Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR201C (COQ9)7.351ON26026013940.0
Skud_12.2657.351ON26026012561e-177
Suva_10.2967.351ON26026012221e-171
Smik_12.2607.351ON26026011291e-157
TDEL0C019707.351ON2602498701e-118
Kpol_530.307.351ON2602538391e-113
NCAS0E028707.351ON2612618391e-113
CAGL0A03949g7.351ON2682458151e-109
ZYRO0F11726g7.351ON2512518051e-108
NDAI0E044707.351ON2642487981e-107
TBLA0E004507.351ON2792477931e-106
TPHA0F029807.351ON2642487841e-105
KNAG0B026207.351ON2652607681e-102
KLLA0D12320g7.351ON2502487369e-98
KLTH0H01232g7.351ON2572477309e-97
SAKL0F11396g7.351ON2542467231e-95
Kwal_56.246447.351ON2582617186e-95
Ecym_47227.351ON2532486908e-91
KAFR0L014807.351ON2642456831e-89
ACL147W7.351ON2462506621e-86
Kwal_23.47892.237ON60543693.1
Ecym_56715.18ON117669668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR201C
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   541   0.0  
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   488   e-177
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   475   e-171
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   439   e-157
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   339   e-118
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   327   e-113
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   327   e-113
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   318   e-109
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   314   e-108
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   311   e-107
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   310   e-106
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   306   e-105
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   300   e-102
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   288   9e-98
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   285   9e-97
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   283   1e-95
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   281   6e-95
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   270   8e-91
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   267   1e-89
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   259   1e-86
Kwal_23.4789 s23 (868626..870443) [1818 bp, 605 aa] {ON} YIL125W...    31   3.1  
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    30   8.2  

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120

Query: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180
           QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLIKSQLVRG 260
           FAWYTLMSTVNLIKSQLVRG
Sbjct: 241 FAWYTLMSTVNLIKSQLVRG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  488 bits (1256), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 229/260 (88%), Positives = 247/260 (95%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           M CRN AR GCKF RLYHSNPIEHVKP+HIKPLTYGK+SPQYKVLSLAL ++VP+HGFSE
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLN+LGYPSSM+SSIGA NSPSFFHSSTAVMEL+KFQLVDKRYRLTEGINPDVT 
Sbjct: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120

Query: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180
           +YKLPSLEHLLLKRLEMDK IGG L++LMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240
           +DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSH++KETF FAK+KLH+VMRLGEYYNNTEE
Sbjct: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLIKSQLVRG 260
           FAWYTLMSTVNL+KSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  475 bits (1222), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 239/260 (91%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           M  RN  R      RLYHSNPIEHV P+HIKPL YGK+SPQYKVLSLALQ++VP+HGF+E
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLN+LGYPSSMISSIGA NSPSF HSSTAVMEL+KFQLVDKRYRLTEGINPDVTP
Sbjct: 61  RSIVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120

Query: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180
            YKLPSLEHLLLKRLEMDKP+G  L++LMSQLAIPS FLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGS+LFMAQDKSH++ ETF FAKDKLHRVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLIKSQLVRG 260
           FAWYTLMSTVNL+KSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  439 bits (1129), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 237/260 (91%), Positives = 245/260 (94%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           MLCRN  R GC  FRLYH NPIEHVK  HIKPLTYGKESPQYKVLSLAL+++VP+HGFSE
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLNELGYPSSMISSI A NSPSFFHSSTAVMELIKFQLVDKRYRLTE INPDVTP
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTP 120

Query: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180
           QYKLPSLEHLLL+RLEMDKPIGG LSELMSQLAIPS FLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYK+TF FAK KL+RVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLIKSQLVRG 260
           FAWYTLMSTVNL+KSQLVRG
Sbjct: 241 FAWYTLMSTVNLVKSQLVRG 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  339 bits (870), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 166/249 (66%), Positives = 203/249 (81%), Gaps = 2/249 (0%)

Query: 13  FFRLYHSNPIEHVKPIHIK-PLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELG 71
           F R Y     E++ PI+ + PL YGK+SPQYKVLS  L K VP +GF+ER+IV SLNELG
Sbjct: 13  FARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELG 72

Query: 72  YPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLL 131
           YPS+M+S IG+ N PSFFHSS A+MEL+KF LVDKR  LTE I+ + TP  +LPSLEHL+
Sbjct: 73  YPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-TPVDQLPSLEHLV 131

Query: 132 LKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAK 191
           +KRLEM+ P+  HLS+L+SQL+IP  FL + ++PELHRLSDDMIYFS EKDH+D AWY+K
Sbjct: 132 IKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSK 191

Query: 192 RLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVN 251
           RLAVS  Y+ S+LFMAQD+S +YKETF FA++KLHRV  LGEYYNNTEEFAWYTL+ST+N
Sbjct: 192 RLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTIN 251

Query: 252 LIKSQLVRG 260
           L+KSQL RG
Sbjct: 252 LVKSQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  327 bits (839), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 200/253 (79%), Gaps = 1/253 (0%)

Query: 8   RTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESL 67
           RT     R YH NP E+V  + + PL YGK+S QYK+LS +L   VPE GF+ER+IV S+
Sbjct: 9   RTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSI 68

Query: 68  NELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSL 127
           N LGYPSS++S IG+ N+PSF HSSTA+MEL+KF LV KRY+L+E I  D TP  +LPSL
Sbjct: 69  NLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSL 127

Query: 128 EHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSA 187
           E LL+KRL+MD PIG HLS+L++QL+IP  FL +T++PELHRL+DDMIYFS+EKDH D A
Sbjct: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187

Query: 188 WYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLM 247
           WYAKR+ VS+ Y+ SKLFMAQD+S  Y +TF FAKDKL R+M+LG+YYNN EE+AWY LM
Sbjct: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247

Query: 248 STVNLIKSQLVRG 260
           +++N+ KS+  RG
Sbjct: 248 NSINMAKSKAARG 260

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  327 bits (839), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/261 (62%), Positives = 204/261 (78%), Gaps = 1/261 (0%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           ML R+  + G   +R YH +  E+VKP  + PLTY KES QYK+LS AL K+VP+HGF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHS-STAVMELIKFQLVDKRYRLTEGINPDVT 119
           ++I +SLNELG+ SS++S IGA NSP+ F S S AVMELIKFQLV KRY LTE + PD T
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 120 PQYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSN 179
           P+ +LPSLE LLLKRLEMDK IG  +  L ++LA PS+FLF+ A+PELHRLSDDMIYFSN
Sbjct: 121 PKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTE 239
           EKDHHD AWY KRL VS  Y+ SKL+MAQD S ++++T +FAKDKLHR+M+LGEYYNNTE
Sbjct: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240

Query: 240 EFAWYTLMSTVNLIKSQLVRG 260
           E+AWY  M + NL++++L R 
Sbjct: 241 EYAWYMFMVSTNLVRARLARS 261

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  318 bits (815), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 190/245 (77%), Gaps = 1/245 (0%)

Query: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74
           R YH    E+V P   +PLTY  ESP++K+LS  ++  VP+HGF+E++IV SLN +  PS
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLKR 134
            M+++IGA NS +F HSS AVMELIKFQLV+KR+R+ EGI  ++    KLPSLE LLLKR
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEASKLPSLESLLLKR 142

Query: 135 LEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           L+MD PI  HL+++ +QL +PS+F+   ++PEL RL+DDMIY+SNEKDHHD AWY KR A
Sbjct: 143 LKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAA 202

Query: 195 VSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIK 254
           +++TY+ SK FMAQDKSHN+ ET  FA+DKLH+VM LG+YYNN EEF W+TLMS VNL K
Sbjct: 203 LATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTK 262

Query: 255 SQLVR 259
           SQ+ R
Sbjct: 263 SQMAR 267

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  314 bits (805), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 194/251 (77%), Gaps = 6/251 (2%)

Query: 11  CKF-FRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNE 69
           C+   R YH +  EH+    + PL YG +SPQY VLS AL+  VP  GF+ER+IV SLN+
Sbjct: 6   CQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQ 65

Query: 70  LGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEH 129
           L YPS+M+S IGA NSPS  HSS AVMEL+KF LV KR +L++    D++ + K PSLE 
Sbjct: 66  LNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK-PSLED 120

Query: 130 LLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWY 189
           L +KRLE++ PI GHLS+L+S +++P  F  +TA+PELHRLSDD+IY+SNEKDHHD AWY
Sbjct: 121 LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180

Query: 190 AKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMST 249
           +KRL +S  Y+ S+LFMAQDKSHNY+ETF FA+DKL R M+LGEYYNNTEE+ WYTL+++
Sbjct: 181 SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS 240

Query: 250 VNLIKSQLVRG 260
           +NL KSQ+ RG
Sbjct: 241 INLAKSQMARG 251

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 188/248 (75%), Gaps = 2/248 (0%)

Query: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74
           R +HSN +E+ K   + PLTY K+S QYK+LS AL K+VP+ GF++ +I  SLNEL   S
Sbjct: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLSS 76

Query: 75  SMISSIGAPNSPSFFHS-STAVMELIKFQLVDKRYRLTEGINPDV-TPQYKLPSLEHLLL 132
           S+ S +G+ NSPS F S S AVMEL+KFQLV KRY+LTE I P + T + KLPSLE LL+
Sbjct: 77  SLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136

Query: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192
           +RL+MD+P+   LS L +QL IPS  LF  A+PEL  LSDD+IYFSNEKDHHD AWYAKR
Sbjct: 137 ERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196

Query: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252
           L VS  Y+ SKL+M ++   N+ +T  FAKDKLHR+M LGEYYNNTEE+AWYTLM ++NL
Sbjct: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256

Query: 253 IKSQLVRG 260
           +K++L RG
Sbjct: 257 VKARLARG 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  310 bits (793), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/247 (59%), Positives = 193/247 (78%), Gaps = 3/247 (1%)

Query: 14  FRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYP 73
            R Y+S   +  K  H++PL YGK+S QY++L  A+Q  VP  GF+ER+I+ S+N+LGY 
Sbjct: 36  IRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYN 95

Query: 74  SSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLK 133
           SSMIS +G+ N+ +  HSS AV+EL+KF LV KR +L+EGI+P+      LPSLE+LLLK
Sbjct: 96  SSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETK---DLPSLEYLLLK 152

Query: 134 RLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193
           RL+MDK I   L+E++++L+IP  FL ET+IPEL RLSDDMIYFSNEKDHHD AWY+KRL
Sbjct: 153 RLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRL 212

Query: 194 AVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLI 253
           AVS+TYI S++FMAQD S +  +T  FA+DKL++VM LGEYYNNTEEF W+TLM++VN++
Sbjct: 213 AVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIV 272

Query: 254 KSQLVRG 260
           KSQL R 
Sbjct: 273 KSQLARS 279

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  306 bits (784), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 155/248 (62%), Positives = 193/248 (77%), Gaps = 2/248 (0%)

Query: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYP- 73
           R +H    E+V P  + P TY K+SPQ+K+LS A+   V + GFSER+I+E++ EL    
Sbjct: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76

Query: 74  -SSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLL 132
            S+M+S+IG+ NSPSF HSS +VMEL+KF LV KRYR+ EG++P    Q +LPSLE LLL
Sbjct: 77  QSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSLESLLL 136

Query: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192
           KRLEMD PIG H+S  MSQL IP  FL ++A+PELHRL+DDMIYFSNEKDHHD AWY+KR
Sbjct: 137 KRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196

Query: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252
           L VSS YI SKLFMAQD S NYKET  FAKDKL +VMRLG+YYNNTEE+AWY L+++VN+
Sbjct: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256

Query: 253 IKSQLVRG 260
           +KS++ R 
Sbjct: 257 VKSRMSRA 264

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  300 bits (768), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 145/260 (55%), Positives = 186/260 (71%), Gaps = 1/260 (0%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           +L  + +R      RLYH NPIE+     + PLTY  +SPQ ++L+  LQ  VP  GF+E
Sbjct: 5   LLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINP-DVT 119
           R++++S+  +GY SSM+S +GA NSPS FHSS AVMEL+KF LV KR+ LTE +    + 
Sbjct: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLG 124

Query: 120 PQYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSN 179
               LPSLEHLL+KRL+MD P+   L +L +QLA+PS F+   A+PEL RLSDDMIYFSN
Sbjct: 125 SPAALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSN 184

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTE 239
           EKDH D+AWY+KRL VS  Y  SKLFMAQD S N ++T  FA+DKLHR+M LGEYYNN E
Sbjct: 185 EKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVE 244

Query: 240 EFAWYTLMSTVNLIKSQLVR 259
           E+AWY++M+TVN  K+   R
Sbjct: 245 EYAWYSIMTTVNRAKAGFSR 264

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  288 bits (736), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 191/248 (77%), Gaps = 2/248 (0%)

Query: 13  FFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGY 72
           F RLYH N +EH  P  IKPLTYG +S Q+KVLS AL K VP++GF+ER+IV+SLNELG 
Sbjct: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGM 64

Query: 73  PSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLL 132
            SS +S +G+ NSPSFF+ S +V+EL+KF LV KR +L   +  D      LP L+ L L
Sbjct: 65  GSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLD--SDKPLPDLKTLFL 122

Query: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192
           +RL++++ +  HLS+L+S +++P  FL  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR
Sbjct: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182

Query: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252
           +A+S+ Y+ S+LFMAQDKSHN++ET  FA+ KL++V +LG  YNNTEE+ W+TL+S++NL
Sbjct: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242

Query: 253 IKSQLVRG 260
            KSQ+ RG
Sbjct: 243 AKSQITRG 250

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  285 bits (730), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 140/247 (56%), Positives = 183/247 (74%), Gaps = 1/247 (0%)

Query: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74
           RLYH + +EH       PLTYG  S Q+KVL  AL K VP +GF+ER++V SLN+L    
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQ-YKLPSLEHLLLK 133
           S++S IGA NSPSF ++S AV+ELIKF LV KRY LT+ ++P  T    + P+LE L  +
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 134 RLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193
           RLE++KPI  HL++L+S L+IP  FL +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 194 AVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLI 253
           A+S  ++ S+LFMAQD+S NY +TF FA +KLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 254 KSQLVRG 260
           KSQL R 
Sbjct: 251 KSQLTRS 257

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  283 bits (723), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 192/246 (78%), Gaps = 3/246 (1%)

Query: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74
           R YH N +EH     + PL Y K+SPQ+K+L+ AL + VP++GF+ER++  S ++LGY S
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLKR 134
           S +S +GA NSPSFF+SS AV+EL+KF LV KRY LT+G+  D T +   PSLE+L LKR
Sbjct: 72  SFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV-ADGTLES--PSLENLFLKR 128

Query: 135 LEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           LEM+KPI  HLS+L+S LA+P AFL E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188

Query: 195 VSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIK 254
           +S+ Y+ S+LFMAQDKS +Y++T  FAK+KL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248

Query: 255 SQLVRG 260
           SQ+ R 
Sbjct: 249 SQMTRS 254

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  281 bits (718), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 138/261 (52%), Positives = 185/261 (70%), Gaps = 4/261 (1%)

Query: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60
           ML R+    G +F   Y  NP+E+     + PL YG +S Q+KVL  AL+  VP +GF+E
Sbjct: 1   MLARSFRTLGRRF---YQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNE 57

Query: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGIN-PDVT 119
           R++V SLN+LG  S ++SSIGAPNSP   +SS AV+EL+KF LV KRY LT+ ++     
Sbjct: 58  RALVASLNDLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCA 117

Query: 120 PQYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSN 179
              + P+LE L  KRLE++ PI  H+++L++ LA+P  FL ++A+PELHRLSDDMIYFS 
Sbjct: 118 SPAEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSK 177

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTE 239
           E D +D AWY+KR A+S  ++ S+LFMAQDKS NY +TF FA DKLH V +LG+YY NTE
Sbjct: 178 EPDANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTE 237

Query: 240 EFAWYTLMSTVNLIKSQLVRG 260
           E+ WYTL+ +VNL KSQ+ R 
Sbjct: 238 EYMWYTLLMSVNLAKSQITRS 258

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  270 bits (690), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 131/248 (52%), Positives = 177/248 (71%), Gaps = 7/248 (2%)

Query: 13  FFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGY 72
           F R YH N  E+     ++PL YG+ SPQYKVL+ AL+K+VP  GF + +IV++ NELGY
Sbjct: 13  FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY 72

Query: 73  PSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLL 132
            S+++++IGA NSP+ F+ ST+V EL+KF LV KRY L E        Q    +LE L L
Sbjct: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQEGTKTLEELFL 125

Query: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192
           KRLE +K +G HL E++S LAIP  FL  T +PEL +L+DDMIY+S EKD +D AWY+KR
Sbjct: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185

Query: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252
           LAVS  YI ++LFMA+D S N++ T  FAK +++++  +G  YNN EEFAW+ L++TVNL
Sbjct: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245

Query: 253 IKSQLVRG 260
            +SQLVRG
Sbjct: 246 ARSQLVRG 253

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  267 bits (683), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 141/245 (57%), Positives = 181/245 (73%), Gaps = 5/245 (2%)

Query: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74
           RLYH    E+V P  I PLTY  +S Q K+LS +L+++VP  GF+E+SI++S+N+LGY S
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLKR 134
           SM+S IGA NSPSF HSS AV+ELIK+ LV KR  LT+      T      +L+ LLLKR
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTK-----DTNDNTTTTLKELLLKR 138

Query: 135 LEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           LEMD PI   L  L +QLA P  F+F+ ++PEL +L+DDMI+FSNEKDHHD AWY+KRLA
Sbjct: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198

Query: 195 VSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIK 254
           VS  Y+ SK+FM QD S+N++ T  FA DK+ RVM LGEYYNN EE+AW+TLM+++NL+K
Sbjct: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258

Query: 255 SQLVR 259
           SQ  R
Sbjct: 259 SQFSR 263

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  259 bits (662), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 173/250 (69%), Gaps = 8/250 (3%)

Query: 11  CKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNEL 70
           C+  RLYH N +EH     ++PL Y ++SPQYKVL  AL+  VP  GF+ER+IV +  +L
Sbjct: 5   CR--RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDL 62

Query: 71  GYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHL 130
           GY S+++S++ APNSP+  +  +AV+EL+KF LV KR  L      D   Q  + S+E L
Sbjct: 63  GYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALA-----DAAAQGNV-SMEQL 116

Query: 131 LLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYA 190
            L+R+E D+P+ G L++L+S L++P  FL  TA+PEL RLSDD+IY+S EKDH D AWY+
Sbjct: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176

Query: 191 KRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTV 250
           KR AV+  Y+ + LFMA+D+S   +ET  FA+ +L +V  LG  YNN EEFAWY L+  +
Sbjct: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236

Query: 251 NLIKSQLVRG 260
           NL+KSQL RG
Sbjct: 237 NLVKSQLTRG 246

>Kwal_23.4789 s23 (868626..870443) [1818 bp, 605 aa] {ON} YIL125W
           (KGD1) - alpha-ketoglutarate dehydrogenase [contig 5]
           FULL
          Length = 605

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 23  EHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVE 65
           E  +P   +PL Y K S Q  V+ +  +K + E  F+++ IVE
Sbjct: 511 ETDQPSFTQPLMYQKISKQRSVIDVYTEKLISEGSFTQKDIVE 553

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVD-KRYRLTEGINPDVTPQY-KLPSLEHLLL 132
           SMI+    P+S S+   +     L+  ++ D K+ RLT GI   V  QY KL  LE +L 
Sbjct: 712 SMINEDKLPSSESYIRENDQTKVLLFVKMFDIKKQRLT-GIGHIVLSQYSKLTELETVLS 770

Query: 133 KRLEMDKPI 141
           K   +D+ I
Sbjct: 771 KLFNIDQKI 779

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,099,889
Number of extensions: 1192475
Number of successful extensions: 3186
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3247
Number of HSP's successfully gapped: 32
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)