Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR203C (MSS51)7.346ON43643622930.0
Smik_12.2617.346ON43643622220.0
Suva_10.2977.346ON43643621920.0
Skud_12.2667.346ON43643621860.0
TDEL0C020207.346ON42540217790.0
Kpol_530.357.346ON42540417530.0
NCAS0E028807.346ON42941417470.0
SAKL0F11286g7.346ON42340217440.0
TPHA0F029307.346ON43643817430.0
CAGL0A03927g7.346ON43741717220.0
KLTH0H01342g7.346ON42240216940.0
Kwal_56.246317.346ON42240216860.0
ZYRO0F11616g7.346ON41541016550.0
KNAG0B026307.346ON43841216510.0
NDAI0E044807.346ON44341116460.0
Ecym_47277.346ON42940816330.0
KLLA0D12430g7.346ON41840216230.0
NCAS0A141207.346ON42742615460.0
TBLA0E005007.346ON43742115270.0
KAFR0B008407.346ON42642515140.0
NDAI0A019307.346ON45041715040.0
ACL152W7.346ON42840215000.0
KNAG0C037507.346ON42440814800.0
KLTH0G11418g8.357ON897103751.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR203C
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   887   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   860   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   848   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   846   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   689   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   679   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   677   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   676   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   676   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   667   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   657   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   654   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   642   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   640   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   638   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   633   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   629   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   600   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   592   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   587   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   583   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   582   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   574   0.0  
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    33   1.1  

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 424/436 (97%)

Query: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNR 60
           MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGL            NR
Sbjct: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET
Sbjct: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/436 (93%), Positives = 417/436 (95%)

Query: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNR 60
           MT LY PSGATQLY HLLR+S HNRLV+SHQTRRHLMGFVRNALGL            NR
Sbjct: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQ QGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSL T TKNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQ+FEIHFIGPECLYKRDKQEYVKSTTPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           VDETLKFI+RT+FFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET
Sbjct: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLTDD+NLVKSKYGKEMD+LM+PV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/436 (91%), Positives = 412/436 (94%)

Query: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNR 60
           MT LYAPSGA QLY HLLR+SP NRLVVSHQTRRHLMGFVRNALGL            NR
Sbjct: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLF YTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+  TT+NR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQ+FEIHFIGPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           +DETLKF + T+FF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM ALLET
Sbjct: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360

Query: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DDINLVKSKYGKEMD+LM+PV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/436 (91%), Positives = 413/436 (94%)

Query: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNR 60
           MT LYAPSGA Q+Y HLLR+SP+NRLVV HQTRRHLMGFVRNALGL            NR
Sbjct: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDK YHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240
           AVTKMLSYPITIGS+LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+  TTKNR
Sbjct: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQ+FEIHF+GPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           VDETL+FI+ T+FF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM+ALLET
Sbjct: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360

Query: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DDIN VKSKYGKEMD+LM+PVRNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/402 (78%), Positives = 355/402 (88%), Gaps = 1/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR ++GFVRNALGL            NRFHPWDQSP  DLRERAA+IRTLA CPVTGK+I
Sbjct: 24  RRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I S+LH+FSPYSLNPKGP+TL
Sbjct: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203

Query: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272
           EGLKSLAALRYTLYPLEN+++ ++TK+R MRIFILGARAEAQLPGHVWKQLQ+LFPEQ F
Sbjct: 204 EGLKSLAALRYTLYPLENKTI-SSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332
           E+HF+GPECL  ++K +YV S+TPVV+RVDET+ F+Y T+FF V HEAQDFFPYDPY+DV
Sbjct: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392
           FF FHPG+ +PE+  SW+ ETMK LLETKCAIFTTGFNK DL  D++ VK KYGKE+DVL
Sbjct: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382

Query: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           MEPV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/404 (77%), Positives = 356/404 (88%), Gaps = 2/404 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +R LMGFVRNALGL            NRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 21  KRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ +NLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLH+FSPYSLNPKGP+TL
Sbjct: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200

Query: 213 EGLKSLAALRYTLYPLENRS--LPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270
           EGLKSLAALRYTLYP +N+S  +   T++R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260

Query: 271 SFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYM 330
            FEIHFIGPEC   ++K +Y+ S+TP+V++VD+TLK ++  ++F VFHEAQDFFPYDP++
Sbjct: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320

Query: 331 DVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMD 390
           DVFFTFHPGYA PE+   W+GETMKALL+TKCAIFTTGF+K+DL  DI++VK++YG E+D
Sbjct: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380

Query: 391 VLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           +LM+PV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/414 (75%), Positives = 353/414 (85%)

Query: 22  PHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRT 81
           P N   V+    RHLMGFVRNALGL            NRFHPWDQSPS DLRERAA+IRT
Sbjct: 16  PRNAFNVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRT 75

Query: 82  LAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPF 141
           LA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLRSGRPF
Sbjct: 76  LARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPF 135

Query: 142 PEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSP 201
           PEFDFP+ QG D+ VN+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSP
Sbjct: 136 PEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSP 195

Query: 202 YSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWK 261
           YSL PKGPI+LEGLKSLAALRYTLYP++NR + +TTK R MRIFILGARAE+QLPGHVWK
Sbjct: 196 YSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWK 255

Query: 262 QLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQ 321
           QLQ+LFPEQ+FEIHFIGPE  Y +DK++Y++ TTP+ + VDETLK IY T +F   HEAQ
Sbjct: 256 QLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQ 315

Query: 322 DFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLV 381
           DFFPYDPYMDVFF FHPG+AS E    WM +TMK LL+TKCAIFTTGF K DL +DI +V
Sbjct: 316 DFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVV 375

Query: 382 KSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           + KYGKE+D+LM+P +NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 376 QDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/402 (76%), Positives = 348/402 (86%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH++GFVRNALGL            NRFHPWDQSPS DLR RAA IR LA CPVTGK+I
Sbjct: 21  KRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPITL
Sbjct: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200

Query: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272
           EGLKSLAALRYTLYP ++R +   TK+R MRIFILGARAEAQLPGHVWKQ QFLFPE +F
Sbjct: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332
           E+HFIGPE  Y R+K+EY+ S+TP+V+RVDETL F+Y T++F VFHEAQDFFPYDPY+D+
Sbjct: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392
           FF FHPG+A+PES   WMG+TM+ LLETKCAIFTTGFN++DL  D+  V+ KYG EMD+L
Sbjct: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380

Query: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           MEPVRN+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/438 (71%), Positives = 369/438 (84%), Gaps = 5/438 (1%)

Query: 1   MTVLYAPSGATQ--LYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXX 58
           MTVL +     +  +  ++L K+    L  S   +R LMGFV+NALGL            
Sbjct: 1   MTVLMSSINTLRHPMSMNILNKNTLTSLPSSQ--KRSLMGFVKNALGLDPSPSPDDPTPE 58

Query: 59  NRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHD 118
           NRFHPWDQSPS DLRERAA+IRTLA CPVT K+INYTCPLSGIPTHHSREAWE DK YH 
Sbjct: 59  NRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQ 118

Query: 119 SKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQ 178
           SK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q +D+ VNLTNWDLFFYTR+FYSMDTEFQ
Sbjct: 119 SKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQ 178

Query: 179 LAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS-LPTTT 237
           LAAVTKMLSYP+TIGS+LH+FSPYSLNPKGPITLEGLKSLAALRY+LYP + +S +    
Sbjct: 179 LAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKL 238

Query: 238 KNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPV 297
            +R MRIFILGARAEAQLPGHVWKQLQFLFP+Q+FEIHFIG ECL   +K +Y+KS  PV
Sbjct: 239 HDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPV 298

Query: 298 VQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKAL 357
           V+++DET+K IY +++F V+HEAQDF PYDPY+DVFFTFHPG+A+PE+   WMG+TMKAL
Sbjct: 299 VKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKAL 358

Query: 358 LETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQ 417
           LETKCAIFTTGFNK+D+T+D+ +VK++YGKEMD LM+P++N +GSTKWELNDMNPQE++Q
Sbjct: 359 LETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQ 418

Query: 418 FNMYIAGFRGKRYHTIKR 435
           FNMY+AGFRGKRYHTIKR
Sbjct: 419 FNMYVAGFRGKRYHTIKR 436

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 349/417 (83%), Gaps = 14/417 (3%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           ++R LMGFVRNALGL            NRFHPWDQSP+VDLRERAA+I+TLA CPVT K 
Sbjct: 20  SKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKP 79

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           I YTCP+SGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFP+ QG
Sbjct: 80  IQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQG 139

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
            D+ VNLTNWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH+FSPYSLNPKGPIT
Sbjct: 140 PDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 199

Query: 212 LEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQS 271
           LEGLKSLAALRYTLYPL+NR++ TT KN+ MRIFILGARAEAQLPGHVWKQLQFLFP+Q+
Sbjct: 200 LEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQN 259

Query: 272 FEIHFIGPECLYKRDKQEYVKSTT--------------PVVQRVDETLKFIYRTNFFEVF 317
           FEIHFIGPE LY R++ EY++S T              PV +R+DET+KF Y T++F   
Sbjct: 260 FEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTL 319

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDD 377
           H AQDFFPYDPY DVFF FHPG ASPES  +WM +T+K LL+TKCAIFTTGFNKKD+ DD
Sbjct: 320 HTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADD 379

Query: 378 INLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           I +++  YGKEMD+LM PV+NVFGSTKWEL+D +P  VYQFNMYIAGFRGKRYH IK
Sbjct: 380 IQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIK 436

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 345/402 (85%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH+MGFVRNALGL            NRFHPWDQSPS DLRERAA IR LA CPVTG++I
Sbjct: 20  KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREI 79

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 80  NYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDF 139

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGP+TL
Sbjct: 140 DRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTL 199

Query: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272
           EGLKSLAALRYTLYP +NR + + TKN  +RIFILGARAEAQLPGHVWKQLQF+FPE + 
Sbjct: 200 EGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNI 259

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332
           E+HF+GPE  Y R+K+EYV S++P+V+RVDETL F+Y T++F VFHEAQDFFPYDPY D+
Sbjct: 260 ELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDI 319

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392
           FF FHPG+A+PES  +WMG+TM+ALLETKCA+FTTGFN+ DL  D+  V  K+GKE+D+L
Sbjct: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDML 379

Query: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           MEPV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 380 MEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/402 (74%), Positives = 343/402 (85%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH+MGFVRNALGL            NRFHPWDQSPS DLRERAA IR LA CPVTG++I
Sbjct: 20  KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREI 79

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTHHSREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 80  NYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDF 139

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VNLTNWDLFFYTR F+SMDTEFQLAAVTKMLSYPITIGS+LH+FSPYSLNPKGPITL
Sbjct: 140 DRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITL 199

Query: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272
           EGLKSLAALRYTLYP +NR + +  KN  +RIF+LGARAEAQLPGHVWKQLQF+FPE   
Sbjct: 200 EGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQM 259

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332
           EIHF+GPE  Y R+K+EYV S  P+++RVDETL F+Y T++F VFHEAQDFFPYDPY D+
Sbjct: 260 EIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTDI 319

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392
           FF FHPG+A+PES  +WMG+TM+ALLETKCAIFTTGFN+ DL  D++ V ++YGKE+D++
Sbjct: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDII 379

Query: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+P +N FGSTKWELND+NPQEVYQFNM++AGFRGKRYH I+
Sbjct: 380 MDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIE 421

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/410 (72%), Positives = 342/410 (83%), Gaps = 1/410 (0%)

Query: 25  RLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAH 84
           RL      RR ++GFVRNALGL            NRFH WDQSP+ DLRERAA+IR LA 
Sbjct: 6   RLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQ 65

Query: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144
           CPVTGK+INYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEF
Sbjct: 66  CPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEF 125

Query: 145 DFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSL 204
           DFPQ   +D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI S+L++FSPYSL
Sbjct: 126 DFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSL 185

Query: 205 NPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQ 264
           NPKGPITLEGLKSLAALRYTLYP EN+++   TK+R MR+FILGARAEA LPGHVWKQLQ
Sbjct: 186 NPKGPITLEGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQ 244

Query: 265 FLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFF 324
           FLFPE +FE+HFIGPECL  ++K +YV S  PVV+R+DETL F+Y T++F V+H+AQDFF
Sbjct: 245 FLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFF 304

Query: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSK 384
           PYDPY+D FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L  DIN V  K
Sbjct: 305 PYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDK 364

Query: 385 YGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           + KE+D+LMEP +N++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 365 HSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/412 (73%), Positives = 341/412 (82%), Gaps = 8/412 (1%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
            RR LMGFVRNALGL            NRFHPWDQSP   LRERAA+I+TLA CPVTG +
Sbjct: 27  ARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           + YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ+QG
Sbjct: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
           YDK VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SLL +FSPYSLNPKGPIT
Sbjct: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206

Query: 212 LEGLKSLAALRYTLYPL----ENRSLPTTT----KNRAMRIFILGARAEAQLPGHVWKQL 263
           LEGLKSLAA+RYTLY        R+   TT    KNR MR+F+LGARAEAQLPGHVWKQL
Sbjct: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266

Query: 264 QFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDF 323
            +LFPEQSFE+ FIGPE  Y R + +YV+S TPVV++VDETLKFI+ T++F V HE+QDF
Sbjct: 267 SYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDF 326

Query: 324 FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKS 383
           FPYDPY D FFTFHPG+ASPE+  +W+  T+ ALL+TKCAIFTTGF++ DL +D+ L+  
Sbjct: 327 FPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE 386

Query: 384 KYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           K+G EMD+LMEP +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHTIKR
Sbjct: 387 KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/411 (70%), Positives = 343/411 (83%)

Query: 24  NRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLA 83
           N   VSH + R LMGFVRNALGL            NRFHPWDQSP  DLRERAAKIRTLA
Sbjct: 32  NNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLA 91

Query: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPE 143
           HCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGRPFPE
Sbjct: 92  HCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPE 151

Query: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYS 203
           F FPQ Q +D+ +N+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSPYS
Sbjct: 152 FVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYS 211

Query: 204 LNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQL 263
           L PKGPITLEGLKS+AALRYTLYP  N+S  T TKNR MRIF+LGARAEAQLPGH+WKQL
Sbjct: 212 LQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQL 271

Query: 264 QFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDF 323
           Q+LFPEQ FE+ FIGPE  Y ++K++Y+K   P++Q +D+TLK  + T +F   HE+QD 
Sbjct: 272 QYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDL 331

Query: 324 FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKS 383
           FPYDPYMDVFF FHPG+++ E+   WM +TMK+LLET+CAIF TGF++ D+ +D+N++  
Sbjct: 332 FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE 391

Query: 384 KYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           KY  ++D+LM+PV+NVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 392 KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/408 (70%), Positives = 343/408 (84%), Gaps = 1/408 (0%)

Query: 27  VVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCP 86
           V   Q RR +MGFVRNALGL            NRFHPWDQSPS +LRERAA+I+ LA CP
Sbjct: 22  VCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCP 81

Query: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146
           VTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRPF EFDF
Sbjct: 82  VTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDF 141

Query: 147 PQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206
           P+QQ YD+ VN+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNP
Sbjct: 142 PEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNP 201

Query: 207 KGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFL 266
           KGPITLEGLKSLAALRYTLYP +NR +  + +++ +R+FILGARAEAQLPGHVWKQLQ+L
Sbjct: 202 KGPITLEGLKSLAALRYTLYPEQNRRV-RSIQDKPLRVFILGARAEAQLPGHVWKQLQYL 260

Query: 267 FPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPY 326
           FPE   E+HF+GPE  Y R+K+EYV S+ PVV+R+D+T+K  Y T++F VFHEAQDFFPY
Sbjct: 261 FPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPY 320

Query: 327 DPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYG 386
           DPY D+FF FHPG+ SPE+  +WM  T++ALL+TKCAIFTTGFNKKDL DD+  VK KYG
Sbjct: 321 DPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYG 380

Query: 387 KEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            E+D+L++P +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 381 DELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/402 (72%), Positives = 339/402 (84%), Gaps = 2/402 (0%)

Query: 34  RHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93
           R +MGFVRNALGL            NRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 94  YTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYD 153
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ Q YD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 154 KAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLE 213
           + VN++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNPKGPITLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 214 GLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFE 273
           GLKSLAALRYTLYP ++       ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ S E
Sbjct: 197 GLKSLAALRYTLYPEQSGRF-RAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 274 IHFIGPECLYKRDKQEYVKSTTP-VVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332
           +HF+GPE  Y R+K+ YV+S+T  +V+R+DE ++  Y T+FF VFHEAQDFFPYDPY DV
Sbjct: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392
           FF FHPG+A+PE+   WMG+TMKAL++TKCA+FTTGF+K+DL  DI++V+ KYG E+D+L
Sbjct: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375

Query: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           MEPV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/426 (66%), Positives = 339/426 (79%), Gaps = 7/426 (1%)

Query: 9   GATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSP 68
            ATQL  H +     +  + SH+T   L+GFV+NALG+            NRF+PWD+SP
Sbjct: 8   AATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANRFYPWDESP 64

Query: 69  SVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKV 128
           S  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K YE L+KV
Sbjct: 65  SPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKV 124

Query: 129 NIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSY 188
           NIYEHDLRSGRPFPEFDFP +Q  D  VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSY
Sbjct: 125 NIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSY 184

Query: 189 PITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILG 248
           PITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYTL    N +   TTK R MRIFILG
Sbjct: 185 PITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL---RNNAF-ATTKTRPMRIFILG 240

Query: 249 ARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFI 308
           ARAE+QLP H+WKQLQFLFP Q+FEI+FIGPEC        Y+ S + +V+RVDE+L   
Sbjct: 241 ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA 300

Query: 309 YRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTG 368
           Y  ++F+ FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TMKALL+TKCAIFTTG
Sbjct: 301 YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG 360

Query: 369 FNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 428
           F++ D+  DI  V+  YG+E+D+LM P++NVFGSTKWELND+NPQ+VYQFNMYIAGFRGK
Sbjct: 361 FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK 420

Query: 429 RYHTIK 434
           RYHT+K
Sbjct: 421 RYHTVK 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/421 (63%), Positives = 335/421 (79%), Gaps = 12/421 (2%)

Query: 24  NRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLA 83
           N +  S+ ++R+LMGFVR+ LGL            NRFHPW+ SP  DLRERAA+I+T+A
Sbjct: 15  NIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMA 74

Query: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPE 143
            CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNIYEHDLRSGRPFPE
Sbjct: 75  KCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPE 134

Query: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYS 203
           FDFP++Q YD  +NL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI S+LH+FSPYS
Sbjct: 135 FDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYS 194

Query: 204 LNPKGPITLEGLKSLAALRYTLY----------PLENRSLPTTTKNRAMRIFILGARAEA 253
           L PKGP+TLEGLKSLAALRYTL             ++ ++  T+KNR MRIFILGARAEA
Sbjct: 195 LTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEA 254

Query: 254 QLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNF 313
           QLP HVWKQLQ+LFP  +FEIHFIGPE L  +DK  YV STTP+ +R+D+++  +Y T++
Sbjct: 255 QLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDY 314

Query: 314 FEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKD 373
           F V+H+AQDF+PYDPY D+FF FHPG A+ +   +W+ ETM+ LL++KC IF TGF++KD
Sbjct: 315 FHVYHKAQDFYPYDPYFDIFFMFHPGLAATKE--TWLNETMQGLLDSKCPIFMTGFHEKD 372

Query: 374 LTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTI 433
           +T DI+++   + K+MD+LM+PV+NVFGSTKWELND NPQEVYQFNMYIAG+RGKRYH  
Sbjct: 373 ITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHAT 432

Query: 434 K 434
           +
Sbjct: 433 E 433

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/425 (65%), Positives = 334/425 (78%), Gaps = 8/425 (1%)

Query: 17  LLRKSPH--NRLVVSHQTRR----HLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSV 70
           LL  +PH   R  + H  RR     L+GFVRNALGL            NRF+PWDQSPS 
Sbjct: 2   LLSGAPHVYARGRLQHLQRRVLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSP 61

Query: 71  DLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNI 130
           +LRERAAKI+ +A CP+TGK+INYTCP+SGIPTHHSREAWE D+AYH +K  +ILKKVNI
Sbjct: 62  ELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNI 121

Query: 131 YEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPI 190
           YEHDLRSGR FPEFDFP  Q +D+AVNL NWDL+FYTRSFYSMDTEFQLA VTKMLSYPI
Sbjct: 122 YEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPI 181

Query: 191 TIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTT-TKNRAMRIFILGA 249
           TI S+LH++SPYSL P GPITLEGLKS+AALRY+LYP +++S  +   K R MRIFILGA
Sbjct: 182 TIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGA 241

Query: 250 RAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIY 309
           RAE+QLPGHVWKQ Q+LFP Q+FEI FIGPEC   R+    V     +V+R+D+T+  +Y
Sbjct: 242 RAESQLPGHVWKQFQYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVY 300

Query: 310 RTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGF 369
               F   H+AQDFFPYDPY DVFF FHPG+ASPE+   WM +T+KALL+TKCA+F TGF
Sbjct: 301 HPKLFHDIHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGF 360

Query: 370 NKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 429
           +KKDL++D+ L+   YG ++D LM PV+N+FGSTKWELND+NPQEVYQFNMYI+ FRGKR
Sbjct: 361 SKKDLSNDVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKR 420

Query: 430 YHTIK 434
           YH I+
Sbjct: 421 YHPIE 425

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/417 (65%), Positives = 325/417 (77%), Gaps = 18/417 (4%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           + RH +GFV+NALG+            NRFHPWDQSPS DLRERAA+IR LA CPVTGK+
Sbjct: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKE 96

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
           +D AV++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216

Query: 212 LEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQS 271
           LEGLKS+AAL+Y+L   E      TTK R MRIFILGARAE+QLP H+WKQ  +LFP Q+
Sbjct: 217 LEGLKSIAALKYSLRHNEFE----TTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272

Query: 272 FEIHFIGPEC----LYKRDKQEYVKSTTP----------VVQRVDETLKFIYRTNFFEVF 317
           FEI+FIGPEC           E   +TT           +V+R+DE L  +Y T+FF   
Sbjct: 273 FEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDD 377
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETMKALL+TKCAIFTTGFNK+DL  D
Sbjct: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392

Query: 378 INLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           I++V+  YGKE+D+LM+P +NVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/402 (70%), Positives = 327/402 (81%), Gaps = 2/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR +MGFVRNALGL            NRFH W+QSPS DLRERAA+IR LA CPVTGKDI
Sbjct: 28  RRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDI 87

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
            Y+C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ+QG 
Sbjct: 88  RYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGR 147

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGSLLH+FSPY+L P+GPITL
Sbjct: 148 DRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITL 207

Query: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272
           EGLKSLAALRYTLYP E+ S     +++ MRIFILGARAEAQLPGHVWKQLQ+LFP  + 
Sbjct: 208 EGLKSLAALRYTLYP-ESESA-RAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNM 265

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332
           EIHFIGPE LY R ++EYV S+TPV +RVD TLK ++ T++  VFHEAQDFFPYDPY DV
Sbjct: 266 EIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDV 325

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392
           FF FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D   +++ +  EMDVL
Sbjct: 326 FFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVL 385

Query: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M P +N+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 386 MHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 320/408 (78%), Gaps = 6/408 (1%)

Query: 27  VVSHQTRRHLMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSVDLRERAAKIRTLAHCP 86
           +V +   R +MG+VRNA GL            NRFHPW++SP  DLR+RAA+I+TLA CP
Sbjct: 22  IVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCP 81

Query: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146
           VTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKKVNIYEHDLRSGR FPEFDF
Sbjct: 82  VTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDF 141

Query: 147 PQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206
           P +QG D+AVNL NWDLF YTR FYSMDTEF LA VTKMLSYPITI S+LH+FSPY L P
Sbjct: 142 PAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQP 201

Query: 207 KGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFL 266
           +GP+TLEGLKS+AALRYTLYP   ++  + + N  MRIFI+G RAE+QLPGHVWKQLQ+L
Sbjct: 202 RGPVTLEGLKSIAALRYTLYPKLGKT--SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYL 259

Query: 267 FPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPY 326
           F E+ FEIHFIGPEC  K  K     ++TP++++VD+TL  IY   +F   H++ D FPY
Sbjct: 260 FSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPY 315

Query: 327 DPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYG 386
           +PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF TGFN+ D+T+D+ L+   Y 
Sbjct: 316 NPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYR 375

Query: 387 KEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            E+DVLM+P++NVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH IK
Sbjct: 376 NEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 50/103 (48%), Gaps = 8/103 (7%)

Query: 182 VTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENR----SLPTTT 237
           V +++S    + S+L + +    NP+ P T+  L +L  ++ +++P   R    S  T  
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 238 KNRAMRIFILGARAEAQLPGHVWKQLQF----LFPEQSFEIHF 276
             + + IF L A+ E  + G+    L+     +  E+ +EI++
Sbjct: 721 SRKNLEIFTLLAKMETSILGNYLSDLKVTLRDILEERFYEINW 763

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,392,524
Number of extensions: 2070801
Number of successful extensions: 4278
Number of sequences better than 10.0: 26
Number of HSP's gapped: 4362
Number of HSP's successfully gapped: 26
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)