDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 120

Query: 119 SLNEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 178
           SLNEFLATF+KPPLLQQF+++IH+NI +EPCTILSYCHVLYLALFAGGKLIRSNLYRRLG
Sbjct: 121 SLNEFLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 180

Query: 179 LFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIIS 238
           LFPNFEKL+QKELVKKGTNFFTFS+LGPTEETRLKWEYKKNYELATRTELTEAQKL+IIS
Sbjct: 181 LFPNFEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIIS 240

Query: 239 VAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVL 298
           VAEGIFDWNFNIVAEIGELNRRELM KFSFKC+TY+YEEWMF+K SA+R+A  T MLL+L
Sbjct: 241 VAEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLML 300

Query: 299 SIIAIWVLYFLVK-SFLSIV 317
           SI A+W+LY+ V+ +FLS+V
Sbjct: 301 SITAVWILYYFVRQNFLSVV 320

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 237/307 (77%), Gaps = 1/307 (0%)

Query: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           M     T IPSPTDVGALANRINFQTRD HNKIN +M +KMA AMRHGFIYRQGI+AYYY
Sbjct: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VF AIEQEIDRLL  PVT ++ +   IL+QFW E+FRRS ++  DL++LY++ +  +E L
Sbjct: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120

Query: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
            EFL  FQ P  LQ+F++ IH N+ KEP TIL+YCHVLYLALFAGG++++SNLYR +GLF
Sbjct: 121 QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240
           P F  LS KELV++ TNFFTFS+ G  +E RL+W+YKK YELATRTELTEA+KL+II V+
Sbjct: 181 PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVS 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFN-KDSATRRALHTVMLLVLS 299
           + IF  N  +VAEIGE+NR ELMGKFS+K I++L EEW ++ K +   + L    L+V +
Sbjct: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFN 300

Query: 300 IIAIWVL 306
           ++ ++ +
Sbjct: 301 MVFVYTI 307

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 174/306 (56%), Positives = 235/306 (76%), Gaps = 2/306 (0%)

Query: 9   IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IP+PTDVGALANRINF TRDAHNK+N +M +++A A++HGFIYRQGILA+Y++FDA+EQE
Sbjct: 8   IPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQE 67

Query: 69  IDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQ 128
           +DRLLNDP  +EE Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F+    
Sbjct: 68  LDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQP 127

Query: 129 KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188
             P LQ F+++IH  + ++ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP FE L+ 
Sbjct: 128 LAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTP 187

Query: 189 KELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248
           KELV +GTNFFTFSD G   E +L+W+YK+ YELATR EL+E+QK +I+ V+  IFDWN 
Sbjct: 188 KELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNM 247

Query: 249 NIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVLYF 308
           +++ EIGE+NR ELM KFSFK +TYL EEW ++   + R     +++ +L  I   V Y 
Sbjct: 248 DVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAIL--IQFLVAYI 305

Query: 309 LVKSFL 314
           +++ F+
Sbjct: 306 VLRKFI 311

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  371 bits (952), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 216/271 (79%), Gaps = 1/271 (0%)

Query: 9   IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IP+PTDVGALANRINF TRDAHNKIN +M +++A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63

Query: 69  IDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQ 128
           +DR+++    E+E+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL +  
Sbjct: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123

Query: 129 K-PPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLS 187
              P LQ F+++IH+N+ +EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ LS
Sbjct: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183

Query: 188 QKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWN 247
            +ELV++GTNFFTFS+ G   E +L+W YK+ YELATR ELTE QK +IISV+  IF WN
Sbjct: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243

Query: 248 FNIVAEIGELNRRELMGKFSFKCITYLYEEW 278
              +AEIGELNR+ELMG  SF+ +TYL+EEW
Sbjct: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEW 274

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 229/307 (74%), Gaps = 2/307 (0%)

Query: 5   SNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDA 64
           S T IPSPTDVGALANRINF TRD+HNKIN  M +K+A AM+HG IYRQGILA+YY+F A
Sbjct: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61

Query: 65  IEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFL 124
           +EQEID LL +  T  ELQT  IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL
Sbjct: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121

Query: 125 ATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184
                PP  Q F+  IH+ + ++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+
Sbjct: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181

Query: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIF 244
            L+ +++V++GTNFFTFS+ G   E +L+WEYKK YELATR ELTE QK +II V+  IF
Sbjct: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241

Query: 245 DWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIW 304
           DWN +++ E+GE+NR ELMGKFSFK ++++ EEW +++  +    +   +L++ +I+   
Sbjct: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKI--TILVIFAILQFL 299

Query: 305 VLYFLVK 311
           + Y+L++
Sbjct: 300 LAYWLLR 306

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 227/308 (73%), Gaps = 2/308 (0%)

Query: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66
           + IPSPTDVGALANRINF TRD HNKI+  M +K A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 2   STIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIE 61

Query: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126
           QEIDRLL +  T EE+QT  IL QFW+  F R+ +IY+DLKLLY+  F S E L+ FL  
Sbjct: 62  QEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQ 121

Query: 127 FQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL 186
              PP  Q F++ +HE++   P +IL++CHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 122 NTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDL 181

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246
           + +E+V+KGTNFFTFSD G   E +L+ EYK+ YELATR  LTE QKL I+ VA   F+W
Sbjct: 182 TPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEW 241

Query: 247 NFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVL 306
           N  +++EIGE+NR+ELMGK SFK +++  +EW  + +  TRR   +++L   ++I I V+
Sbjct: 242 NTRVISEIGEINRQELMGKLSFKLVSFAIDEWK-HTEKLTRRQ-KSIVLATGAVIQILVM 299

Query: 307 YFLVKSFL 314
           Y++++ FL
Sbjct: 300 YWMLRKFL 307

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 222/307 (72%), Gaps = 2/307 (0%)

Query: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66
           T IPSPTDVGALANRINF TRD HNKI+  M  K A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61

Query: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126
           QE+DRL  +  T EE QT  IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL  
Sbjct: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121

Query: 127 FQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL 186
               P LQ F++ +H +I   P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246
           + +E+V++GTNFFTFSD G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+W
Sbjct: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241

Query: 247 NFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVL 306
           N  +V EIGE+NR+ELMGK SF+ +T++ EEW ++ D  TR+   +++L    ++ I ++
Sbjct: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYS-DKLTRKQ-KSLVLATGVVLQILMM 299

Query: 307 YFLVKSF 313
           Y++++ F
Sbjct: 300 YWVLRKF 306

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  347 bits (889), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 222/316 (70%), Gaps = 3/316 (0%)

Query: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           M   +NTIIPSPTD  ALANRINFQTRDAHNKIN  M IK+AIA+RHGFIYRQGIL YYY
Sbjct: 1   MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           +F  +E+EI +L   P T EE++   +L + W+ +F R+  + KDL+LLY + + + E+L
Sbjct: 61  IFKVVEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEAL 120

Query: 121 NEFLAT--FQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 178
             FL T   + PP+L  FI  IH++I + PC+I +YCHVLYLALFAGGK+IRS +Y+ LG
Sbjct: 121 QLFLETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLG 180

Query: 179 LFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIIS 238
             PNF  LS KE+ +KGTNFF F   G  EET+LK E+KKNYEL TR  L E +K  II 
Sbjct: 181 FLPNFNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIE 240

Query: 239 VAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVL 298
            ++ IFD+N   + E+G +N+ +LM K +FK +TYL EEW FN +  ++R  H +M +V+
Sbjct: 241 TSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIM-VVM 299

Query: 299 SIIAIWVLYFLVKSFL 314
            ++ +   +F++K FL
Sbjct: 300 VLLHMLFAFFILKRFL 315

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 223/319 (69%), Gaps = 9/319 (2%)

Query: 1   MEDSSNTI-------IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQ 53
           M DS + I       IPSPTDVGALANRINF TRD H K + F+  KMA+AMRHGFIYRQ
Sbjct: 7   MNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQ 66

Query: 54  GILAYYYVFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNT 113
           GILA+YY+F A+EQ+IDRLL  P T+EELQ S IL+QFW E+FRRS ++ +DL+  Y + 
Sbjct: 67  GILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE 126

Query: 114 FKSTESLNEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNL 173
           + +   L +FL  F+ PP LQ+F++ I +   + P TIL+YCHVLY ALFAGGK++RSN+
Sbjct: 127 YPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNI 186

Query: 174 YRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQK 233
           YR +GLFP  + +S  E  + GTNFFTFSD G  EE +L+W+YKKNYELATR  L E QK
Sbjct: 187 YRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQK 246

Query: 234 LQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTV 293
           L+II V+   F    +I+ EIGE N++ELM  FSFK +T+L  EW +N+  ++   +   
Sbjct: 247 LEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE--VKQA 304

Query: 294 MLLVLSIIAIWVLYFLVKS 312
           + + +  I   ++YF +++
Sbjct: 305 LAIAVFFINFLMIYFTLRT 323

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  308 bits (789), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 219/331 (66%), Gaps = 20/331 (6%)

Query: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           M  S+ TIIPSPTD  ALANRINF TRDAHNKI+  M +K+A+A+RHG IYRQGIL YYY
Sbjct: 1   MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYY 60

Query: 61  VFDAIEQEIDRLL--NDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 118
           +F A+E EI+ LL  N   T+E+ +T ++L + WL +F R+ +++KDLKLLYS+ F++ +
Sbjct: 61  IFQAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQ 120

Query: 119 SLNEF------LATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSN 172
            L  F      L    K   L QF+N IH +I   PC IL+YCHVLYLALFAGGK+I+S 
Sbjct: 121 DLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSK 180

Query: 173 LYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGP--------TEETRLKWEYKKNYELAT 224
           +Y+ LG  PNF  LS KEL    TNFF F++           + E +LK ++K+N+EL T
Sbjct: 181 IYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNT 240

Query: 225 RTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDS 284
           R+ L E +KL II +A+ IF WN   + E+G+ N++ELM  FSFK I YL+EEW FN   
Sbjct: 241 RSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN--D 298

Query: 285 ATRRALHTVMLLVLSIIAIWVLYFLVKSFLS 315
           + ++    +++ V  I+ + + +F+ +S  +
Sbjct: 299 SIKKNFKAILMFV--ILLLLIQFFVSRSLFT 327

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  295 bits (754), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 216/314 (68%), Gaps = 11/314 (3%)

Query: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66
           + IPSPTDVGALANRINF+TRD HNK++ FMGI++A+A++HGFIYR+G++ +Y++F+ IE
Sbjct: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62

Query: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE-SLNEFLA 125
            EID +LN+   +++ Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ 
Sbjct: 63  TEIDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119

Query: 126 TFQ---KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPN 182
           + +       LQ F+  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP 
Sbjct: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179

Query: 183 FEKLSQKELVKKGTNFFTFSDLGPTEET--RLKWEYKKNYELATRTELTEAQKLQIISVA 240
           FE LS KE++ +GTNF+ F+D    E T  +L+W YKKNYEL+TR EL E QKL +I  +
Sbjct: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300
           + +F    N +AE+G  NR ELM  FS+K  T++ EEW +N  S+    L   ++ +L I
Sbjct: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYN--SSISPFLKKSLMFILII 297

Query: 301 IAIWVLYFLVKSFL 314
           I   +   L+  ++
Sbjct: 298 IQFTLASVLLNRYI 311

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  285 bits (728), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 146/288 (50%), Positives = 203/288 (70%), Gaps = 9/288 (3%)

Query: 4   SSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFD 63
           S+  IIPSPTDV ALANRINF+TRD HNKI  FM I++A+A+RHGFIYRQG++A+Y++F 
Sbjct: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61

Query: 64  AIEQEIDRLLNDPVTE---EELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKST-ES 119
            IE EID LLN   +E    ++QT  ILK F++ +FRR   + +DL +LY   FK   + 
Sbjct: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121

Query: 120 LNEFL--ATFQKP--PLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYR 175
           + +FL   TF K   P L  F + I +   ++P TI++YCHVLYLALFAGGK+++SN+ +
Sbjct: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181

Query: 176 RLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTE-ETRLKWEYKKNYELATRTELTEAQKL 234
            +GLFP F+ +S +E+  +G+NFF F+     + +++L++EYKKNYEL+TR EL E QK 
Sbjct: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241

Query: 235 QIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNK 282
            II V++ IF    N++AEIG  NR +LMG F+ K ITYL EEW +N+
Sbjct: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNE 289

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  280 bits (716), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 183/263 (69%), Gaps = 12/263 (4%)

Query: 37  MGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTEEELQTST 86
           M ++ A+A+RHG +YRQGILA+YYVF AIEQEID LL+            V++++L  S 
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 87  ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQKPPLLQQFINNIHENIHK 146
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   Q PP LQ F++ +H  + +
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 147 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGP 206
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE LS KEL +KGTNFFTFSD G 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 207 TEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKF 266
             E +LKW+YKKNYELATR  L E  KL+II VA+ IF+ N +I+ EIG+LN+  L    
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239

Query: 267 SFKCITYLYEEWMF-NKDSATRR 288
               + Y++EE  F NKD + ++
Sbjct: 240 KLDLLQYVFEELKFYNKDRSHQQ 262

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  266 bits (679), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 185/277 (66%), Gaps = 1/277 (0%)

Query: 5   SNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDA 64
           ++ ++P PTD GALANRINF TR+ H+K + F+  K A+A+RH  IYRQG+LA YY+F +
Sbjct: 14  ASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRS 73

Query: 65  IEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFL 124
           +EQ IDRLL  P T +E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL
Sbjct: 74  VEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133

Query: 125 ATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184
            +++ PP L   + +I     ++P TIL++CHVLYLALFAGG+++RS L R+LGL P   
Sbjct: 134 DSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAA 193

Query: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIF 244
            LS +E   +GT+FFTF   G  EE + +  YK+ YELATRT L+EA+K  +I  A   F
Sbjct: 194 GLSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADF 252

Query: 245 DWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFN 281
           D    ++AE+   NR+EL+G  S++ +T+L EEW + 
Sbjct: 253 DHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  249 bits (637), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 195/307 (63%), Gaps = 18/307 (5%)

Query: 9   IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           +PSPTD  ALANRINF TRD HN I+  M IK   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 69  IDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQ 128
           ID +    ++ +      IL+ F+ + FRR  QI KDLK L  N  +  +S +++L++  
Sbjct: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLSS-- 115

Query: 129 KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFEKL 186
             P L +F+N I  N+H+ P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+K+
Sbjct: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246
           S  +++   TNFF F D     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233

Query: 247 NFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVL 306
           NFN++ EIG +N+ ELM  F++K +TY+ EEW F K    +      ++L L I  ++V 
Sbjct: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKK-----YVILFLIIFHLFVF 288

Query: 307 YFLVKSF 313
             L K F
Sbjct: 289 INLFKKF 295

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  230 bits (587), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 180/310 (58%), Gaps = 19/310 (6%)

Query: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66
           + IPSPTD  ALANRINF TRD HN+++    +K  +A+RH FIY   +  +Y VF  +E
Sbjct: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62

Query: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126
           Q ID L+    +E       IL +F++ +FRR+ +I +DL  L    + + ES       
Sbjct: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQ 112

Query: 127 FQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF--- 183
           +  PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF   
Sbjct: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172

Query: 184 ----EKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISV 239
               E++S   LV   TNFF F++    +E +L+W YK+NYELATR  LTE QKL +I+ 
Sbjct: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231

Query: 240 AEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLS 299
           +  +F   F ++ EI + N  ELM   SFK +TY  EEW FNK+   R  L  V  L   
Sbjct: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKN-FKRGVLWGVAFLAQF 290

Query: 300 IIAIWVLYFL 309
           +  +    FL
Sbjct: 291 LFVVLYCCFL 300

>KNAG0M00810 Chr13 (138732..142256) [3525 bp, 1174 aa] {ON} Anc_6.115
            YBR218C
          Length = 1174

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 46   RHGFIYRQGILAYYYVFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKD 105
            R     R G+    +  DAI ++++      + E ++ +  +  + + EDF+++ ++Y D
Sbjct: 962  RRKLTCRPGLELAPFDLDAIREDLNSRFGSDIDECDVASYNMYPKVY-EDFQKTRELYGD 1020

Query: 106  LKLLYSNTFKSTESLNE 122
            L +L +  F +  ++ E
Sbjct: 1021 LSVLPTKNFLAPAAIGE 1037

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 15/91 (16%)

Query: 48  GFIYRQGILAYYYVFDAIEQEIDRLLNDPVTE------EELQTSTIL---KQFWLEDFRR 98
           G + + GIL   +  D ++ E+++++N+ + E      +E + ST +    Q W++DF+R
Sbjct: 171 GILIKNGILKSKFGGDFLDFEVNKIINEKIKESDKEEMDEDKKSTEMWLESQTWIKDFKR 230

Query: 99  STQIYKDLKLLYSNTFKSTESLNEFLATFQK 129
           S     D  L      + TE +N+     QK
Sbjct: 231 SMIQVSDRSL------EETERINKEQIELQK 255

>YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}
            PDR12Plasma membrane ATP-binding cassette (ABC)
            transporter, weak-acid-inducible multidrug transporter
            required for weak organic acid resistance; induced by
            sorbate and benzoate and regulated by War1p; mutants
            exhibit sorbate hypersensitivity
          Length = 1511

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 183  FEKLSQKELVKKGTNFFTFSDLGPTEETRLKW 214
            FE+  +  L+KKG     F D+GP  ET LK+
Sbjct: 1048 FEQFDRLLLLKKGGKMVYFGDIGPNSETLLKY 1079

>Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] {ON}
            YPL058C (REAL)
          Length = 1511

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 183  FEKLSQKELVKKGTNFFTFSDLGPTEETRLKW 214
            FE+  +  L+KKG     F D+GP  ET LK+
Sbjct: 1048 FEQFDRLLLLKKGGKMVYFGDIGPNSETLLKY 1079

>Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] {ON}
            YPL058C (REAL)
          Length = 1511

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 183  FEKLSQKELVKKGTNFFTFSDLGPTEETRLKW 214
            FE+  +  L+KKG     F D+GP  ET LK+
Sbjct: 1048 FEQFDRLLLLKKGGKMVYFGDIGPNSETLLKY 1079

>Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W
           (REAL)
          Length = 781

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 80  EELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQK--PPLLQQ 135
           E++  S  + Q W +  R+ST ++K  KLL S  F S +S N F     +  P LLQQ
Sbjct: 294 EDIINSLGVSQNWNKIIRKSTSLWK--KLLISENFVSPKSFNHFNLKLSERYPKLLQQ 349

>NDAI0B02770 Chr2 (697765..698070) [306 bp, 101 aa] {ON} Anc_3.116
           YOL086W-A
          Length = 101

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 27/44 (61%)

Query: 100 TQIYKDLKLLYSNTFKSTESLNEFLATFQKPPLLQQFINNIHEN 143
           T I  DL+L  ++  + T + ++ +   +K PLLQ+ ++N++ N
Sbjct: 54  TDIGTDLELFANHAGRGTITRDDLMLLLRKTPLLQEMVSNLNMN 97

>Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)
          Length = 763

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 80  EELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF-LATFQKPPLLQQ 135
           +++  S  + Q W +  ++ST ++K  KLL S  F S+ES N F L   +K P L Q
Sbjct: 277 DDIINSLRVSQSWNKVIKKSTSLWK--KLLVSENFVSSESFNSFNLKLSEKYPKLPQ 331

>TDEL0D01210 Chr4 complement(225620..227938) [2319 bp, 772 aa] {ON}
           Anc_1.256 YJL105W
          Length = 772

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 99  STQIYKDLKLLYSNTFKSTESLNEFLATFQK-PPLLQQFINNIHENIHKEPCTILSYCHV 157
           S  +YK +K   +N +K  E LN++    ++ PP+L +    + EN  + P  +  Y + 
Sbjct: 558 SQSLYKTVKSKMNNRYKLNEILNQYQGKKRRQPPILSRMAKEVLENEERAPKVLADY-NE 616

Query: 158 LYLALFAG 165
             LA+  G
Sbjct: 617 KKLAITCG 624

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,499,879
Number of extensions: 1480636
Number of successful extensions: 6123
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6312
Number of HSP's successfully gapped: 44
Length of query: 317
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 208
Effective length of database: 40,982,805
Effective search space: 8524423440
Effective search space used: 8524423440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 66 (30.0 bits)