Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR199C (PBA1)7.353ON27627614500.0
Skud_12.2637.353ON27427411791e-164
Smik_12.2587.353ON27427411711e-163
Suva_10.2947.353ON27527511651e-162
TDEL0C019507.353ON2732786955e-91
NCAS0E028507.353ON2812846713e-87
Kpol_530.287.353ON2742806686e-87
KAFR0L015007.353ON2792836341e-81
ZYRO0F11770g7.353ON2722776235e-80
TPHA0F030007.353ON2822856035e-77
NDAI0E044507.353ON2212235715e-73
CAGL0A03993g7.353ON2722795443e-68
KNAG0B026007.353ON2792855375e-67
SAKL0F11440g7.353ON2722824611e-55
TBLA0E020707.353ON2522874251e-50
KLTH0H01188g7.353ON2672853843e-44
Kwal_56.246507.353ON2522603084e-33
KLLA0D12276g7.353ON2582802771e-28
Ecym_47207.353ON2612782238e-21
ACL145W7.353ON2342481973e-17
Smik_4.192.56ON97246820.079
KLTH0H00726g5.73ON241441693.5
SAKL0D14960gna 1ON57867693.5
TBLA0C032105.292ON68337683.8
TDEL0B054101.468ON74069666.9
TBLA0B051106.194ON64251667.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR199C
         (276 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   563   0.0  
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   458   e-164
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   455   e-163
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   453   e-162
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   272   5e-91
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   263   3e-87
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   261   6e-87
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   248   1e-81
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   244   5e-80
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   236   5e-77
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   224   5e-73
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   214   3e-68
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   211   5e-67
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   182   1e-55
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   168   1e-50
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   152   3e-44
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   123   4e-33
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   111   1e-28
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    91   8e-21
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    80   3e-17
Smik_4.19 Chr4 complement(40263..43181) [2919 bp, 972 aa] {ON} Y...    36   0.079
KLTH0H00726g Chr8 (72819..80063) [7245 bp, 2414 aa] {ON} highly ...    31   3.5  
SAKL0D14960g Chr4 (1237823..1239559) [1737 bp, 578 aa] {ON} weak...    31   3.5  
TBLA0C03210 Chr3 (779532..781583) [2052 bp, 683 aa] {ON} Anc_5.2...    31   3.8  
TDEL0B05410 Chr2 (960929..963151) [2223 bp, 740 aa] {ON} Anc_1.4...    30   6.9  
TBLA0B05110 Chr2 complement(1201224..1203152) [1929 bp, 642 aa] ...    30   7.8  

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/276 (100%), Positives = 276/276 (100%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120
           FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF
Sbjct: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120

Query: 121 SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVM 180
           SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVM
Sbjct: 121 SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVM 180

Query: 181 TENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVD 240
           TENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVD
Sbjct: 181 TENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVD 240

Query: 241 LCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           LCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 LCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  458 bits (1179), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 214/274 (78%), Positives = 250/274 (91%)

Query: 3   FKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFP 62
           FKQWNDLPEP+H LD PEISKNLQSLE CP+P+VE PQDL+V QYST +ITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 63  KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSF 122
           KNLLQLTSIGE+K++LTVK+ S  QS+  +SWNYDENFPNEVDP  +++T+ ET Y FSF
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120

Query: 123 PIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTE 182
           PIYSFG+TLLFS+EENFI+ISPIFGNMISRSI+SQL + SPDIIVIG+SD+I++MK MT+
Sbjct: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180

Query: 183 NECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLC 242
           +ECTLQPPEFITGFIGSVLTQLI+G +KG+ FKCL+ PSEGPNGFEK+SLSDMGSL+D+C
Sbjct: 181 SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC 240

Query: 243 GQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
            QWLGF+ S+YS+ECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  455 bits (1171), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/274 (78%), Positives = 244/274 (89%)

Query: 3   FKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFP 62
           FKQWN++PEP+HLLD PEISKNL SLE CPVPKVE PQDLDV QYST VITTKIMNPLFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 63  KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSF 122
           KNLLQL ++G+I+TTLTV +    QS+G HSWN+DENFPNEVDP  +   +DET Y FSF
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120

Query: 123 PIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTE 182
           PIYSFGKTLLFS+EENF+SISPIFGNMISR I+S+L + SP+IIVIGTSDKIA+MKVMT+
Sbjct: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK 180

Query: 183 NECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLC 242
           +EC+L+PPEFITGFIGSVLTQL+ G +KG+KFKCLV PSEGPNG+EKLSLSDMGSLV LC
Sbjct: 181 DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC 240

Query: 243 GQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           GQWLGF+ S Y EECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  453 bits (1165), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 214/275 (77%), Positives = 244/275 (88%), Gaps = 1/275 (0%)

Query: 3   FKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFP 62
           FKQWNDLPEP+H LD PEISKNLQSLEVCPVPKVE PQDLDV QYS  VITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 63  KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTA-DETVYGFS 121
           KNLL+L SIGEIKT+L VK  +  Q +  HSWNYDENFPNE++P+ +  T+ +ET+Y FS
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120

Query: 122 FPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMT 181
           FPIYSFGKTLLFS+EENFI+ISPIFGNMISRSI SQL + SPD+I+IGTSD+I++MK+MT
Sbjct: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180

Query: 182 ENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDL 241
           E+ECTLQPPEF+TGFIGSVLTQLI G +KG+KFKCLV PSEGPNGFEK SLSDMGSL+D+
Sbjct: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240

Query: 242 CGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           C QW G + S+YSEEC+RLWRCDSAAIGAQSGLYI
Sbjct: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  272 bits (695), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 136/278 (48%), Positives = 188/278 (67%), Gaps = 7/278 (2%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFKQWN++ EP+H LD P I  N  +L+   +P+V  P  +D+  +S  ++T+ IMNPL
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLP-PIDLQNFSRVILTSAIMNPL 59

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120
           FP+ LL+ T +G++K  L + S  +      HSWN+DENFPNEVDP    +   +T +  
Sbjct: 60  FPEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSKT-FEL 118

Query: 121 SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQ--FSPDIIVIGTSDKIASMK 178
             PI SFG+TLL S++ENF+  SPIF N I++S++ +LAQ  F  +++V+GTSD+I  +K
Sbjct: 119 CAPIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELK 178

Query: 179 VMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSL 238
            +++ E TL PPEF+T F+G+V+TQLI    K L F+ L+APSEGP GFEKL+L  M  L
Sbjct: 179 PVSDKETTLNPPEFVTSFVGAVITQLI---EKSLPFQGLIAPSEGPVGFEKLNLVTMEEL 235

Query: 239 VDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           + LC QW+      Y  ECYR WR D AA+GAQSGLYI
Sbjct: 236 ITLCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  263 bits (671), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 193/284 (67%), Gaps = 11/284 (3%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFKQWN+  EP+H LD P +SKN +SL+  P+PKV FP  +    Y   +ITT++MNPL
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPL 59

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120
           FP+ L++  ++G+I+T LT+       +   HSWN++ENFPNE DPD ++    +  + F
Sbjct: 60  FPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAFNF 119

Query: 121 SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVM 180
            FP+++ GK ++ S+++NF+ ISPIF N+IS+ +I QL + +   +++G+SD+IAS+K +
Sbjct: 120 EFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPR-TIKPLILGSSDRIASVKEI 178

Query: 181 TENECTLQPPEFITGFIGSVLTQLIV-------GPSKGLKFKCLVAPSEGPNGFEKLSLS 233
            ++ CTL PPEFITGFI S+LT+L +       G +K  +F  ++ PSEGP GFEKL+L+
Sbjct: 179 NDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNLT 237

Query: 234 DMGSLVDLCG-QWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
            +  L+DL   +W   +P  Y+EE YR W+   + +GAQSGLYI
Sbjct: 238 VIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  261 bits (668), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 134/280 (47%), Positives = 189/280 (67%), Gaps = 10/280 (3%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFKQWN+   P+H LD P I++N  SL++  +P+V  P+  D+ +Y   V+TTKIM+PL
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPE-TDLSKYKNVVLTTKIMDPL 59

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120
           FP  LL    I +I TTL +        S  HSW+Y+ENFPNEV    K D+ +  +  F
Sbjct: 60  FPSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVG--FKRDSNNRRLLSF 117

Query: 121 SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQL-AQFSPDI--IVIGTSDKIASM 177
           S PI++F  T++  +EENFI +S IF N+I+  +I+ L    +PD+  I IGTSD+I ++
Sbjct: 118 SSPIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRILNI 177

Query: 178 KVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLK-FKCLVAPSEGPNGFEKLSLSDMG 236
           K +T++ C+L+PPEF+TGFIGS+LTQLI   SK +  F  ++APSEGP GFEK++L  + 
Sbjct: 178 KKLTQDHCSLEPPEFVTGFIGSILTQLI---SKEVNVFTGILAPSEGPIGFEKMTLDVIK 234

Query: 237 SLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
            L+D+C + L  + + YS +C R+WR D AAIGAQSGLYI
Sbjct: 235 ELIDICQELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  248 bits (634), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 129/283 (45%), Positives = 186/283 (65%), Gaps = 11/283 (3%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFKQWN+L EP+H LD P I KN +SL+  P+P+VE P  ++   Y   ++TTK+MNPL
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKH-SWNYDENFPNEVDPDQKNDTADETVYG 119
           FPKNLL++  +G I+TTL +    +      H SW+++ENFPNE +P  ++ T +   + 
Sbjct: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGNNN-FS 119

Query: 120 FSFPIY--SFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIA-S 176
           F FPIY  S   TLL S++ENF+ +SPIF N+IS+ + S +      I+++G SDKI+ +
Sbjct: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179

Query: 177 MKVMTENECTLQPPEFITGFIGSVLTQLI-VGPSKGLKFKCLVAPSEGPNGFEKLSLSDM 235
           +K +T   C++ PPEFITGFIGS+L +L+ +G      F+C++ PSEGP GFEKLSLS M
Sbjct: 180 IKTVTNKNCSINPPEFITGFIGSLLYELLEIGTD---NFECIIVPSEGPIGFEKLSLSTM 236

Query: 236 GSLVDLCGQWLG--FEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
             L++     LG   +   Y +EC+R W+ + +A   QSGLYI
Sbjct: 237 EELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  244 bits (623), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 121/277 (43%), Positives = 181/277 (65%), Gaps = 6/277 (2%)

Query: 1   MLFKQWNDLPEPKHLLDLP-EISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNP 59
           MLFKQWN++ EP+H LD P  +  + +SL+   +P VE P +++  ++    +TT IM+P
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELP-NINWNKFHKIFLTTGIMDP 59

Query: 60  LFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYG 119
           LFPK LL +  +G+I+TTLT+   +    +G++SWN++ENFPNEV+ +   D  D     
Sbjct: 60  LFPKELLGVMKLGDIRTTLTIDR-NQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSLT 118

Query: 120 FSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKV 179
           F   + +FG  LL  ++ENF+ +SPI  N I++ ++S       ++ V+GTSD+I  +K 
Sbjct: 119 FVTTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITELKS 178

Query: 180 MTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLV 239
           ++     LQPPEF+TGFIGS+LTQL V   K + F+  +APSEG  GFEK+S++ M  L+
Sbjct: 179 ISHLRSDLQPPEFVTGFIGSILTQLTV---KNIPFEGFIAPSEGAIGFEKMSMNTMPELI 235

Query: 240 DLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           D+CGQW+     +Y  ECYR WR DS A+G+ SGLY+
Sbjct: 236 DICGQWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  236 bits (603), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 176/285 (61%), Gaps = 12/285 (4%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFKQWNDL EP+H L  P +S N++SL++  +P+V    +L    +   ++TTK MN L
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNAL 59

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADE----- 115
           FP   L LT +GE+ ++L +       ++  +SW+Y ENFPNEVD   +     E     
Sbjct: 60  FPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNE 119

Query: 116 -TVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQF---SPDIIVIGTS 171
              Y F  PI ++ KTLL S+EENFI +SPIF N+ +  I+  +  F   +  I+ +GTS
Sbjct: 120 SKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTS 179

Query: 172 DKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLS 231
           D++A+++ +T    TL  PEFITGF+GS ++QL++       +K ++ PSEGP GFEKLS
Sbjct: 180 DRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPN--YKAVIVPSEGPIGFEKLS 237

Query: 232 LSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           +  +  L+D+C + L     +YS E +RLW+   +A+GAQ+GLYI
Sbjct: 238 IETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  224 bits (571), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 109/223 (48%), Positives = 158/223 (70%), Gaps = 5/223 (2%)

Query: 57  MNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADET 116
           MNPLFP++LL L S+  I TTLT+    L  + GKHSWNY+ENFPNE DP  K+  + E 
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEK 60

Query: 117 VYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIAS 176
            Y F+FPI++  +TL+ S++ENF+ ISPIF N+IS++++  L   + +I+++GTSD++A 
Sbjct: 61  SYDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLVQALP-LNKEILILGTSDRVAV 119

Query: 177 MKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMG 236
           M+ ++    TL+PPEF+TGFIGS++T+L +  +K   F  ++ PSEGP GFEKL+L+ M 
Sbjct: 120 MRKISNEIDTLEPPEFVTGFIGSLITELNLHNAK-YNFDAIIVPSEGPTGFEKLNLTIMQ 178

Query: 237 SLVDLC-GQW--LGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
            L+D+   +W  L  +   Y+E+CYR W+   AAIGAQSGLYI
Sbjct: 179 DLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  214 bits (544), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 173/279 (62%), Gaps = 10/279 (3%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDL-DVPQYSTAVITTKIMNP 59
           MLFKQWN+L EP++ LD P +  N +SL++ P+P V  P +L +       ++TTK M+ 
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 60  LFP-KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVY 118
            F     +++  + +I  +L +   +L      H+W++ ENFPNEV+P Q     ++  +
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPK-NLQTHEATHTWDFGENFPNEVEPLQD---EEQRTF 116

Query: 119 GFSFPIYSF-GKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASM 177
              FPIY    +TL  S++ENF+++SPIF   IS  +IS+      +I+++G SD+I   
Sbjct: 117 SLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQIS-DVISKKLNRGHEIVILGCSDRIEDT 175

Query: 178 KVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGS 237
           K+ T N C+L PPEF+TGF+GS+++ L    +    F   + PSEGP GFEKLS + + S
Sbjct: 176 KICTNNNCSLVPPEFVTGFLGSLMSDLT--KTNDQLFTAAIFPSEGPQGFEKLSSTTVDS 233

Query: 238 LVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           ++D C Q +  + SRY+EECY+ W+ ++++ GAQSGLY+
Sbjct: 234 IIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  211 bits (537), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 168/285 (58%), Gaps = 15/285 (5%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           MLFK WN+  EP+H LD P +  N +SL+  P+P V  P   D  +        KIMNPL
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHS--WNYDENFPNEVDP--DQKNDTADET 116
           F  +     + GE+ T+L +    + Q++ + S  W+Y ENFPNE DP  D + DT    
Sbjct: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV 120

Query: 117 VYGFSFPIYSFG--KTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKI 174
           +     PI       TLL S++ENF+ +SPIF N+++R +   L      I+++G+SDKI
Sbjct: 121 L---RLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKL-RTLLNTQTKILLVGSSDKI 176

Query: 175 ASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSD 234
            S K+++ NECTLQPPEFITGF+G ++ +L+   ++   FK  +  SEGP GFEKLSL  
Sbjct: 177 YSTKMVSLNECTLQPPEFITGFLGGMIDELV--KNRFSNFKGFIVQSEGPTGFEKLSLES 234

Query: 235 MGSLVD-LCGQWLGF--EPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           M  L+D +  +W  +      + E C++LW+ D AA+ AQSGLYI
Sbjct: 235 MDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  182 bits (461), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 167/282 (59%), Gaps = 16/282 (5%)

Query: 1   MLFKQWNDLPEPKHLLDLPEI-SKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNP 59
           MLFK WN+  EP+H LD P   + N +SL+  P+P V   + +D+ Q++  V+ TK++ P
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 60  LFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYG 119
           LFP  +  +T+I E + T+  +  ++ ++ G  S   DE++  E  PD+K    +E +  
Sbjct: 61  LFPSTICPMTTISEFQVTIPPQPTAIKKAHG--SSYGDEDYEQESLPDKK---PEEII-- 113

Query: 120 FSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQL-AQFSPDIIVIGTSDKIASMK 178
            SF +  F   L   +EENF+ +SPI  N++S+ II    ++ +   IV+GTSD+I ++K
Sbjct: 114 VSFQVEKFNDILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITTLK 173

Query: 179 VM--TENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMG 236
            +  T     L+PPEF+T    S++T LI+     L FK L+APSEGP+GFEKLSL  M 
Sbjct: 174 SVGSTLGLPDLEPPEFVTNCTASLITTLIL---HDLPFKSLIAPSEGPSGFEKLSLVSMD 230

Query: 237 SLVDLCGQWLG--FEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
            L + C + +      S Y EEC+R WR    A+GAQ+GLYI
Sbjct: 231 QLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  168 bits (425), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 149/287 (51%), Gaps = 46/287 (16%)

Query: 1   MLFKQWNDLPEPKHLLD----LPEISKNLQSLEVCPVPKVEFPQDL-DVPQYSTAVITTK 55
           MLFKQW++  EP+H +D    +P   +N  SL+  P+P V+ P  L D+  Y   ++ T+
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 56  IMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADE 115
           ++ PLFPK +L  TS+G I+  L V                                ++ 
Sbjct: 61  VLMPLFPKEILNFTSLGNIEVKLNV--------------------------------SEA 88

Query: 116 TVYGFSFPIYSFG-KTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKI 174
           T +    PIY    +TL+  ++EN + + PIF N+IS++I +         ++ GTSD+I
Sbjct: 89  TAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGN-QLKFLIFGTSDRI 147

Query: 175 ASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSD 234
           + +K +    CTL PPEFITGFIGS+++ L +  +   KF   + PSEGP GFEKL+L  
Sbjct: 148 SKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLET 205

Query: 235 MGSLVDLCGQWL-----GFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           M  L+   G+ +           Y +ECYR WR     IG QSGLYI
Sbjct: 206 MEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  152 bits (384), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 145/285 (50%), Gaps = 27/285 (9%)

Query: 1   MLFKQWNDLPEPKHLLDLP-EISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNP 59
           MLFKQWN+  EP+H LD P E + +L SL+  P+P+V   + +D   +  A I T I   
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60

Query: 60  LFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYG 119
           LF   L +   I               Q+ G+    Y E++  + D    ++T       
Sbjct: 61  LFEDRLARAEQISSFVVVW--------QTKGREQHLYREDYQTQEDSRSTDETKR----- 107

Query: 120 FSFPIYSFGK-TLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMK 178
             FP++     TL   + E+F+ + PI  N++SR I         ++++ G+SD++  +K
Sbjct: 108 LEFPVHKLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGL--EVLLFGSSDRVERVK 165

Query: 179 VMT------ENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSL 232
            +       +    L PPE IT F  S++TQL+   S  ++F   VAPSEGP+G+EKLS+
Sbjct: 166 YVGFPGNVGKGLPLLTPPELITNFTASIMTQLL---SNKVRFDGYVAPSEGPSGYEKLSM 222

Query: 233 SDMGSLVDLCGQWLGF-EPSRYSEECYRLWRCDSAAIGAQSGLYI 276
             M  L+DLC   + F     Y + C+R WR +   +GAQ+GLY+
Sbjct: 223 ETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  123 bits (308), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 132/260 (50%), Gaps = 30/260 (11%)

Query: 27  SLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLTVKSPSLP 86
           SL++ P+P+V   + L    +    I T+I   LF   L     I    +T  VK     
Sbjct: 13  SLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQI----STFEVKW---- 64

Query: 87  QSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSFPIYSFGK-TLLFSMEENFISISPI 145
           Q+ G+    Y E+F  + D  ++N++      G S P+    + T L  + E+F+ + PI
Sbjct: 65  QTKGREQHLYREDFQVQEDCTKENESC-----GLSIPVLKIDEDTFLLCVAEDFLHVPPI 119

Query: 146 FGNMISRSIISQLAQFSPD--IIVIGTSDKIASMKVMTENECT------LQPPEFITGFI 197
            GN++S+    ++A+   D  ++VIGTSD+I  +K +   +        L PPE IT F 
Sbjct: 120 VGNLLSQ----EMAKLCRDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSFT 175

Query: 198 GSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGF-EPSRYSEE 256
            S+ TQL++     + F   VAPSEGP+G+EKLS+  M  L+DLC   +       Y +E
Sbjct: 176 ASITTQLLLCK---VPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRDEYVKE 232

Query: 257 CYRLWRCDSAAIGAQSGLYI 276
            +R WR    + G Q+GLY+
Sbjct: 233 THRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  111 bits (277), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 136/280 (48%), Gaps = 27/280 (9%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEF-PQDLDVPQYSTAVITTKIMNP 59
           + FKQW +   P+H +D P +  +  SL     P V   P+ LD+  Y+  ++    +  
Sbjct: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60

Query: 60  LFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYG 119
           L PK+++ L  IG I  TL          S  + W   +  P   D ++    + E  + 
Sbjct: 61  LLPKSIINLVHIGIISGTL----------SNMNEWESMKPVPGMYDTEEHMINSTEQ-FV 109

Query: 120 FSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKV 179
             + ++    TL+  ++EN +    I  N ++R++ +QL +   DI ++  SDKI  +K 
Sbjct: 110 IHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQ 168

Query: 180 MTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLV 239
           ++     L PPEFITG I + +  L   P K LK   +V PSEGP GFEK +   + +LV
Sbjct: 169 LS----YLVPPEFITGSITNFILAL---PRKELK--VIVVPSEGPIGFEKYNFPTVDALV 219

Query: 240 DLCGQWLGFEPSR---YSEECYRLWRCDSAAIGAQSGLYI 276
           D   + L   PS+   Y  EC +LW+ D      Q GLYI
Sbjct: 220 DEMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 90.5 bits (223), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 128/278 (46%), Gaps = 19/278 (6%)

Query: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60
           M+FKQW     P+H +     S +  SL + P P +    D++   Y  A+     +  L
Sbjct: 1   MIFKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWL 58

Query: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120
            P +L+    I  +  T  +K  S P        N    +  +V P  K   A       
Sbjct: 59  LPADLIHFKQISCL--TAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRA------- 109

Query: 121 SFPIYSFG-KTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKV 179
           S+PIY     TL+  ++E+ +   PI  N ++ ++   L      + ++  SDKI   K 
Sbjct: 110 SYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKS 169

Query: 180 MTENECTLQPPEFITGFIGSVLTQL-IVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSL 238
           ++E    LQPPEFI G + +++T L     SK  + + +V  SEGP G+E  +++ +  L
Sbjct: 170 LSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLL 225

Query: 239 VDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276
           V+     LG+    Y    YR W+ +SA+   QSGLY+
Sbjct: 226 VEYMKSTLGYS-EEYVTSAYRRWKSNSAS-QFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 120/248 (48%), Gaps = 30/248 (12%)

Query: 34  PKVEFPQDLDVPQYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHS 93
           P+VEF   L   +YS A++    ++ L P  ++QLT + ++  TLT       Q+ G   
Sbjct: 12  PQVEFSGKLG-ERYSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLT-------QAGGGEC 63

Query: 94  WNY----DENFPNEVDPDQKNDTADETVYGFSFPIYSFG-KTLLFSMEENFISISPIFGN 148
                  D+ +  +V   +++          ++ +Y  G   L+  +EEN +   PI  N
Sbjct: 64  ATRLVAADQFYEADVPQAERH-------VRVAYQLYERGPGQLVVVVEENDLKYPPIVHN 116

Query: 149 MISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGP 208
            +++ +  +L     +  V+  SDK   +K + E    L PPEFITG + +++  L   P
Sbjct: 117 RLAQQLAEKLRAVGAETTVLVNSDKSTGVKDLEE----LVPPEFITGALAALVCALA--P 170

Query: 209 SKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAI 268
           S     + LV  SEGP+GFEK +L+ + +LV+   Q L  +P  Y   C R W+  + + 
Sbjct: 171 SGA--GRVLVVQSEGPHGFEKHNLTVVDALVERVRQILD-QPPEYVAACTRHWKLQAGS- 226

Query: 269 GAQSGLYI 276
             Q GLY+
Sbjct: 227 QFQGGLYL 234

>Smik_4.19 Chr4 complement(40263..43181) [2919 bp, 972 aa] {ON}
           YDL220C (REAL)
          Length = 972

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 210 KGLKFKCLVAPS-EGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYS 254
           + L F+C  APS +    +E+LSL+ +GS+  L G+++G  PS +S
Sbjct: 357 RRLSFQCTSAPSSQQIIDYERLSLAKVGSVERLKGKFVGMYPSHFS 402

>KLTH0H00726g Chr8 (72819..80063) [7245 bp, 2414 aa] {ON} highly
            similar to uniprot|P33334 Saccharomyces cerevisiae
            YHR165C PRP8 Component of the U4/U6-U5 snRNP complex
            involved in the second catalytic step of splicing
          Length = 2414

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 187  LQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGF 227
            LQ   F+  F G +L  LI+GP +  +   L  PS+ PN F
Sbjct: 1111 LQFSSFVYQFYGLMLDLLILGPQRASE---LAGPSQAPNNF 1148

>SAKL0D14960g Chr4 (1237823..1239559) [1737 bp, 578 aa] {ON} weakly
           similar to uniprot|P32465 Saccharomyces cerevisiae
           YHR094C HXT1 Low-affinity glucose transporter of the
           major facilitator superfamily, expression is induced by
           Hxk2p in the presence of glucose and repressed by Rgt1p
           when glucose is limiting
          Length = 578

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 196 FIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLV-DLCGQWLGFEPSRYS 254
           +IG VLT L VG S  L    L   S  P   + ++  ++G  + DL G W+ F  S + 
Sbjct: 153 YIGRVLTGLTVGASTNLTVVYLSEVSPAPIRGQIIAFYEVGWRIGDLIGFWINFGVSEHI 212

Query: 255 EECYRLW 261
               + W
Sbjct: 213 SPGNKQW 219

>TBLA0C03210 Chr3 (779532..781583) [2052 bp, 683 aa] {ON} Anc_5.292
           YHR042W
          Length = 683

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 150 ISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECT 186
           ISR + +QL QF+P++ +  T DK++  K +   E T
Sbjct: 368 ISRDLFTQLIQFAPNLDIKNTIDKLSKDKELFAKEIT 404

>TDEL0B05410 Chr2 (960929..963151) [2223 bp, 740 aa] {ON} Anc_1.468
           YJR042W
          Length = 740

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 109 KNDTADETVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVI 168
           KN  A   +  F+F + S+G   L+S+    IS SPI      R+ I++L    P     
Sbjct: 457 KNGMASYMLNNFAFELCSYGDKKLWSIAIGLISFSPIGNPSAKRTAIAELLPHFP----F 512

Query: 169 GTSDKIASM 177
            T+D I  M
Sbjct: 513 QTNDDIEWM 521

>TBLA0B05110 Chr2 complement(1201224..1203152) [1929 bp, 642 aa]
           {ON} Anc_6.194
          Length = 642

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 147 GNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFI 197
           G M S+ ++S++A+F  DI   G  D   + +V  EN C    P  + G I
Sbjct: 222 GEMDSQLLLSEVAKFKLDIPDEGDVDSHTAERVYAENICKWGKPFGLDGLI 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,846,707
Number of extensions: 1375556
Number of successful extensions: 4196
Number of sequences better than 10.0: 33
Number of HSP's gapped: 4263
Number of HSP's successfully gapped: 33
Length of query: 276
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 168
Effective length of database: 41,097,471
Effective search space: 6904375128
Effective search space used: 6904375128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)