Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR200W (YKE2)7.352ON1141145783e-78
Smik_12.2597.352ON1141145115e-68
Suva_10.2957.352ON1141145012e-66
Skud_12.2647.352ON1141144821e-63
KAFR0L014907.352ON1071033961e-50
NCAS0E028607.352ON1051033934e-50
TPHA0F029907.352ON1071033901e-49
ZYRO0F11748g7.352ON1091033901e-49
TBLA0E004407.352ON1151123883e-49
TDEL0C019607.352ON1071033847e-49
CAGL0A03971g7.352ON1061003803e-48
KNAG0B026107.352ON1191033762e-47
Kpol_530.297.352ON1071073718e-47
NDAI0E044607.352ON1061023622e-45
KLLA0D12298g7.352ON115993502e-43
Ecym_47217.352ON1071033473e-43
ACL146C7.352ON1071033396e-42
SAKL0F11418g7.352ON1151083337e-41
Kwal_56.246487.352ON1131003328e-41
KLTH0H01210g7.352ON1131003311e-40
KLTH0E11374g8.489ON21639670.62
TPHA0H027307.69ON51695680.70
YLR131C (ACE2)8.326ON77065670.86
KAFR0A073402.101ON12999651.1
Skud_16.546.248ON483103661.3
Skud_12.2008.326ON76765661.3
CAGL0G06314g7.69ON65337651.4
KLTH0C05346g7.447ON10254621.9
SAKL0G11286g5.260ON83473642.5
Kpol_1039.612.101ON129104613.0
KLLA0A06952g5.390ON71669606.7
Ecym_43118.259ON1376107607.0
YHL014C (YLF2)2.549ON40534608.0
ABL041W2.472ON81822608.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR200W
         (114 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   227   3e-78
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   201   5e-68
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   197   2e-66
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   190   1e-63
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   157   1e-50
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   155   4e-50
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   154   1e-49
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   154   1e-49
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   154   3e-49
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   152   7e-49
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   150   3e-48
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   149   2e-47
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   147   8e-47
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   144   2e-45
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   139   2e-43
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   138   3e-43
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   135   6e-42
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   132   7e-41
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   132   8e-41
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   132   1e-40
KLTH0E11374g Chr5 (1017534..1018184) [651 bp, 216 aa] {ON} some ...    30   0.62 
TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {O...    31   0.70 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    30   0.86 
KAFR0A07340 Chr1 (1481834..1482223) [390 bp, 129 aa] {ON} Anc_2....    30   1.1  
Skud_16.54 Chr16 complement(100169..101620) [1452 bp, 483 aa] {O...    30   1.3  
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    30   1.3  
CAGL0G06314g Chr7 complement(603668..605629) [1962 bp, 653 aa] {...    30   1.4  
KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar...    28   1.9  
SAKL0G11286g Chr7 complement(963289..965792,965887..965887) [250...    29   2.5  
Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {...    28   3.0  
KLLA0A06952g Chr1 complement(628173..630323) [2151 bp, 716 aa] {...    28   6.7  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    28   7.0  
YHL014C Chr8 complement(76097..77314) [1218 bp, 405 aa] {ON}  YL...    28   8.0  
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...    28   8.5  

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  227 bits (578), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114
           QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  201 bits (511), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 99/114 (86%), Positives = 107/114 (93%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MSELG KYQ LQ ELEEFIVARQKLETQLQENKIVNEEFDQLEE+TPVYKLTGNVLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114
           QSEAR NVDKRLEFIE EITRCEKNI+DKQE+LEK+R++LIKLNN AA+TGP R
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  197 bits (501), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 106/114 (92%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MSELGAKYQ LQ+ELEEFIVARQKLETQLQENKIVNEEFDQL+EDTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114
           QSEAR NV+KRLEFIETEI RCEKNIR KQEELE++R+EL+KLNN A + GP R
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  190 bits (482), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 104/114 (91%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MSELGA+YQ LQ+ELEEFIVARQKLETQLQENKIVNEEFDQ+ +DTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114
           QSEAR NVDKRLEFIETEI RCE+NIR+KQ+ELEK+R+ELIKLNN  A  G  R
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  157 bits (396), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 79/103 (76%), Positives = 91/103 (88%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MSEL A+YQ+LQ+ELEE IVARQKLETQLQENKIVN+EF  L+E+T VYKLTGNVLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           Q EAR NVDKRLEFIE EITRCE NI+ KQ E+E +R+EL+KL
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKL 103

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  155 bits (393), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 95/103 (92%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           M++L A+YQ LQ+ELE FI+ARQKLETQLQENKIV +EF+QL ++T VYKLTGNVLLPVE
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           Q EAR+NV+KRLEFI++EIT+CEKNI+ KQEELEK+R+E+IK+
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKM 103

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  154 bits (390), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 92/103 (89%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MS++ AKYQ +Q ELEE I+ARQKLETQLQENKIVN+EF+ L EDTP+YKLTGNV+LP+E
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           Q EA++NV+KRLEFIE EI RCE+NI+ KQ+EL+K+R EL+K+
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKM 103

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  154 bits (390), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 91/103 (88%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MSEL A+YQ+LQ ELE FIVARQKLETQLQENKIV++EF+ L+ D+ VYKLTGNVLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           Q +ARTNV KRLEFI+TEI RCE NI+ KQEE E++++ELIKL
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKL 103

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  154 bits (388), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 77/112 (68%), Positives = 93/112 (83%), Gaps = 3/112 (2%)

Query: 2   SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQ 61
           +EL  KYQ  QNELE FIV RQKLETQLQENKIVN+EF++L+E+T V+KLTGNVLLP+EQ
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  SEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPG 113
            EAR+N+DKRLEFI+TEI RCEKNI+ KQ E+EK+RSEL+    TA +  P 
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMA---TAPAPTPA 112

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  152 bits (384), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 90/103 (87%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MS+L A YQ LQ+ELE  ++ARQKLETQLQENKIV+EEF +L+EDT VYKLTGNVLLPVE
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           QSEA +NV KRLEFI+TEI RCE N++ KQ+E EK+R+ELIKL
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKL 103

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  150 bits (380), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 84/100 (84%)

Query: 2   SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQ 61
           +ELGAKYQ LQNELEE + ARQKLETQLQENKIVNEEF  L+EDT VYKLTGNVLLPVE 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  SEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELI 101
            +A+ NVDKRLEFI  EI RCE NIR KQ+ELE +R +LI
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  149 bits (376), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 88/103 (85%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MS   AKYQ+ Q+ LEE IVARQKLETQLQENKIV EEFD L+ED+ VYKLTG+VLLPV+
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           Q EARTNVDKRLEFI  EI RCE+NI++KQE LE +RSEL+KL
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  147 bits (371), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           MS+L  KYQ++Q ELEE IVAR++LETQLQENKIVNEEF+ L+EDT VYKLTGNVLLPVE
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTA 107
           Q EAR+NV+KRLEFIE EI +CE NI+ KQ EL K+R EL+K    A
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  144 bits (362), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 89/102 (87%)

Query: 2   SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQ 61
           S L +KYQ LQ ELE+ I+ARQKLETQLQENKIV EEF+QL  ++ VYKLTGNVLLPV+Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  SEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
            EA +NVDKRLEFI+TEI+RCE NI++KQ+EL+ +RSE++K+
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  139 bits (350), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/99 (71%), Positives = 82/99 (82%)

Query: 7   KYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEART 66
           KY +LQ ELEE IVARQKLETQLQENKIV++EF  L++D  VYKLTG VLLPVEQ EA+ 
Sbjct: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68

Query: 67  NVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNN 105
           NV+KRLEFIE EI RCE NI+ KQ+ELE  RSEL+KL +
Sbjct: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 82/103 (79%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
           + ++ AKY QLQ ELE+ IV RQKLETQLQENKIVNEE   L+ED  VYKLTG VLLPVE
Sbjct: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
             EA +NV KRLEFI+ EI RCE NI++KQ+ELE+ R ELIKL
Sbjct: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  135 bits (339), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 79/103 (76%)

Query: 3   ELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQS 62
           ++  KY QLQ ELEE +V RQKLETQLQENKIVNEE   L+ +T VYKLTG VLLPVEQ 
Sbjct: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64

Query: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNN 105
           EA  NV KRLEFIE EI RCE+NI+ KQEE+E  R+ L+KL  
Sbjct: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  132 bits (333), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 90/108 (83%), Gaps = 5/108 (4%)

Query: 1   MSELGAK-----YQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNV 55
           M+EL A+     Y  +Q+ELE+ ++ARQKLETQLQENKIV +EFD L +++ VYKLTG V
Sbjct: 1   MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60

Query: 56  LLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103
           LLPVEQ EA+ NV+KRL+FI+ EITRCE+NI++KQ +LE++R+EL++L
Sbjct: 61  LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRL 108

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  132 bits (332), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%)

Query: 3   ELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQS 62
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD L+E+T VYKLTG VLLPVEQ 
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIK 102
           EA++NV KRLEFI TEI RCE NI++KQ  LEK+R+EL++
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  132 bits (331), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%)

Query: 3   ELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQS 62
           +L   Y   Q+ELEE ++ARQKLETQLQENKIV +EFD L E+T VYKLTGNVLLPVEQ 
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIK 102
           EA++NV KRLEFI  EI RCE+NI+ KQ  LEK+R+EL++
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106

>KLTH0E11374g Chr5 (1017534..1018184) [651 bp, 216 aa] {ON} some
           similarities with uniprot|Q6LE92 Saccharomyces
           cerevisiae YPL041C Hypothetical ORF
          Length = 216

 Score = 30.4 bits (67), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 24/39 (61%)

Query: 19  IVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLL 57
           ++++ KL T+L +   +   FD+L E +PV  ++  ++L
Sbjct: 69  LISKSKLLTRLSKRPAIGHYFDKLAETSPVSTISSFLIL 107

>TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {ON}
           Anc_7.69 YOR324C
          Length = 516

 Score = 30.8 bits (68), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (56%), Gaps = 8/95 (8%)

Query: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60
             +L  + Q+L++ L +  +A   ++    EN  ++++FD+  E + +Y++T NV   VE
Sbjct: 410 FDDLSQRLQKLRSNLNDITLA---VKNSHLEN--LDKKFDRNNESSLIYQVTENVAEFVE 464

Query: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEK 95
           + E   N+ KR +  ++ + R  + IR  ++ELEK
Sbjct: 465 KLE---NIQKRYDTCKSLVDRHREVIRIMEQELEK 496

>YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON}
           ACE2Transcription factor required for septum destruction
           after cytokinesis; phosphorylation by Cbk1p blocks
           nuclear exit of Ace2p during the M-to-G1 transition,
           causing its specific localization to daughter cell
           nuclei, and also increases Ace2p activity;
           phosphorylation by Cdc28p and Pho85p prevents nuclear
           import during cell cycle phases other than cytokinesis;
           part of the RAM network that regulates cellular polarity
           and morphogenesis
          Length = 770

 Score = 30.4 bits (67), Expect = 0.86,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 36  NEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEK 95
           N++FD + E+         VLL  +Q E R  ++K+ E  E    + EK +RD Q + EK
Sbjct: 171 NDDFDHIRENDGENSYLSQVLLK-QQEELRIALEKQKEVNE----KLEKQLRDNQIQQEK 225

Query: 96  MRSEL 100
           +R  L
Sbjct: 226 LRKVL 230

>KAFR0A07340 Chr1 (1481834..1482223) [390 bp, 129 aa] {ON} Anc_2.101
           YNL153C
          Length = 129

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 9   QQLQNELEEFIVAR----QKLETQLQENKIVNE---EFDQLEEDTPVYKLTGNVLLPVEQ 61
           QQ  NE  + I+ +    Q+L  ++QE + +++   E + ++ED  V    G++ L  +Q
Sbjct: 19  QQKINEFSKLIMRKDSIEQELSKEMQEKEYLDDVSLEIELIDEDEKVQYKIGDIFLFFKQ 78

Query: 62  SEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSEL 100
           SEA   ++K +E I+ +I   +    D    +  +++EL
Sbjct: 79  SEAVEQLEKDVESIDAKIEELQNKQSDIDSRVSALKTEL 117

>Skud_16.54 Chr16 complement(100169..101620) [1452 bp, 483 aa] {ON}
           YPL224C (REAL)
          Length = 483

 Score = 30.0 bits (66), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 51/103 (49%), Gaps = 7/103 (6%)

Query: 6   AKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEAR 65
           ++Y ++++ ++  +++   L+T L     +N +   +    P  + T  + +PV  S   
Sbjct: 360 SRYLEVESVIKSSLIS---LKTHLDSKGTLNVKDLTILASGPNLRATTTLEVPVLHSGQE 416

Query: 66  TNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAA 108
             +    +F+E+ I    K++R K   +EK+  E + L +T++
Sbjct: 417 VGI----KFLESTIATIRKDLRLKVPNVEKVDVEFVDLTSTSS 455

>Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {ON}
           YLR131C (REAL)
          Length = 767

 Score = 30.0 bits (66), Expect = 1.3,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 36  NEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEK 95
           NE+F Q+ E          VLL  +Q E R  ++K+ E  E    + EK +RD Q + EK
Sbjct: 170 NEDFAQIREKDGENSYLSQVLLK-QQEELRIALEKQKEVNE----KLEKQLRDNQVQQEK 224

Query: 96  MRSEL 100
           +R  L
Sbjct: 225 LRRVL 229

>CAGL0G06314g Chr7 complement(603668..605629) [1962 bp, 653 aa] {ON}
           some similarities with uniprot|P39734 Saccharomyces
           cerevisiae YAL028w
          Length = 653

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 70  KRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNT 106
           K LEF+E +++ C+  + D++E + KM S L+ L N+
Sbjct: 577 KHLEFLENKMSECQSQLVDQKETMRKMES-LLYLENS 612

>KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar
          to uniprot|P47128 Saccharomyces cerevisiae YJR082C EAF6
          Esa1p-associated factor subunit of the NuA4
          acetyltransferase complex
          Length = 102

 Score = 28.5 bits (62), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 7/54 (12%)

Query: 1  MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGN 54
          M E    YQ+L+ EL+E +V R+ LE Q   ++I  E FD+       Y LTGN
Sbjct: 1  MDEAHQHYQKLKQELQEALVDRETLEKQW--DQIQQEIFDK----ESAY-LTGN 47

>SAKL0G11286g Chr7 complement(963289..965792,965887..965887) [2505
           bp, 834 aa] {ON} similar to uniprot|P14907 Saccharomyces
           cerevisiae YJL041W NSP1 Essential component of the
           nuclear pore complex which mediates nuclear import and
           export
          Length = 834

 Score = 29.3 bits (64), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 12/73 (16%)

Query: 37  EEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKM 96
           E+  QL  DT          L  EQ++ R  +D+ L++IE + T  E  +   + + E +
Sbjct: 685 EQISQLYSDT----------LIAEQTQNR--IDQSLQYIERQQTELETFLDTYERKTESL 732

Query: 97  RSELIKLNNTAAS 109
            SE++  NN +++
Sbjct: 733 LSEMLSSNNGSSA 745

>Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {ON}
           complement(169465..169854) [390 nt, 130 aa]
          Length = 129

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 7/104 (6%)

Query: 4   LGAKYQQLQNELEEFIVARQKLETQLQ---ENKI----VNEEFDQLEEDTPVYKLTGNVL 56
           +  K QQL NE  + I+ +  +E QL    E K     V+ E + ++ED  V+   G+V 
Sbjct: 14  VSYKDQQLINEFSKLIMRKDSIEEQLNLQNEEKSYLEDVSLEIELIDEDQLVHYKIGDVF 73

Query: 57  LPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSEL 100
           L + Q E    ++   E I+++I   + +  +  + L++++++L
Sbjct: 74  LMLPQEEVVNLLESDTEVIDSKIDNLQNSKSEIDDRLKELKAQL 117

>KLLA0A06952g Chr1 complement(628173..630323) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q05497 Saccharomyces cerevisiae
           YDR338C
          Length = 716

 Score = 27.7 bits (60), Expect = 6.7,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 35  VNEEFDQLEEDTPVYKLTGNVLLPVEQSE----ARTNVDKRLEFIETEITRCEKNIRDKQ 90
           V E+ D+ +ED     L+  V LP   SE    ++ N+D  LE  E   +  + +  D+ 
Sbjct: 93  VLEDIDEYDEDGE--PLSRTVSLPSRVSEPSNVSQQNLDWLLEEHERRFSSSQNSENDED 150

Query: 91  EELEKMRSE 99
           E+LE   SE
Sbjct: 151 EDLENGTSE 159

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
           similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 9/107 (8%)

Query: 7   KYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQ----S 62
           KY +LQ E+ +       LE Q+ +   +N E  QL +D    +L   ++   E+    +
Sbjct: 379 KYGELQKEITDLRELSDNLEEQITK---INAEKSQLVKDK--LQLQRELVSSEEKLKSLN 433

Query: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAAS 109
           + RT  +K L+  E  I  CE NIR   E   +  + L++LN +  S
Sbjct: 434 QKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHS 480

>YHL014C Chr8 complement(76097..77314) [1218 bp, 405 aa] {ON}
           YLF2Protein of unknown function, has weak similarity to
           E. coli GTP-binding protein gtp1; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies
          Length = 405

 Score = 27.7 bits (60), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 16  EEFIVARQKLETQLQENK-IVNEEFDQLEEDTPV 48
           ++F++   + E+QL E K I +E FD+++EDT V
Sbjct: 258 DKFLLFSAEFESQLMECKGIASEYFDKIKEDTNV 291

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score = 27.7 bits (60), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%)

Query: 81  RCEKNIRDKQEELEKMRSELIK 102
           RCEK +R+K EELEK+   L+K
Sbjct: 735 RCEKLLREKSEELEKVAQLLMK 756

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,018,155
Number of extensions: 505923
Number of successful extensions: 3933
Number of sequences better than 10.0: 468
Number of HSP's gapped: 3879
Number of HSP's successfully gapped: 539
Length of query: 114
Length of database: 53,481,399
Length adjustment: 84
Effective length of query: 30
Effective length of database: 43,849,455
Effective search space: 1315483650
Effective search space used: 1315483650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)