Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR120C (YPS1)8.318ON56956926120.0
Smik_12.1868.318ON57257222810.0
Skud_12.1928.318ON56957122000.0
Suva_10.2118.318ON56657320630.0
CAGL0M04191g8.318ON60151712921e-172
Suva_2.3058.318ON59749112611e-167
YDR144C (MKC7)8.318ON59650612431e-165
TPHA0A015808.318ON60053412421e-164
NCAS0B035608.318ON58655312391e-164
Kpol_543.618.318ON58850412291e-162
SAKL0H15664g8.318ON55654412141e-161
Skud_4.4038.318ON59052712141e-160
Smik_4.3888.318ON59752812111e-160
NCAS0C033008.318ON55950911851e-156
Kwal_26.7254singletonON57050411601e-152
KNAG0G024108.318ON53052511151e-146
NDAI0G026208.318ON59050011191e-146
KAFR0B057108.318ON57554111171e-146
YLR121C (YPS3)8.319ON50852410881e-142
TDEL0F044508.318ON52454210861e-142
Smik_12.1878.319ON50752210701e-140
Skud_12.1938.319ON49752510611e-138
KLLA0E04049g8.318ON58953510681e-138
KAFR0H023008.318ON52150710551e-137
KLTH0G12386g8.318ON58051310581e-137
ZYRO0F10230g8.318ON58053310491e-136
KNAG0I009108.318ON56956710331e-133
ZYRO0F10274gsingletonON57250910251e-132
Kwal_56.239028.318ON62952110261e-131
TBLA0D00140singletonON60753510091e-129
KAFR0B06530singletonON5385299991e-129
TBLA0H012908.318ON6673799491e-120
NDAI0J010308.318ON6523539281e-117
Suva_10.2128.319ON7453489281e-116
KNAG0E03220singletonON5405869061e-115
ZYRO0F10318g8.319ON4865378991e-114
ZYRO0G02904gsingletonON5314939031e-114
TBLA0E02630singletonON6893189071e-113
ZYRO0F10252gsingletonON5514728921e-112
TBLA0A039108.318ON5964878961e-112
KAFR0E03940singletonON6384888701e-108
KLTH0F06754gsingletonON7674778231e-100
SAKL0C02970gsingletonON5925408028e-99
Ecym_42518.318ON5023557913e-98
Kwal_33.14239singletonON6514828016e-98
KAFR0I01700singletonON5525257937e-98
CAGL0E01419g8.318ON5915707872e-96
SAKL0F07172g7.182ON5424497543e-92
ZYRO0E02266gsingletonON5064917382e-90
AGL192W8.318ON4993187217e-88
CAGL0E01815gsingletonON5194747141e-86
CAGL0E01793gsingletonON5164627122e-86
CAGL0E01859gsingletonON5055017033e-85
KNAG0I009008.319ON5315257038e-85
ZYRO0F10296gsingletonON5285036984e-84
CAGL0E01749gsingletonON4824806902e-83
CAGL0E01771gsingletonON5194766801e-81
Suva_16.14singletonON5405046611e-78
CAGL0E01727gsingletonON5394356566e-78
YIR039C (YPS6)singletonON5374756513e-77
CAGL0E01881gsingletonON5084856484e-77
Suva_9.13singletonON4644906402e-76
CAGL0E01837gsingletonON5214666417e-76
Suva_34.1singletonON3873056221e-74
Smik_65.1singletonON3423256102e-73
TPHA0C008408.318ON10003466193e-69
KAFR0B06700singletonON5313185954e-69
KNAG0I01200singletonON6773486011e-68
NCAS0A124607.182ON5404545739e-66
KLLA0D15917g7.182ON5114625711e-65
NDAI0B017207.182ON5474885467e-62
ZYRO0D15554g7.182ON5214665386e-61
YIL015W (BAR1)7.182ON5874745233e-58
SAKL0E15356gsingletonON5573185013e-55
KNAG0H027607.182ON5634574863e-53
Smik_5.7singletonON3043064623e-52
Skud_9.1547.182ON5163254763e-52
Smik_9.1757.182ON5933254701e-50
TDEL0H026507.182ON5523324372e-46
CAGL0J02288g7.182ON5412914241e-44
Ecym_43947.182ON5183184221e-44
Suva_79.1singletonON2272083837e-42
AGR240W7.182ON4523073645e-37
SAKL0H00330gsingletonON5784313422e-33
Suva_9.1877.182ON3331692915e-28
Suva_9.186singletonOFF5431692891e-26
TBLA0D045807.182ON3953032733e-25
Kpol_1063.227.182ON3362002511e-22
Ecym_13245.401ON5762822171e-17
KLLA0F22088g5.401ON5583052108e-17
Kwal_26.88028.677ON4122881953e-15
AGR407CsingletonON2682691904e-15
KLTH0D11264g8.677ON4172881954e-15
ZYRO0F07392g8.677ON4182851911e-14
Suva_62.1singletonON2522821805e-14
Skud_4.6185.401ON5862831841e-13
NCAS0C013608.677ON4063201812e-13
TPHA0D012608.677ON4192001812e-13
YDR349C (YPS7)5.401ON5963111822e-13
Smik_6.3518.677ON4052911802e-13
Skud_16.1288.677ON4052911803e-13
ZYRO0A06578g5.401ON7202991813e-13
Kwal_55.200345.401ON5932481778e-13
KLTH0E02596g5.401ON5961961761e-12
TDEL0E022305.401ON5733011761e-12
YPL154C (PEP4)8.677ON4052911741e-12
KNAG0J017108.677ON4152911732e-12
Suva_2.5205.401ON5982341742e-12
Suva_16.1568.677ON4062911703e-12
TBLA0B038308.677ON4132881705e-12
KLLA0D05929g8.677ON4092901696e-12
Smik_4.6135.401ON5963041707e-12
TBLA0H016805.401ON6092341698e-12
SAKL0H06512g8.677ON4042871679e-12
NDAI0E021058.677ON4082951679e-12
Kpol_1013.68.677ON4022781661e-11
KAFR0H024208.677ON4162811661e-11
Smik_5.6singletonON123741512e-11
Ecym_23968.677ON4152801606e-11
TPHA0E019205.401ON6242721601e-10
SAKL0G07524g5.401ON6322761601e-10
KAFR0E040805.401ON5962791591e-10
KNAG0C051405.401ON5982651591e-10
Kpol_1072.158.677ON3992851552e-10
CAGL0A02431g5.401ON5873381563e-10
NDAI0C046105.401ON6092781538e-10
ACR150W5.401ON5532241492e-09
NCAS0F031505.401ON6452431473e-09
Smik_67.1singletonON110911335e-09
ACR144W8.677ON4083231446e-09
YGL259W (YPS5)singletonON165911322e-08
TDEL0A062308.677ON4081811358e-08
Kpol_1059.335.401ON6623211313e-07
ACR143WsingletonON3932371261e-06
CAGL0M02211g8.677ON4151191116e-05
YGL258W-AsingletonON7748962e-04
SAKL0D01408gna 1ON506120970.003
Ecym_4614na 1ON481121910.016
YBR220C6.118ON56086810.33
KAFR0E040505.407ON52830751.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR120C
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...  1010   0.0  
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   883   0.0  
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   852   0.0  
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   799   0.0  
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   502   e-172
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   490   e-167
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   483   e-165
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   483   e-164
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   481   e-164
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   478   e-162
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   472   e-161
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   472   e-160
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   471   e-160
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              461   e-156
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   451   e-152
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   434   e-146
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   435   e-146
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   434   e-146
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   423   e-142
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   422   e-142
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   416   e-140
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   413   e-138
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   416   e-138
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   410   e-137
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   412   e-137
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   408   e-136
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              402   e-133
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   399   e-132
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   399   e-131
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                393   e-129
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            389   e-129
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   370   e-120
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             362   e-117
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   362   e-116
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   353   e-115
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   350   e-114
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   352   e-114
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   353   e-113
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   348   e-112
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   349   e-112
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              339   e-108
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   321   e-100
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   313   8e-99
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   309   3e-98
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   313   6e-98
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   310   7e-98
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   307   2e-96
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   295   3e-92
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   288   2e-90
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   282   7e-88
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   279   1e-86
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   278   2e-86
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   275   3e-85
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              275   8e-85
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   273   4e-84
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   270   2e-83
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   266   1e-81
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   259   1e-78
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   257   6e-78
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   255   3e-77
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   254   4e-77
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   251   2e-76
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   251   7e-76
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   244   1e-74
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       239   2e-73
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   243   3e-69
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   233   4e-69
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              236   1e-68
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   225   9e-66
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   224   1e-65
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   214   7e-62
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   211   6e-61
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   206   3e-58
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   197   3e-55
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   191   3e-53
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       182   3e-52
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   187   3e-52
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   185   1e-50
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   172   2e-46
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   167   1e-44
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   167   1e-44
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   152   7e-42
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   144   5e-37
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   136   2e-33
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...   116   5e-28
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...   115   1e-26
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   109   3e-25
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   101   1e-22
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    88   1e-17
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    86   8e-17
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    80   3e-15
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    78   4e-15
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    80   4e-15
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    78   1e-14
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    74   5e-14
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    75   1e-13
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    74   2e-13
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    74   2e-13
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    75   2e-13
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    74   2e-13
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    74   3e-13
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    74   3e-13
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    73   8e-13
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    72   1e-12
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    72   1e-12
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    72   1e-12
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    71   2e-12
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    72   2e-12
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    70   3e-12
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    70   5e-12
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    70   6e-12
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    70   7e-12
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    70   8e-12
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    69   9e-12
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     69   9e-12
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    69   1e-11
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    69   1e-11
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        63   2e-11
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    66   6e-11
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    66   1e-10
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    66   1e-10
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    66   1e-10
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    66   1e-10
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    64   2e-10
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    65   3e-10
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    64   8e-10
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    62   2e-09
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    61   3e-09
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        56   5e-09
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    60   6e-09
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    55   2e-08
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    57   8e-08
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    55   3e-07
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    53   1e-06
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    47   6e-05
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    42   2e-04
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    42   0.003
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    40   0.016
YBR220C Chr2 complement(662995..664677) [1683 bp, 560 aa] {ON} P...    36   0.33 
KAFR0E04050 Chr5 complement(800197..801783) [1587 bp, 528 aa] {O...    33   1.4  

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/569 (89%), Positives = 511/569 (89%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP
Sbjct: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
           EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN
Sbjct: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120

Query: 121 SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPAS 180
           SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS                 QSVPAS
Sbjct: 121 SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQSVPAS 180

Query: 181 EATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 240
           EATMDCQQY                YFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV
Sbjct: 181 EATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 240

Query: 241 ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND 300
           ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND
Sbjct: 241 ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND 300

Query: 301 SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKT 360
           SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVT             KT
Sbjct: 301 SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKT 360

Query: 361 LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGG 420
           LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGG
Sbjct: 361 LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGG 420

Query: 421 FHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN 480
           FHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN
Sbjct: 421 FHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN 480

Query: 481 TTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNLXXXXXXX 540
           TTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNL       
Sbjct: 481 TTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNLTTSTASA 540

Query: 541 XXXXXKRNVGDHIVPSLPLTLISLLFAFI 569
                KRNVGDHIVPSLPLTLISLLFAFI
Sbjct: 541 TSTSSKRNVGDHIVPSLPLTLISLLFAFI 569

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/572 (77%), Positives = 482/572 (84%), Gaps = 3/572 (0%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNS---KFVKLPFHKLYGDSLENVGSD 57
           M+L TVRSAVLSSLFA QVL KIIP A+KRD+D +    KFVKLPFHKLYGDSL+NVG D
Sbjct: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRDNDDDDSNSKFVKLPFHKLYGDSLDNVGRD 60

Query: 58  KKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117
           KKPE  L KRADGYEEIIITNQQSFYSV+L+VG+PPQNVTVLVDTGSSDLWIMGS+NPYC
Sbjct: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120

Query: 118 SSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSV 177
           SS++  +SRRRVIDKRDDSSS G+L+NDINPFGWLTGTG                  QSV
Sbjct: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180

Query: 178 PASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 237
           PASEATMDC++Y                YFSISYGDGTFASGTFGTDVLDLSDLNVTGLS
Sbjct: 181 PASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240

Query: 238 FAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLY 297
           FAVANETNSTMGVLGIGLPELEVTYSGSTAS   + +KYDNFPIVLKNSGAIK+N YSLY
Sbjct: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300

Query: 298 LNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXX 357
           LNDSDA HGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVT            
Sbjct: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360

Query: 358 XKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFD 417
            KTLTTTKIPALLDSGTTLTYLP+TVV++IA E+GAQYS R+GYYVLDCPSDDS +IVFD
Sbjct: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFD 420

Query: 418 FGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
           FGGFHINA LSSFILSTG+TCLLGIIPTSD+TGTILGDSFLTNAYVVYDL+NLEISMAQA
Sbjct: 421 FGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480

Query: 478 RYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNLXXXX 537
           +YNTT+ENIE+I+SS+PSAVKAPGYTNTWSTSA+IVTGGNIFTV+SSQTASFSGN+    
Sbjct: 481 QYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNVTSST 540

Query: 538 XXXXXXXXKRNVGDHIVPSLPLTLISLLFAFI 569
                   KRN  D I PSLPLTL SLLFAFI
Sbjct: 541 ASATSTSSKRNAADCIAPSLPLTLFSLLFAFI 572

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/571 (77%), Positives = 480/571 (84%), Gaps = 4/571 (0%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           MKL TVRSAVLSSLFA Q L KIIPAA+KRDDDSNSKFVKLPFHKLYGD+ ++VG+DKKP
Sbjct: 1   MKLTTVRSAVLSSLFALQTLAKIIPAASKRDDDSNSKFVKLPFHKLYGDTRDDVGTDKKP 60

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
           EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGS+NPYCSS 
Sbjct: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYCSSG 120

Query: 121 SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPAS 180
           SM SSRRRVI+KRDDSSS G+L+NDINPFGWLTGTGS                 QSVPAS
Sbjct: 121 SMSSSRRRVINKRDDSSSSGALVNDINPFGWLTGTGSAIGPTATGSGGGSGTATQSVPAS 180

Query: 181 EATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 240
           EATM+CQ++                YFSISYGDGTFASGTFGTD+LDLSDLNVTGLSFAV
Sbjct: 181 EATMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAV 240

Query: 241 ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND 300
           ANETNSTMGVLGIGLPELEVTYSGSTAS S + Y YDNFP+VLKNSGAIK+N YSLYLND
Sbjct: 241 ANETNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLND 300

Query: 301 SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKT 360
           SDA HGTILFGAVDHSKY GTLYT+PIVNTLSASGFSSPIQFDVT             KT
Sbjct: 301 SDAKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKT 360

Query: 361 LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD-DSMEIVFDFG 419
           LTTT+IPALLDSGTTLTYLPQ VV+MIA EL AQYSSR+GYYVLDCPS+ +S +IVFDFG
Sbjct: 361 LTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVFDFG 420

Query: 420 GFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARY 479
           GFHINA LSSFIL+ G  CLLGII T DDT TILGDSFLTNAYVVYDL+NLEISMAQA+Y
Sbjct: 421 GFHINASLSSFILNAGNICLLGIIAT-DDT-TILGDSFLTNAYVVYDLDNLEISMAQAQY 478

Query: 480 NTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNL-XXXXX 538
           N T+ENIE+ITSS+PSA+KAPGYT+TWSTSASIVTGGNIFTV+SSQTASFSGN+      
Sbjct: 479 NITNENIEVITSSIPSAIKAPGYTSTWSTSASIVTGGNIFTVDSSQTASFSGNVTSATAS 538

Query: 539 XXXXXXXKRNVGDHIVPSLPLTLISLLFAFI 569
                   RNVGD + PSLP TLI+LLFAFI
Sbjct: 539 ATSTTSKSRNVGDRMAPSLPFTLITLLFAFI 569

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/573 (72%), Positives = 457/573 (79%), Gaps = 11/573 (1%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDD-DSNSKFVKLPFHKLYGDSLENVGSDKK 59
           M+L T+RSA+LSSLFASQ L K+IP A   D  D+ SKFVKL F KLYGDSL+  G DKK
Sbjct: 1   MRLATIRSALLSSLFASQTLAKLIPVATDGDGGDTGSKFVKLSFDKLYGDSLDTAGRDKK 60

Query: 60  PEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
           PEVRL KRADGYEEIIITNQQSFYSVDLEVGTP QN+TVLVDTGSSDLWIMGS NPYCSS
Sbjct: 61  PEVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSSNPYCSS 120

Query: 120 NSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPA 179
           +    S + V+ KRD SSS G L+NDINPFGWLT TGS                 QSVPA
Sbjct: 121 DD---SSKYVLRKRDTSSSSGDLVNDINPFGWLTETGSVTGATATATGSGTAT--QSVPA 175

Query: 180 SEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFA 239
           SEATMDC++Y                 F ISYGDGTFA+GTFGTDVL+LSDLNVTGLSFA
Sbjct: 176 SEATMDCEEYGTFTSSDSSTFKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNVTGLSFA 235

Query: 240 VANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLN 299
           VANETNSTMGVLGIGLP LEVTYSGS+AS+ GK+YKYDNFPIVLKNSGAIKSN YSLYLN
Sbjct: 236 VANETNSTMGVLGIGLPSLEVTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNAYSLYLN 295

Query: 300 DSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXK 359
           DSDA HGTILFG VDH+KY+GTLYT+ +VNTL  SGF+SPIQFD+T             K
Sbjct: 296 DSDAKHGTILFGGVDHNKYSGTLYTVALVNTL--SGFTSPIQFDITLNGLGIIDDNGDEK 353

Query: 360 TLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDF 418
           TLTTTKIP LLDSGTTLTYLP  +V +IA  +GAQYSSRIGYYV++CP SD+S EIVFDF
Sbjct: 354 TLTTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVMECPSSDNSTEIVFDF 413

Query: 419 GGFHINAPLSSFILST-GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
           GGFHINA LSSFILST G TCLLGIIPTSD TG+ILGDSFLTNAYVVYDLENLEISMAQA
Sbjct: 414 GGFHINASLSSFILSTSGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENLEISMAQA 473

Query: 478 RYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNL-XXX 536
           +YN TSE+IE+I++SVP+AVKAPGYTNTWST+ASI TGGNIFTV+SS TAS+SGN+    
Sbjct: 474 KYNVTSEDIEVISTSVPNAVKAPGYTNTWSTTASIATGGNIFTVDSSSTASYSGNVTSST 533

Query: 537 XXXXXXXXXKRNVGDHIVPSLPLTLISLLFAFI 569
                    K+N GD IVPSLP TLISLLFAFI
Sbjct: 534 ASATSTTSSKKNGGDRIVPSLPFTLISLLFAFI 566

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  502 bits (1292), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 280/517 (54%), Positives = 345/517 (66%), Gaps = 28/517 (5%)

Query: 38  FVKLPFHKLYGDSLENVGSDK-KPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNV 96
           +VKL F K YG++ E     + + ++R+ KRA+GYEE+ ITNQ SFYSV LEVGTPPQ+V
Sbjct: 27  YVKLDFDKYYGETFETAKRGRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSV 86

Query: 97  TVLVDTGSSDLWIMGSDNPYCSSNSMGSS----------RRRVIDKRDDSSSGGSLI--- 143
            VLVDTGSSDLWI GSDNPYC   S G+S          +R + D RD +    +L    
Sbjct: 87  VVLVDTGSSDLWITGSDNPYCR-GSTGTSGKNMLLEAELKRALEDARDIAKERTTLAPRD 145

Query: 144 ---NDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPA----SEATMDCQQYXXXXXXX 196
              ND     WLTG+                    +       + AT++C +Y       
Sbjct: 146 DEHND-GLLSWLTGSDGLLGGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDTSK 204

Query: 197 XXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLP 256
                     F I YGD TFASGT+G D L LSDLNVTGLSFAVAN TNST+GVLGIGLP
Sbjct: 205 SSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLP 264

Query: 257 ELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHS 316
            LEVTYSG TA    + Y+YDNFP+VL  +GAIKSN+YSL+LN++ A  G++LFGAVDHS
Sbjct: 265 ALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHS 324

Query: 317 KYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTL 376
           KY G LYTIP+VNT ++ G+ +PIQF+VT              T+TTTKIPALLDSGTTL
Sbjct: 325 KYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNT-TITTTKIPALLDSGTTL 383

Query: 377 TYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD-DSMEIVFDFGGFHINAPLSSFIL-ST 434
           TYLPQ +V+ I  +L A YS+R GYYV  CPS  D  E+VFDFGGFHINAP+++FI+ S+
Sbjct: 384 TYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSS 443

Query: 435 GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVP 494
           G +C+LGI+P S   G ILGDSFL +AYVVYDLEN EISMAQA Y    E+IE+I+SSVP
Sbjct: 444 GDSCILGIMPQSGG-GIILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEVISSSVP 502

Query: 495 SAVKAPGYTNTWSTSA-SIVTGGNIFTVNSSQTASFS 530
            AV+APG+++TWST A S  T G+IFTV ++ T S S
Sbjct: 503 GAVRAPGFSSTWSTLATSFNTQGDIFTVQAAATVSGS 539

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  490 bits (1261), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 338/491 (68%), Gaps = 13/491 (2%)

Query: 38  FVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVT 97
           +V++ F K YGDS EN  S+KK E RL+KR D YE + ++NQ SFYSVDL++GTP Q VT
Sbjct: 36  YVRIQFQKKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVT 95

Query: 98  VLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS 157
           VLVDTGSSDLW+ GS+NPYCS+ S  +S      +R D  +  SL+  +     +    S
Sbjct: 96  VLVDTGSSDLWVTGSNNPYCSTKSGHTSSSS--KERKDEDNILSLVQSV-----VQSVAS 148

Query: 158 XXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFA 217
                             S  ++  T+DC  Y                 FSI+YGD TFA
Sbjct: 149 EISYDTTITDTDATATQDSTSSALQTIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFA 208

Query: 218 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYD 277
           SGT+G D L+L++LNVTGLSFAVANETNST+GVLGIGL  LE TYSG+T S + ++Y Y+
Sbjct: 209 SGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLAGLESTYSGATLSSAQESYTYN 268

Query: 278 NFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 337
           NFP+VLKNSGAIKS  YSL+LN+++A HG+ILFGAVDH KY+G LYTIPI+NTL   G+ 
Sbjct: 269 NFPMVLKNSGAIKSAAYSLFLNETNAKHGSILFGAVDHGKYSGDLYTIPIINTLQDHGYK 328

Query: 338 SPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSS 397
            PIQF VT              T+TTTKIPALLDSGTT++Y+P  ++ M+A +LGA YSS
Sbjct: 329 DPIQFQVTLQGLGLAKGDSESTTITTTKIPALLDSGTTISYMPVELMEMLADKLGASYSS 388

Query: 398 RIGYYVL--DCPSDDSMEIVFDFGGFHINAPLSSFILSTGTT---CLLGIIPTSDDTGTI 452
           ++GYY++     +DD + +VFDFGGF+I+  LSS+ LS  ++   C+LG  P SD T  I
Sbjct: 389 KVGYYLMDCITDTDDDINVVFDFGGFYISGNLSSYQLSADSSSDVCILGFAPQSDST-VI 447

Query: 453 LGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASI 512
           LGD+FL+NAYVVYDL+N+EISMAQ   +  SE+I++I  SVPSAVKAP Y++TWST  SI
Sbjct: 448 LGDNFLSNAYVVYDLDNMEISMAQVDLSGRSEDIDVIEDSVPSAVKAPSYSSTWSTDGSI 507

Query: 513 VTGGNIFTVNS 523
           V+GG+IFTV+S
Sbjct: 508 VSGGDIFTVSS 518

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  483 bits (1243), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 265/506 (52%), Positives = 332/506 (65%), Gaps = 25/506 (4%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPP 93
           SN  +VK+ F K YG S EN   D K   RL+ R D YE + +TNQ SFYSV+L++GTPP
Sbjct: 32  SNEVYVKMNFQKKYGSSFENALDDTKGRTRLMTRDDDYELVELTNQNSFYSVELDIGTPP 91

Query: 94  QNVTVLVDTGSSDLWIMGSDNPYCSS---NSMGSSRRRVIDKRDDSSSGGSLINDINPFG 150
           Q VTVLVDTGSSDLW+ GSDNPYCS+   ++ GSS ++V +K   +S   S+  +I+   
Sbjct: 92  QKVTVLVDTGSSDLWVTGSDNPYCSTKKKDTTGSSFKQV-NKDALASVVESVFTEIS--- 147

Query: 151 WLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSIS 210
                                    S  ++   +DC  Y                 FSI+
Sbjct: 148 ----------YDTTIVTSEATATFDSTASTSQLIDCATYGTFNTSKSSTFNSNNTEFSIA 197

Query: 211 YGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHS 270
           YGD TFASGT+G D L L+DLN+TGLSFAVANETNST+GVLGIGLP LE TYSG + S  
Sbjct: 198 YGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSV 257

Query: 271 GKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNT 330
            K+Y Y+NFP+VLKNSG IKS  YSL+ NDSD+ HGTILFGAVDH KY G LYTIPI+NT
Sbjct: 258 QKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGKYAGDLYTIPIINT 317

Query: 331 LSASGFSSPIQFDVTXXXXXXXXXXXXXK--TLTTTKIPALLDSGTTLTYLPQTVVSMIA 388
           L   G+  PIQF VT                TLTTTKIP LLDSGTT++Y+P  +V M+A
Sbjct: 318 LQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGTTISYMPTELVKMLA 377

Query: 389 TELGAQYSSRIGYYVLDCPSDDSME--IVFDFGGFHINAPLSSFILSTGTT---CLLGII 443
            ++GA YSS  GYY++DC  +   E  I+FDFGGF+++  LS F L T +    C+LGI 
Sbjct: 378 DQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQLVTDSRSNICILGIA 437

Query: 444 PTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYT 503
           P SD T  ILGD+FL N YVVYDL+N+EISMAQA ++   E IEII S+VPSA+KAPGY+
Sbjct: 438 PQSDPT-IILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEIIESAVPSALKAPGYS 496

Query: 504 NTWSTSASIVTGGNIFTVNSSQTASF 529
           +TWST  SIV+GGN+F+  ++ + S+
Sbjct: 497 STWSTYESIVSGGNMFSTAANSSISY 522

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  483 bits (1242), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 270/534 (50%), Positives = 342/534 (64%), Gaps = 62/534 (11%)

Query: 1   MKLKTVRSAVLSSLFASQV------LGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENV 54
           MK+    S V +++  S +       G   P   KRD      F+K  F K YGDS +N 
Sbjct: 1   MKVLNSNSVVYAAVLLSDLSNGLSLFGNKKPQLTKRDGSEIDNFIKFKFDKSYGDSYKNS 60

Query: 55  GSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDN 114
               KP++ ++KR DGYEEI + N+ SFYS+ L +GTP QNVTVL+DTGSSDLW+ GSDN
Sbjct: 61  SKRNKPKLDIVKR-DGYEEIELKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDN 119

Query: 115 PYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXX 174
           P CSS              DD+                T TGS                 
Sbjct: 120 PLCSS--------------DDA----------------TFTGSDG--------------- 134

Query: 175 QSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 234
               +S++++DC  Y                 F+I+YGDG++A G +G DVL L D++VT
Sbjct: 135 ----SSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQDIDVT 190

Query: 235 GLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTY 294
           GLSFAVAN TNST+GVLGIGLP LE TYSGS A      Y+YDN P+VL+NSGA+KS  Y
Sbjct: 191 GLSFAVANYTNSTVGVLGIGLPSLEATYSGSLAGS--NPYQYDNLPLVLRNSGAVKSYAY 248

Query: 295 SLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXX 354
           SL+LND D+  G+ILFG VDHSKY GTL T+P+VN   +SGF SP +FD+T         
Sbjct: 249 SLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTS 308

Query: 355 XXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD-DSME 413
                T++ T+I ALLDSGTTLTYLP T+ S++A EL A YS+R+GYY + CPS  DS E
Sbjct: 309 SKNT-TVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSSDSTE 367

Query: 414 IVFDFGGFHINAPLSSFIL-STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEI 472
           IVFDFGGFHIN PL+SFI+ S+   C+LGIIP S D   ILGDSFL +AYVVYDLENLEI
Sbjct: 368 IVFDFGGFHINVPLTSFIVTSSMNVCILGIIPRSGDQA-ILGDSFLQHAYVVYDLENLEI 426

Query: 473 SMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQT 526
           S+AQA+Y ++SE+IE I SSVPSAV+A  Y+NTWST+A+I +GG+IFTV+++ +
Sbjct: 427 SLAQAKYGSSSEDIEAIVSSVPSAVRAASYSNTWSTAATINSGGDIFTVSTTAS 480

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  481 bits (1239), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 274/553 (49%), Positives = 348/553 (62%), Gaps = 33/553 (5%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           M+L T++    SSL  + +L   IP       D +SK+V LPF+KL GDS E+   DKKP
Sbjct: 1   MRLSTIKYIFSSSLLFTNILASTIP--EHETTDQSSKYVILPFNKLVGDSYEDATPDKKP 58

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
              L+KR   YE + I N+QSFYSV+L +GTP Q +TVLVDTGSSDLWIMGSDNPYC+S 
Sbjct: 59  HFALVKRDGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYCAST 118

Query: 121 SMGSSRRRVIDKRDDSSSGGSLINDI------------NPFGWL----TGTGSXXXXXXX 164
           S G   + V+ K D +   G L  +I            + F ++    T   +       
Sbjct: 119 SNG---KNVMRKDDSNLPDGILFTEITVTNLSDLTGFFSDFSFIPMSETDIPTGVTSTNT 175

Query: 165 XXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTD 224
                      ++  SE T+DC QY                 F  SYGD TFASGT+  D
Sbjct: 176 VGGPVFPTQTNNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHD 235

Query: 225 VLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLK 284
           VL+L  LN+TGLSFAVAN +NST+GVLGIGLP LE TYSGST+    K Y+Y+NFP++LK
Sbjct: 236 VLNLGGLNITGLSFAVANMSNSTVGVLGIGLPGLETTYSGSTS----KLYQYNNFPMLLK 291

Query: 285 NSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDV 344
            SGAI S +YSL+L+D DA  G++LFGAVDH+KY G LYT+P+VN L++ G+ +PIQFDV
Sbjct: 292 QSGAIDSTSYSLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDV 351

Query: 345 TXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVL 404
           T              T+TT K PALLDSGTT++Y PQ VV  IA +LGA+YSS +G+Y +
Sbjct: 352 TLAGIGIQNDSKNY-TVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAM 410

Query: 405 DCPS-DDSMEIVFDFGGFHINAPLSSFILST-GTTCLLGIIPTSDDTGTILGDSFLTNAY 462
            C     S   VFDFGGFHI  P+S F+L T G TC+L + P  +    +LGD FLT+AY
Sbjct: 411 SCNGVSSSTNFVFDFGGFHITGPVSDFLLPTSGNTCVLAMAP-QESQHILLGDIFLTHAY 469

Query: 463 VVYDLENLEISMAQARYNTTS--ENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFT 520
           VVYDL+N EIS+AQA   T +   NI+II+ SVPSA+KAP Y+ TWS +  I TGGNIFT
Sbjct: 470 VVYDLDNYEISLAQANTGTQNLDSNIQIISDSVPSAIKAPLYSETWSKAMPISTGGNIFT 529

Query: 521 V--NSSQTASFSG 531
           V  N S T++ SG
Sbjct: 530 VPANGSATSTHSG 542

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  478 bits (1229), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 260/504 (51%), Positives = 326/504 (64%), Gaps = 61/504 (12%)

Query: 21  GKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQ 80
           GK   A      + +  FV+  F KL GDS EN  +  K    ++KR +G EE+ I NQ 
Sbjct: 47  GKHAKAQQPGASNESQGFVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQS 106

Query: 81  SFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGG 140
           +FYSV L +G+  QNVTVL+DTGSSDLW+ GS+NP CS              R DS+S  
Sbjct: 107 NFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLCS--------------RGDSNSDA 152

Query: 141 SLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXX 200
                                                      +DC ++           
Sbjct: 153 -------------------------------------------VDCAKFGTFNPSTSDTW 169

Query: 201 XXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEV 260
                 FSISY D ++ASGT+G D L L DL+VTGLSFAVAN TNST+GVLGIGLP LEV
Sbjct: 170 SSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGLSFAVANYTNSTVGVLGIGLPSLEV 229

Query: 261 TYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG 320
           TYSGS  + +G  Y+Y+NFP++LKNSGA K+N YSLYLND D+  G++LFG VDH+KY+G
Sbjct: 230 TYSGSN-NVAGTRYQYENFPLLLKNSGATKANAYSLYLNDLDSRTGSVLFGGVDHNKYSG 288

Query: 321 TLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLP 380
           TLYTIP+VNTL A+GFS P++FDVT              TLTTTKIPALLDSGTTL YLP
Sbjct: 289 TLYTIPLVNTLRAAGFSQPVEFDVTLQGMGISDDEHGNVTLTTTKIPALLDSGTTLVYLP 348

Query: 381 QTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFIL-STGTTC 438
             +VS+IA E  A Y+SR GYYV++CP SD+  +IVFDFGGFHI+  L+++I+ + G  C
Sbjct: 349 SALVSLIADEYDAVYNSRTGYYVMNCPDSDEDSQIVFDFGGFHISTNLTTYIIQAVGGIC 408

Query: 439 LLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVK 498
           +LGI+P S  T  ILGDSFL +AYVVYDL+NLEISMAQA + T  EN+E+I+SS+PSAVK
Sbjct: 409 VLGILPQSSGTA-ILGDSFLQHAYVVYDLDNLEISMAQASFETDDENVEVISSSIPSAVK 467

Query: 499 APGYTNTWSTSASIVTGGNIFTVN 522
           APGY++TWST +SI +GGNIFTV+
Sbjct: 468 APGYSSTWSTFSSISSGGNIFTVD 491

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  472 bits (1214), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 266/544 (48%), Positives = 341/544 (62%), Gaps = 46/544 (8%)

Query: 8   SAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKR 67
           S +LS L  + VL K  P           K+V LPF K  G + E      KP   L KR
Sbjct: 9   SLLLSQLVTASVLKKRSP-----------KYVSLPFDKSRGSTYEESSKHNKPYAVLSKR 57

Query: 68  ADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSR- 126
            DG++EI + NQ SF+SV+LE+GTP QNVTVLVDTGSSDLW+ GS+NPYC + S+G+ R 
Sbjct: 58  DDGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPYCRAGSVGNRRN 117

Query: 127 ----------------RRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXX 170
                           +RV  KRD+ SS  S         WLT +G+             
Sbjct: 118 DASSGSGSGSGSSNNKKRVNIKRDEISSVRS---------WLTASGT---NTRTQSGSAS 165

Query: 171 XXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSD 230
                S+ ++ AT+DC QY                 F I YGD ++A GT+G D L L D
Sbjct: 166 ATRANSLSSALATIDCSQYGTFNTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHD 225

Query: 231 LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIK 290
           +++ GLSFAVAN+TNST+GVLGIGLP LEVTYSG  AS +   Y+YDNFP++LK +  IK
Sbjct: 226 IDIGGLSFAVANQTNSTVGVLGIGLPGLEVTYSG-YASSARNRYQYDNFPLILKRNNVIK 284

Query: 291 SNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXX 350
           +N YSL+LN +++  G++LFGAVDHSKY+G LYT+P++NTL +SG++ PIQF+V      
Sbjct: 285 ANAYSLFLNSTNSSSGSLLFGAVDHSKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIG 344

Query: 351 XXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SD 409
                    TLTTT IPALLDSG TL+Y P  V  MIA  L A YSS  GYY++DCP SD
Sbjct: 345 VRTSGSNT-TLTTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSD 403

Query: 410 DSMEIVFDFGGFHINAPLSSFILSTG--TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDL 467
           D  EI++DFGGFHI + L+ +IL+T   + C+LGI+P + +   ILGD FLT+AYVVYDL
Sbjct: 404 DDTEIIYDFGGFHIASKLTDYILTTNRPSICVLGIVPQNSNR-FILGDVFLTSAYVVYDL 462

Query: 468 ENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTA 527
           +N EIS+AQA Y    E IE+I+ SVPSA+KAP Y++T  +SAS  TGG+IFTV  S T 
Sbjct: 463 DNFEISLAQANYEGGDEQIEVISESVPSAIKAPSYSSTRFSSASASTGGDIFTVTGSNTT 522

Query: 528 SFSG 531
           S S 
Sbjct: 523 SSSA 526

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  472 bits (1214), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 261/527 (49%), Positives = 343/527 (65%), Gaps = 26/527 (4%)

Query: 14  LFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEE 73
           L++S V    I +A+    +S   +V + F K YGDS EN  +D+     L++R D YE 
Sbjct: 15  LYSSTVSADSIASASIATSES---YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYEL 71

Query: 74  IIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSS--RRRVID 131
           + +TN+ SFYSV+L++GTPPQ +TVLVDTGSSDLW+ GS+NPYCS+    +S    + I 
Sbjct: 72  VKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIH 131

Query: 132 KRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXX 191
           K + +S   S+I +I+                            + P +   ++C  Y  
Sbjct: 132 KDNPASVVESVITEIS-------------YDTTISVIEATATLDNTPLASQKINCGTYGT 178

Query: 192 XXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVL 251
                          FSI+YGD TFASGT+G D L+L++LNVTGLSFAVANETNST+GVL
Sbjct: 179 FDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVL 238

Query: 252 GIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFG 311
           GIGLP LE TYSG + S   K+Y Y+NFP+VLKNSGAIKS+ YSL+ N S++ HGTILFG
Sbjct: 239 GIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFG 298

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXX--XXXXXKTLTTTKIPAL 369
           AVDH KYTG LYTIPI+N L  +G+  PIQF VT                TLTTTKIPAL
Sbjct: 299 AVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPAL 358

Query: 370 LDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD--DSMEIVFDFGGFHINAPL 427
           LDSGTT++YLP  +V ++A ++GA YSS  GYYV++C  +    + +VFDFGGFHI++ L
Sbjct: 359 LDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWL 418

Query: 428 SSFIL---STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSE 484
           S+F L   S+   C+LG  P SD T  ILGD+FL + Y+VYDL+N+EISMA A ++   E
Sbjct: 419 SNFQLFTDSSSDVCILGFAPQSDPT-VILGDNFLVSTYIVYDLDNMEISMANADFSDNDE 477

Query: 485 NIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSG 531
            I++I S+VPSA+KAP Y+NTWST  SIV GGNIF+ +S+ + S SG
Sbjct: 478 YIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIFSTSSNVSMSGSG 524

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  471 bits (1211), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 261/528 (49%), Positives = 331/528 (62%), Gaps = 25/528 (4%)

Query: 1   MKLKTVRSAVLSSLFASQVL--GKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDK 58
           MKL T++  V + L  S ++    II  +++ +D     +VK+ F + YGDS E+  +D 
Sbjct: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEIND----GYVKMNFQRKYGDSFESATNDT 56

Query: 59  KPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCS 118
           K   RL+ R D YE + +TNQ SFYSV+L++GTPPQ VTVLVDTGSSDLW+ GSDNPYC 
Sbjct: 57  KARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC- 115

Query: 119 SNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVP 178
                       +  D S S    +N  N    +    +                  +  
Sbjct: 116 ----------FTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTA 165

Query: 179 ASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSF 238
           ++   M+C  Y                 FSI+YGD TFASGT+G D L L++LNVTGLSF
Sbjct: 166 STSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSF 225

Query: 239 AVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL 298
           AVANETNST+GVLGIGLP LE TYSG + S + K+Y Y+NFP++LKNSGAIKS  YSL+ 
Sbjct: 226 AVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFT 285

Query: 299 NDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXX--XXXXXXXXX 356
           N SD+ HGTILFGAVDH KY G LYTIPI+NTL   G+  PIQF VT             
Sbjct: 286 NHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDE 345

Query: 357 XXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSME--I 414
              TLTTTKIP LLDSGTT++Y+P  +V MIA+E+GA YS   GYY++DC ++   E  +
Sbjct: 346 NMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSL 405

Query: 415 VFDFGGFHINAPLSSFIL---STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLE 471
           +FDFGGF+I   LS+F L   S    C+LGI P S D   ILGD+FL + YVVYDL+N+E
Sbjct: 406 IFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQS-DPAIILGDNFLVSTYVVYDLDNME 464

Query: 472 ISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIF 519
           ISMA A ++   E I+ I  SVPSA+KAPGY++TWST  SIV GGN+F
Sbjct: 465 ISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  461 bits (1185), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 251/509 (49%), Positives = 327/509 (64%), Gaps = 67/509 (13%)

Query: 27  ANKRDDDSNSKFVKLPFHKLYGDSLENVGSD-KKPEVRLLKRADG--YEEIIITNQQSFY 83
           A   D++  +KFV L F+K YGD  +   +D +KP++ L+KR DG  YEE+ +TNQQSFY
Sbjct: 22  AQALDNELPNKFVNLRFNKKYGDHYDTASTDSRKPKLELVKR-DGSDYEEVELTNQQSFY 80

Query: 84  SVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLI 143
           SV+++VGTP Q VTVL+DTGSSD W+MGSDNPYCS               DD+S+ G   
Sbjct: 81  SVEVDVGTPSQRVTVLLDTGSSDFWVMGSDNPYCS---------------DDTSTTG--- 122

Query: 144 NDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXX 203
                                                   +DC ++              
Sbjct: 123 ----------------------------------------IDCSEFGTFDSSSSSTFHNN 142

Query: 204 XXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 263
              F+I YGDG+FA GT+GTD + + D+ +  LS AVAN +NS+MGV+G+GL  LE TYS
Sbjct: 143 GTAFNIHYGDGSFALGTWGTDTVSIDDITLDALSLAVANSSNSSMGVIGLGLAGLETTYS 202

Query: 264 GSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLY 323
            S A  SG+ Y+Y NFP+ LKN+G + +N YSLYLND +   G ILFGAVDHS Y+G LY
Sbjct: 203 SSHAVKSGQTYQYANFPLALKNAGIVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLY 262

Query: 324 TIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTV 383
           TIP+VN  S SGF + ++FDVT              T++TT I ALLDSGTTLTY P   
Sbjct: 263 TIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSSGSATTVSTTPIIALLDSGTTLTYFPTQY 322

Query: 384 VSMIATELGAQYSSRIGYYVLDCPS--DDSMEIVFDFGGFHINAPLSSFILSTGT-TCLL 440
           VS++A +LGAQYSS  GYY + C +  D + ++VFDFGGFHINA L+ F++ +GT TC L
Sbjct: 323 VSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINATLADFVVQSGTSTCFL 382

Query: 441 GIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTS-ENIEIITSSVPSAVKA 499
            IIP  + +  ILGD+FL NAYVVYDL+NLEISMAQA+++ +S E+IE+I+SSVPSAVKA
Sbjct: 383 SIIP-QNSSSAILGDTFLNNAYVVYDLDNLEISMAQAKWDQSSDEDIEVISSSVPSAVKA 441

Query: 500 PGYTNTWSTSASIVTGGNIFTVNSSQTAS 528
           PGY+NTWST+ SI +GGNIFTVN+  +A+
Sbjct: 442 PGYSNTWSTTMSITSGGNIFTVNADASAT 470

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  451 bits (1160), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 252/504 (50%), Positives = 315/504 (62%), Gaps = 27/504 (5%)

Query: 36  SKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQN 95
           SK+V++ F KL GD+ E+      P   L+KRADG E I I NQ +FYSV++ VG+P QN
Sbjct: 32  SKYVRISFDKLRGDTAEDARVGLMPRAELVKRADGSETIKIKNQNNFYSVEVGVGSPAQN 91

Query: 96  VTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVID---------KRDDSSSGGSLINDI 146
           VT+L+DTGSSD+W+MGS+NP+C  +S  S    + +         K+D  SS  SL    
Sbjct: 92  VTLLIDTGSSDMWVMGSNNPFCEGSSRSSKHVLLGENIGLEDETVKKDFFSSFRSL---- 147

Query: 147 NPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXY 206
                LT T +                  SV AS+AT+ C  Y                 
Sbjct: 148 -----LTATATSTVSASAVAPSRT-----SVAASDATLSCSSYGTFATGSSSSFKSNNTD 197

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F I YGD T+A GT+G D + L D+ V+ LS AVANE+NST GVLGIGL  LEVT  GS 
Sbjct: 198 FYIQYGDLTYALGTWGHDDVTLQDITVSDLSMAVANESNSTFGVLGIGLTGLEVTNVGSL 257

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIP 326
            S S  AY Y N P +L + G I  N YSL+L+D DA HG++LFGAVDHSKYTG LYT+P
Sbjct: 258 VSSSRSAYTYQNLPALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGAVDHSKYTGNLYTVP 317

Query: 327 IVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSM 386
           +VN   +SGF  PIQ DVT              T TTT IPALLDSGTTLTYLP ++V  
Sbjct: 318 LVNIYKSSGFPDPIQLDVTLQGLGMSANKTNI-TFTTTPIPALLDSGTTLTYLPSSMVQS 376

Query: 387 IATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFILSTGTT-CLLGIIP 444
           IA  L AQYS  +GYYVL+C    DS E+VFDFGGFHI + L +F++   +  C LG++P
Sbjct: 377 IARRLSAQYSYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASSNFCALGLVP 436

Query: 445 TSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTN 504
            S     ILGD+FLT AYVVYDLENLE+SMAQA Y+  SE+IE+I+S++P AVKAPGY++
Sbjct: 437 QSSSRA-ILGDNFLTAAYVVYDLENLEVSMAQANYDGGSEDIEVISSTIPGAVKAPGYSS 495

Query: 505 TWSTSASIVTGGNIFTVNSSQTAS 528
           TWS+   I TGGNIFTV+   + S
Sbjct: 496 TWSSRIPISTGGNIFTVSGGNSTS 519

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  434 bits (1115), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 248/525 (47%), Positives = 327/525 (62%), Gaps = 73/525 (13%)

Query: 14  LFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEE 73
           L A  VL  ++       D     +V + F K +GD+       ++P++RL KR  GYEE
Sbjct: 2   LLAPSVLFPLVAVCAAAKD-----YVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEE 56

Query: 74  IIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKR 133
           I +TNQQSF+SV+L+VGTP QNVTVLVDTGSSDLWI G+DNPYC                
Sbjct: 57  ITLTNQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGADNPYC---------------- 100

Query: 134 DDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXX 193
                             LT +GS                  S+P  +  +DC +Y    
Sbjct: 101 ------------------LTYSGSGA---------------DSIPRRD-RVDCSEYGTFS 126

Query: 194 XXXXXXXXXXXXY--FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVL 251
                          F I+YGD TFASG +G D L L D+NVTG+SFAVAN TNST+GV+
Sbjct: 127 LEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVANRTNSTVGVM 186

Query: 252 GIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFG 311
           GIGLP LE T SGS      + Y Y NFP VLKNSGA +S  YSLYLND +   G+ILFG
Sbjct: 187 GIGLPGLETTNSGS------RPYTYANFPQVLKNSGATQSALYSLYLNDLEEERGSILFG 240

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXK--TLTTTKIPAL 369
           AVDHSKYTG++YT+PI+N L + G+++PIQFD+T                T+T+TK+PAL
Sbjct: 241 AVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTITSTKMPAL 300

Query: 370 LDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLS 428
           LDSGTT+TYLP  +VS IA +LGA  S+R G YVL C +  ++M +V+DFGGFHIN+ L+
Sbjct: 301 LDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMHLVYDFGGFHINSNLT 360

Query: 429 SFIL-STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSEN-- 485
           ++I+ ++ T C+LG+ P   +T  ILGD+FLT+AYVVYDLENL+I +AQA++  +  +  
Sbjct: 361 NYIVQASQTLCILGLFPRDSNTA-ILGDTFLTDAYVVYDLENLQIGLAQAKFGVSDSDAK 419

Query: 486 IEIITSS--VPSAVKAPGYTNTWSTS-ASIVTGGNIFTVNSSQTA 527
           I+I+T S  +PSA +AP Y++TWSTS  ++ TGGNIFT+N  +TA
Sbjct: 420 IDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTTGGNIFTLNPHETA 464

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  435 bits (1119), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 238/500 (47%), Positives = 315/500 (63%), Gaps = 58/500 (11%)

Query: 26  AANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSV 85
           +A+ +D+ S  K++ L F K YGDS  N  S   P  +L+KR DGYE++ +TNQQSFYSV
Sbjct: 21  SASSKDNTSPPKYLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYSV 80

Query: 86  DLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLIND 145
           ++E+GTP Q +TVL+DTGSSD W+  SDNPYC +                +S+ GSL   
Sbjct: 81  EVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGT----------------TSTEGSL--- 121

Query: 146 INPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXX 205
              +G  T                           + T+DC  Y                
Sbjct: 122 ---YGGET---------------------------QDTIDCSTYGTFDSSKSSTFQSNDT 151

Query: 206 YFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSG 264
            F ISYGDG+FA GT+GTDV+ L D L++  +S AVA+ TNS+MGVLGIGL  LE TYS 
Sbjct: 152 DFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSS 211

Query: 265 STASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYT 324
           + + +   +Y YDNFPI LK SG I+S  YSLYLND  +  G ILFG VDHSKYTG LYT
Sbjct: 212 TKSVNEKTSYMYDNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYT 271

Query: 325 IPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVV 384
           +P+++  S + + +P++FDVT             KTLT T+   LLDSGTT +YLP  +V
Sbjct: 272 VPMLS--STTSYKTPVEFDVTLNGIGIIDSSGNKKTLTATQFYGLLDSGTTFSYLPSALV 329

Query: 385 SMIATELGAQYSSRIGYYVLDCPSDDS--MEIVFDFGGFHINAPLSSFILSTGT-TCLLG 441
           +MI  ELGA Y S IGYY +DC ++DS   +IVFD GGFHIN  LS F++   T TC+L 
Sbjct: 330 AMIGEELGASYDSNIGYYTIDCSAEDSDDTKIVFDMGGFHINTTLSDFVIQISTSTCILS 389

Query: 442 IIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSE-NIEIITSSVPSAVKAP 500
           I+P   D   +LGDSFL NAY+VYDL+N EI+MAQA +++T E NI++I++++PSA++AP
Sbjct: 390 IVP--QDGKVVLGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAP 447

Query: 501 GYTNTWSTSASIVTGGNIFT 520
           GY++TWSTS SI +GG+IFT
Sbjct: 448 GYSSTWSTSRSISSGGDIFT 467

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  434 bits (1117), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 250/541 (46%), Positives = 340/541 (62%), Gaps = 33/541 (6%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSN-SKFVKLPFHKLYGDSLENVGSDKK 59
           MKL   +  + +SL  +     I+   +K+  D N +K++KL F K  G+S      DK 
Sbjct: 1   MKLLNSKLILSTSLITALTDASIVAKDSKQPSDFNKNKYLKLGFDKYVGESF-----DKS 55

Query: 60  PEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
            +  L KRA+ Y    +TNQ SFYSV+L +GTP QNVTVLVDTGSSDLW+ GSDNP CS+
Sbjct: 56  SKDSLQKRAE-YAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSDNPLCST 114

Query: 120 NSMGS-------SRRR----VIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXX 168
           +S           ++R    V+ +    +  G+ ++ ++PFGWL G+             
Sbjct: 115 DSSDDDDDSYAFKKKRAETIVVTEEATITENGNNLDGLDPFGWLGGS--------TATSG 166

Query: 169 XXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDL 228
                  S  +S    DC +Y                 F ISYGD + A G +G DVL +
Sbjct: 167 SFETSFPSSSSSSGDFDCSEYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSI 226

Query: 229 SDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGA 288
           SD++V+G+SFAVAN TNST+GVLGIGL  LE TYSG+++S S   Y Y+N P++LK+SG 
Sbjct: 227 SDVDVSGVSFAVANYTNSTVGVLGIGLSGLETTYSGTSSSES---YIYENLPMLLKSSGV 283

Query: 289 IKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXX 348
           I +  YSL+LN+     G +LFGAVDHSKY+G+LYT+PIVN  ++ G+ +P++FDVT   
Sbjct: 284 IDTIAYSLFLNEKSDTTGNLLFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYG 343

Query: 349 XXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDC-P 407
                      T+ T KIPALLDSGTT+ Y P+T++ ++A +LGA YS  +G+Y + C  
Sbjct: 344 LGISTSDSNT-TIATMKIPALLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVS 402

Query: 408 SDDSMEIVFDFGGFHINAPLSSFILS-TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYD 466
           S D  E VFDFGGFHI  PLS F++  +G+ C+L +    DD   ILGD FLTNAYVVYD
Sbjct: 403 SSDDTEFVFDFGGFHITVPLSDFLIRVSGSECILAM-AAQDDESIILGDYFLTNAYVVYD 461

Query: 467 LENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQT 526
           LEN EISMAQA Y++  E+IE+I+S+VPSAVKA  Y+N+WS++ SI +GG+IFTV S+ T
Sbjct: 462 LENYEISMAQANYDSEDEDIEVISSTVPSAVKAASYSNSWSSTGSITSGGDIFTVASNST 521

Query: 527 A 527
           A
Sbjct: 522 A 522

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  423 bits (1088), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/524 (45%), Positives = 303/524 (57%), Gaps = 89/524 (16%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPF-HKLYGDSLENVGSDKK 59
           MKL+    A L+ L  S   G+++P         + K+VK+PF  K  GD+ E       
Sbjct: 1   MKLQLAAVATLAVL-TSPAFGRVLP---------DGKYVKIPFTKKKNGDNGE------- 43

Query: 60  PEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
               L KR++G+E+ ++ N+QSFYSV+L +GTP QN+TVL+DTGS+DL            
Sbjct: 44  ----LSKRSNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADL------------ 87

Query: 120 NSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPA 179
                                          W+ G G+                    P 
Sbjct: 88  -------------------------------WVPGKGN--------------------PY 96

Query: 180 SEATMDCQQYXXXXXXXXXXXXXXXXY-FSISYGDGTFASGTFGTDVLDLSDLNVTGLSF 238
             + MDC QY                  F  +YGDGT+A G FG D L  ++L+++GLSF
Sbjct: 97  CGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSF 156

Query: 239 AVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL 298
           AVANE+NST GVLGIGL  LEVTYSG  A    ++Y+YDNFP+ LK+SGAI +  YSL+L
Sbjct: 157 AVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFL 216

Query: 299 NDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXX 358
           ND     G+ILFGAVDHSKY G LYTIP+VN   + G+  P+ FDVT             
Sbjct: 217 NDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNI 276

Query: 359 KTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFD 417
            TLTTTK+PALLDSGTTLTYLP   V+++A  L A YS  +GYY   CP SD+   + FD
Sbjct: 277 -TLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFD 335

Query: 418 FGGFHINAPLSSFILSTGT-TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQ 476
           FGGF INAPLS F + T   TC+L IIP + +   ILGDSFL NAYVVYDL+N EIS+AQ
Sbjct: 336 FGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQ 395

Query: 477 ARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFT 520
           A+Y T  EN+E+I S+VPSA++AP Y NTWS  AS  +GGNIFT
Sbjct: 396 AKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIFT 439

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  422 bits (1086), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 242/542 (44%), Positives = 320/542 (59%), Gaps = 47/542 (8%)

Query: 32  DDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGT 91
           D+   K+V L F KL G+S E  G   KP   L KR DGYEEI I N+Q+FYS++LE+GT
Sbjct: 25  DEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGT 84

Query: 92  PPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGW 151
           P QNVTVL+DTGSSDLW+   +NPYC            ID            +D  P   
Sbjct: 85  PSQNVTVLLDTGSSDLWVSSPENPYC------------IDS-----------DDTKPVTQ 121

Query: 152 LTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISY 211
           L+                      S  +  AT+DC +Y                 FSISY
Sbjct: 122 LS---------TSTLATSSGTATSSGNSGIATVDCSEYGTFDPSKSTSFRSNNTAFSISY 172

Query: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSG 271
           GD TFASGT+GTD  DL DLNVT LSFAVAN++NST+GV+GIGL  L+ TY G  ++ SG
Sbjct: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG 232

Query: 272 KAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL 331
            AY+Y+NFP+ LK+ G I  N YSL+LN+ DA  G++LFGAVDHSKY+G LYT+P++N  
Sbjct: 233 -AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMY 291

Query: 332 SASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATEL 391
              G  +PI+FDVT             + LT T+ PALLDSGTTL+Y+P T+  +IA  +
Sbjct: 292 RNRGIQNPIEFDVT-VQGVSVTSGSTIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAV 350

Query: 392 GAQYSSRIGYYVLDCPSDDS-MEIVFDFGGFHI---NAPLSSFILSTGTTCLLGIIPTSD 447
           GAQYS   GYY + CPS+++   + FDFGGF I    +       S+ +TC LG+IP + 
Sbjct: 351 GAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTS 410

Query: 448 DTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWS 507
           +   I GD+FL +AYVVYDLEN EISMAQA +N +   IE+I+ S+PSAV+A GY++TWS
Sbjct: 411 N-AAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469

Query: 508 TSASIVTGGNIFTVNSSQTASFSGNLXXXXXXXXXXXXKRNVGDHIVPSLPLTLISLLFA 567
           T+ +I T G+     +++T + S N             +  VGD + PS    L + + +
Sbjct: 470 TNQAISTSGSGSGSGTARTTTTSSN--------GASGARNAVGDTLAPSPLFLLFATIIS 521

Query: 568 FI 569
           F 
Sbjct: 522 FF 523

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  416 bits (1070), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 236/522 (45%), Positives = 299/522 (57%), Gaps = 87/522 (16%)

Query: 3   LKTVRSAVLS-SLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPE 61
           +K + +A +S ++ +S  +G+++P           K+VK+PF K  G+S  +V       
Sbjct: 1   MKVLLAAAVSLTVLSSLAVGRVLP---------EGKYVKMPFVKK-GNSESSV------- 43

Query: 62  VRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121
             L KR+ G+E  ++ N+QSFYSV+L +GTP QN+TVL+DTGS+DL              
Sbjct: 44  --LSKRSSGHENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADL-------------- 87

Query: 122 MGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASE 181
                                        W+ G G+                    P   
Sbjct: 88  -----------------------------WVPGKGN--------------------PYCG 98

Query: 182 ATMDCQQYXXXXXXXXXXXXXXXXY-FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 240
           + MDC QY                  F  +YGDGTFA G FG D L  ++L+++GL FAV
Sbjct: 99  SVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLSGLPFAV 158

Query: 241 ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND 300
           ANE+NST GVLGIGL  LEVTYSG  A    ++Y+YDNFP+ LK+SGAI +  YSL+LND
Sbjct: 159 ANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSLFLND 218

Query: 301 SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKT 360
                G+ILFGAVDHSKY G LYTIP+VN   + G+  P+ FDVT              T
Sbjct: 219 ESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKRNT-T 277

Query: 361 LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFG 419
           LTTTK PALLDSGTTLTYLP   V+++A  L A YS  +GYY   CP SD+   I FDFG
Sbjct: 278 LTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSIAFDFG 337

Query: 420 GFHINAPLSSFILSTGT-TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQAR 478
           GF INAPLS F + T   TC L +IP + +   ILGDSFL NAYVVYDL+N EIS+AQA+
Sbjct: 338 GFRINAPLSDFTMQTSVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAK 397

Query: 479 YNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFT 520
           Y    ENIE I S+VP A +AP Y NTWST AS+ +GGNIFT
Sbjct: 398 YGKAKENIEAIKSTVPGATRAPSYNNTWSTYASVTSGGNIFT 439

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  413 bits (1061), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 237/525 (45%), Positives = 305/525 (58%), Gaps = 86/525 (16%)

Query: 3   LKTVRSAVLS-SLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPE 61
           +K + +A +S ++  +  LG I+P           K+VK+PF K   D   NV       
Sbjct: 1   MKVISAAAVSLAVLNTLALGSILP---------REKYVKIPFVK-NQDGAGNV------- 43

Query: 62  VRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121
             L KR++G+E+ ++ N+QSFYSV+L +GTP Q++TVL+DTGS+DLW+    NPYC S  
Sbjct: 44  --LGKRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGS-V 100

Query: 122 MGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASE 181
           M   +  V DK   S+      N  +PF    G G                         
Sbjct: 101 MDCDQYGVFDKTKSSTFKA---NKSSPFYAAYGDG------------------------- 132

Query: 182 ATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA 241
                                       ++  G F     G D L  + L+++GLSFAVA
Sbjct: 133 ----------------------------TFAQGAF-----GQDRLKYNGLDLSGLSFAVA 159

Query: 242 NETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDS 301
           NE+NST GVLGIGLP LEVTYSG  A    K+Y+YDNFP+ LK SGAI +  YSL+LND 
Sbjct: 160 NESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLNDE 219

Query: 302 DAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTL 361
               G+ILFGAVDHSKY G LYT+P+VN   + G+  P+ FDVT              TL
Sbjct: 220 SQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRHNT-TL 278

Query: 362 TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGG 420
           T TKIPALLDSGTTLTYLP   V+++A  L A YS  +GYY   CP SD+   + FDFGG
Sbjct: 279 TATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSVAFDFGG 338

Query: 421 FHINAPLSSFILST--GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQAR 478
           FHINAP+S F + T  G TC+L +IP + +   ILGDSFL NAYVVYDL+N E+S+AQA+
Sbjct: 339 FHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLAQAK 398

Query: 479 YNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNS 523
           Y T +E+IE I S+VPSA +APGY +TWS  AS+ +GGNIFT  S
Sbjct: 399 YGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNIFTTAS 443

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  416 bits (1068), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 252/535 (47%), Positives = 336/535 (62%), Gaps = 25/535 (4%)

Query: 1   MKLKTV-RSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKK 59
           MKL  V   A+L+SL ++   G I      +  ++N K V + F KL G+        K+
Sbjct: 1   MKLSDVCLGALLASLGSA---GYITKRDVSQVGEANKKHVFMSFDKLRGNDASEASLSKR 57

Query: 60  PEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
               L KRADGY ++ I NQ +FYSVDLE+GTP Q V VL+DTGSSDLW+ GS NP+CS+
Sbjct: 58  RVGHLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFCSA 117

Query: 120 NSMGSSRRRVIDKRDDSSSGGSLIN--------DINPFGWLTGTGSXXXXX---XXXXXX 168
           +   S ++    ++D ++   SL++        D    G  + TGS              
Sbjct: 118 SRSSSKKK----RQDYTALLSSLLSVFGTDVATDYTYTGIASATGSAGTQTVPTALTSGT 173

Query: 169 XXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDL 228
                 +SVP+S AT+DC ++                 F ISY DGTFA G +G D + L
Sbjct: 174 VAATSIRSVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHL 233

Query: 229 SDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGA 288
            D+NVTGLSFAV+N T+S  GVLGIGL   E TYSG  +++    Y+YDNFPIVL+ +G 
Sbjct: 234 DDVNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTY--NRYQYDNFPIVLQRNGV 291

Query: 289 IKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXX 348
           I+ N YS++LND DA  G+ILFGAVDHSKYTGTLYT+P+VN L + G++  I+  +T   
Sbjct: 292 IEKNAYSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQG 351

Query: 349 XXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS 408
                     +T+T TK PALLD+G T  Y P ++ + IA+ + A YSS  GYY +DC S
Sbjct: 352 IGVTSSYGN-ETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCDS 410

Query: 409 DDSMEIVFDFGGFHINAPLSSFILSTGTT--CLLGIIPTSDDTGTILGDSFLTNAYVVYD 466
               ++VFDFGGFHI +PLS +I++T ++  C+LGI+P SD+  T LGD+FLT+AYVVYD
Sbjct: 411 GSDYDLVFDFGGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEIT-LGDAFLTSAYVVYD 469

Query: 467 LENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTV 521
           LE LEIS+AQA Y +  E IE+I  SVPSAV APGY++TWST+AS+ TGGNIFTV
Sbjct: 470 LEELEISLAQASYTSGDEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIFTV 524

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  410 bits (1055), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 243/507 (47%), Positives = 306/507 (60%), Gaps = 70/507 (13%)

Query: 32  DDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGT 91
           D     +V L F K YGDS E  GS       L KR  GYE + + N+Q+FYSVDL++GT
Sbjct: 28  DSKQPDYVNLKFKKTYGDSFE--GSTTWSA--LAKRTRGYELVDLVNRQNFYSVDLDIGT 83

Query: 92  PPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGW 151
           P Q +TVLVDTGSSDLW+ GSDNPYC S                     +L++  N F  
Sbjct: 84  PSQTITVLVDTGSSDLWVTGSDNPYCVS------------------VKSNLVSSTNKF-- 123

Query: 152 LTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISY 211
                                            DC  Y                 FSI+Y
Sbjct: 124 ---------------------------------DCNTYGTFDKNQSSTWSSNDTLFSITY 150

Query: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSG 271
           GD +FA GT+G D L L DL+V+GLSFAVAN TNST+GVLGIGLP LEVTY  +  +   
Sbjct: 151 GDTSFARGTWGQDKLHLDDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTYINAPRNR-- 208

Query: 272 KAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL 331
             Y+YDNFP++LKNSGA  SN YSL+L+  +A HGT+LFGAVDHSKYTG+LYTIP+VNTL
Sbjct: 209 --YQYDNFPMILKNSGATHSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTL 266

Query: 332 SASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATEL 391
              GFS P +F+VT                T TKI ALLDSGTTLTYLPQ +V +IA  +
Sbjct: 267 KTHGFSDPAKFEVTLQGVGIVANNTQTTL-TNTKIAALLDSGTTLTYLPQALVQVIADSI 325

Query: 392 GAQYSSRIGYYVLDCPSDDSME--IVFDFGGFHINAPLSSFILST-GTTCLLGIIPTSDD 448
           GA++SSR GYY++ C + ++ +  +VFDFGGFHIN  L+ FI+ T G  CLL II  +  
Sbjct: 326 GARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHINGKLTDFIVETFGNVCLLTIIEETGS 385

Query: 449 TGTILGDSFLTNAYVVYDLENLEISMAQARYNT-TSENIEIITSS--VPSAVKAPGYTNT 505
              ILGD+FL NAYVV+DLEN EISMAQA +N    ++IEI+TS+  V SAV A GY++T
Sbjct: 386 NSAILGDNFLINAYVVFDLENNEISMAQALHNVDDDQDIEIVTSNAGVASAVTALGYSST 445

Query: 506 WSTSASIVT--GGNIFTVNSSQTASFS 530
           W+   S +    G+IFTV++  TA+++
Sbjct: 446 WTAEPSTIETFAGDIFTVSAGATANYT 472

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  412 bits (1058), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 243/513 (47%), Positives = 321/513 (62%), Gaps = 13/513 (2%)

Query: 30  RDD--DSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDL 87
           RD+   S SKFVK+ F KL GD+ E+  +       L KRADG E ++I NQQ+FYSV+L
Sbjct: 24  RDEGAQSASKFVKVSFDKLRGDTAEDATAGAVAHGVLAKRADGSETVVIKNQQTFYSVEL 83

Query: 88  EVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRV----IDKRDDSSSGG--S 141
            VG+P QNVT+L+DTGSSD+W+MGS+NPYC   S G+S+  +    +D RD+  +    S
Sbjct: 84  GVGSPAQNVTLLIDTGSSDMWVMGSNNPYCEGGSSGNSKHVLLGDHVDSRDEEVNRDWFS 143

Query: 142 LINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXX 201
            +             +                  SV +  AT+ C  Y            
Sbjct: 144 TLRSFLTATATATATATATATGSADSGGNAPSRTSVNSQYATLTCSSYGTFATDSSSSFQ 203

Query: 202 XXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVT 261
                F I YGD T+A GT+G D + L D+ ++G+S AVANE+NST GVLGIGL  LEVT
Sbjct: 204 SNNTAFYIEYGDSTYALGTWGRDNVTLQDITLSGISMAVANESNSTFGVLGIGLAALEVT 263

Query: 262 YSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGT 321
             G+ A+  G +Y Y+N P  + + G I  N YSL+L+  DA  G++LFGAVDHSKYTG+
Sbjct: 264 NVGTLATR-GNSYTYENLPAKMVSEGIIHKNAYSLFLDSLDAKEGSVLFGAVDHSKYTGS 322

Query: 322 LYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQ 381
           LYT+P+ N+  + G+S PIQ +VT                TTT + ALLDSGTTLTYLP 
Sbjct: 323 LYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTANNTNSTF-TTTPLTALLDSGTTLTYLPT 381

Query: 382 TVVSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFIL-STGTTCL 439
           T+V  +A + GA+Y S  GYY+L C    D+ E+VFDFGGFHIN+ + +F++ +T   C 
Sbjct: 382 TLVRQVAAKYGARYDSSYGYYLLSCSDVKDTDELVFDFGGFHINSKVENFLIRATSNICA 441

Query: 440 LGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKA 499
           LG+IP S  +  ILGD+FLT AYVVYDL+NLEIS+AQA Y+  S NIE+I+SSVPSAVK 
Sbjct: 442 LGLIPQSSSS-LILGDNFLTAAYVVYDLDNLEISLAQANYDGGSSNIEVISSSVPSAVKG 500

Query: 500 PGYTNTWSTSASIVTGGNIFTVNSSQTASFSGN 532
           P Y++TWSTS  I TGGNIFTV+ S + + +GN
Sbjct: 501 PSYSSTWSTSVPISTGGNIFTVSGSNSTTTAGN 533

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  408 bits (1049), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 241/533 (45%), Positives = 327/533 (61%), Gaps = 28/533 (5%)

Query: 26  AANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSV 85
           A ++  ++   K VKL F K +G++ E     K+  +  +KR DG  E+ + N+Q+FYSV
Sbjct: 20  AFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSV 79

Query: 86  DLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDD---------- 135
           DLEVG+P Q +TVL+DTGSSDLWI GSDNPYC SNS  S +R + D   D          
Sbjct: 80  DLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGG 139

Query: 136 --------SSSGGSLINDINPFGWL---TGTGSXXXXXXXXXXXXXXXXXQSVPASEATM 184
                   + +GGS+ +    FG +   TG                     S  +   ++
Sbjct: 140 SGAIYKTLTLTGGSMPSSFGSFGSIDVSTGGIEPTETISGGGGGSGGSPTGSSSSGGQSI 199

Query: 185 DCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANET 244
           DC +Y                 F ISYGDG+FASG +G D ++L  LN++ +S AVAN+T
Sbjct: 200 DCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDT 259

Query: 245 NSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAM 304
           NST+GVLGIGLP LE TYS   +  SG  + Y NFP+VLK  G  K N YSLYLN  DA 
Sbjct: 260 NSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319

Query: 305 HGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTT 364
           +G+ILFGAVD SK+ G+LYTIPI+N   + G S PIQFDVT                +TT
Sbjct: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTL-STT 378

Query: 365 KIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD-DSMEIVFDFGGFHI 423
           KIPALLDSG+TL YLP+ ++ M+A  LGA++S  + YY++DCPS  D  +IVF+FGGF+I
Sbjct: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438

Query: 424 NAPLSSFILSTGT-TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTT 482
              L+++     + TC+L I+P S D+  ILGD+FL +AYVVYDLE+ EISMAQA ++  
Sbjct: 439 ETNLTTYTTPISSDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVN 497

Query: 483 SENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIF---TVNSSQTASFSGN 532
            E+IE+++SS+P A  A GY++T+S+S SI +GGNIF   T++ S + + SGN
Sbjct: 498 HEDIEVVSSSIPQATAAAGYSSTYSSSKSITSGGNIFSSGTLSGSASNTASGN 550

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  402 bits (1033), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/567 (41%), Positives = 319/567 (56%), Gaps = 64/567 (11%)

Query: 64  LLKR--ADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121
           L KR   DGY  + + NQ SFYSVDLE+GTPPQ VTVLVDTGSSDLW+MG+DNP C+S  
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64

Query: 122 MGS--------SRRRVIDKRDDS--------------SSGGSLINDIN---PFGWLTGTG 156
            G         +R  +  ++ D                 GG++ N +      GW   TG
Sbjct: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWTMMTG 124

Query: 157 SXXXXXXXXXXXXXXXXXQSVPA------SEATMDCQQYXXXXXXXXXXXXXXXXYFSIS 210
           +                   VPA      +EAT+ C  Y                 F+IS
Sbjct: 125 AENTMMMTGTGTETAVAT-GVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAIS 183

Query: 211 YGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST---- 266
           YGD ++ASG++G D + ++ LNV+G+SFAVAN +NS+MGVLGIGLP LEVT   S     
Sbjct: 184 YGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASG 243

Query: 267 ----ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTL 322
               A+ S   Y+Y NFP+VLKN G I    YSL+LND     G++LFGAVDHSKYTGTL
Sbjct: 244 KKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTL 303

Query: 323 YTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQT 382
           YT+P+V+    S  S P++FD+T              T+ TT IPALLDSGTT++Y P  
Sbjct: 304 YTVPLVDIYHDSASSKPVEFDIT-LYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQ 362

Query: 383 VVSMIATELGAQYSSRIGYYVLDCPSDDS-MEIVFDFGGFHINAPLSSFIL-STGTTCLL 440
           + + IA +  A Y SR G+Y + C  D S   +VFDFGGFHI APL  F++  +  TC+L
Sbjct: 363 LANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVL 422

Query: 441 GIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTT-SENIEIITSSVPSAVKA 499
            I P  ++   +LGD FL+NAYVVYDLENLE+SMAQA ++++  E++E+I+S+VPSAVKA
Sbjct: 423 AIGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKA 481

Query: 500 PGYTNTWSTSASIVTGGNIFTVN-----------------SSQTASFSGNLXXXXXXXXX 542
             Y+N WS++  + TGGNIFTV                  +S+  S S            
Sbjct: 482 ASYSNPWSSAVMMSTGGNIFTVEGASNTTGSSSTRSGSRITSRVGSSSSTRRSEASSSMG 541

Query: 543 XXXKRNVGDHIVPSLPLTLISLLFAFI 569
              ++N G  ++PS    + + + +F+
Sbjct: 542 TNQRKNAGAIVLPSFSTAIFTFIASFL 568

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  399 bits (1025), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/509 (44%), Positives = 313/509 (61%), Gaps = 23/509 (4%)

Query: 32  DDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGT 91
           + ++S  VKL F+K +G + E    +++    L  R +     I+ NQQ+FYSVDL VGT
Sbjct: 23  EQTSSPMVKLSFNKWHGPTYEESSLERR---SLETRNNKEFNFIVENQQNFYSVDLLVGT 79

Query: 92  PPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRR---RVIDKRDDS-----SSGGSLI 143
           P QN+TVL+DTGSSDLW+   +NPYC SN+  + ++   R+ D  + S     ++ G+  
Sbjct: 80  PGQNITVLLDTGSSDLWLTAKNNPYCKSNAGSNDKKEDYRLEDGDNQSIVSMLTASGTGT 139

Query: 144 NDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXX 203
           N I   G  T                      S P  E TMDC QY              
Sbjct: 140 NPIGGSGIPTAISGSAQLTGTYTSGTGTGPSGSSP--EPTMDCSQYGTFDVNKSKSFRSN 197

Query: 204 XXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 263
              F ISYGDG+FASG +GTD ++ +++N+ G+SFAVANETNST+GV GIGLPE E TY+
Sbjct: 198 KTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANETNSTVGVFGIGLPENEATYT 257

Query: 264 GSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLY 323
              + +    Y+Y NFP VLK+ GAI    YSL+LN  DA  G ILFGAVD SKY G LY
Sbjct: 258 PDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDASSGDILFGAVDRSKYKGDLY 317

Query: 324 TIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTV 383
           T+P++N+   + + +P++FDVT                TTTKIPALLDSGT+L YLP  +
Sbjct: 318 TLPLLNS-DPTKYKNPMEFDVTLQGVGFTNGSSKTTF-TTTKIPALLDSGTSLIYLPDAL 375

Query: 384 VSMIATELGAQYSSRIGYYVLDCPSD-DSMEIVFDFGGFHINAPLSSFILST-----GTT 437
              IA +LG  Y+  IGYYV+ CPS+ D  ++VFDFGGF I   LS+++L +      + 
Sbjct: 376 AKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTIKNNLSNYLLGSPDDGDDSQ 435

Query: 438 CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAV 497
           C+LGI+P+  D   ILGD FL +AYVVYDL++ E+S+AQA ++ + E+I+II+ S+P A 
Sbjct: 436 CVLGILPS--DVQAILGDVFLADAYVVYDLDDYEVSLAQASFDNSKEDIQIISDSIPGAK 493

Query: 498 KAPGYTNTWSTSASIVTGGNIFTVNSSQT 526
           +APGY+ TWST ASI +GGNIFT ++ +T
Sbjct: 494 RAPGYSKTWSTPASIKSGGNIFTSSNKKT 522

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  399 bits (1026), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 236/521 (45%), Positives = 310/521 (59%), Gaps = 29/521 (5%)

Query: 24  IPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFY 83
           I A  K   D  SKFVKL F KL GD +EN  + + P V+ +KR DG     I NQ +FY
Sbjct: 21  ISAEAKYSQD-ESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFY 79

Query: 84  SVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKR---DDSSSGG 140
           SV + VG+P Q+VT+L+DTGSSD+W+MGS+NPYC  +S G S+  ++ +    +D ++G 
Sbjct: 80  SVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSS-GKSKHVLLHEDSGFEDDTNGK 138

Query: 141 SLINDINPF------------GWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQ 188
              +D+  +             W T T                    S+ + +AT+ C +
Sbjct: 139 DFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSE 198

Query: 189 YXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM 248
           Y                 F I YGD ++A G +G D + L D+ V+ +S AVAN +NST 
Sbjct: 199 YGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTF 258

Query: 249 GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTI 308
           GVLGIGLP LEVT   + A     AY Y NFP +L + G I+ + YSL++ND +A HG++
Sbjct: 259 GVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSV 316

Query: 309 LFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPA 368
           LFGAVDHSKYTGTL TIP+VN++ ++    PIQFDVT                TTT  PA
Sbjct: 317 LFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLNDTNTTI-TTTPFPA 375

Query: 369 LLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPL 427
           LLDSGTT T+LP  +VS IA +L A+Y    G+Y   C    DS E+VFDFGGFHI + L
Sbjct: 376 LLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKL 435

Query: 428 SSFILST-------GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN 480
            +F L+T          C L +IP +     ILGD+FLT AYVVYDLENLEISMAQA  +
Sbjct: 436 DNFALATYDDDDNETDVCALALIPYNRGE-IILGDNFLTAAYVVYDLENLEISMAQANLD 494

Query: 481 TTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTV 521
             SE+IE I S+VPSAVKAPGY++TW+++  I TGGNIFT+
Sbjct: 495 GGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  393 bits (1009), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/535 (44%), Positives = 314/535 (58%), Gaps = 54/535 (10%)

Query: 26  AANKRDDDSNSKFVKLPFHKLYGDSLENVGSD-----KKPEVRLLKRADGYEEIIITNQQ 80
           A  + +D    K ++L  +K YGDS  N+GS+       P  RL+KR DG+E I I NQQ
Sbjct: 17  ACFENNDAFQDKVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQ 76

Query: 81  SFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSG- 139
           +FYSVDL +GTPPQ VTVLVDTGSSDLW+ G++NPYC     G+S + V    +D S   
Sbjct: 77  AFYSVDLMLGTPPQKVTVLVDTGSSDLWVTGNNNPYCID---GTSSKAVSSNIEDDSQTK 133

Query: 140 -------GSLINDINPF--------GWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATM 184
                  G+ IN I  +         +L  +GS                 + V   +A +
Sbjct: 134 NPISKVVGTTINKIRKYFSHNLPDLSFLEDSGS---------GKYNSSQLKDVTPQDAHI 184

Query: 185 DCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANE 243
           DC  Y                 F I YGD TFASGT+G D ++ SD LN+T  SF VA+ 
Sbjct: 185 DCSTYGTFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADL 244

Query: 244 TNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDA 303
           TNST+ VLG+GLP LEVTYSG +   S   Y Y NFP+ LK SG I    YSLYLN + A
Sbjct: 245 TNSTISVLGMGLPRLEVTYSGLSLDRS--PYTYANFPMALKQSGLIDRMVYSLYLNKAGA 302

Query: 304 MHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTT 363
             G++LFGAVDHSKY G+L TIP++ +LS SG   PI F+V              +T  +
Sbjct: 303 STGSVLFGAVDHSKYHGSLNTIPLI-SLSGSGI--PIAFNVALQGLGMSSDSQGTQTFLS 359

Query: 364 TKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFH 422
           T +PALLDSGTT+TYLP  +V+ +A+ LGA +    G Y+LDCPS  D  E  FDFGGF 
Sbjct: 360 TPLPALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQ 419

Query: 423 INAPLSSFILST-GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNT 481
           I+ PLS+FIL      C+L +  +  +   ILGDSFLT AYVVYDLENLEISMAQARY+ 
Sbjct: 420 ISVPLSNFILEALPDVCVLTLFESHAERA-ILGDSFLTEAYVVYDLENLEISMAQARYDD 478

Query: 482 TSEN------------IEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSS 524
            +++            +E++TS++PSA +APGY++T    ++I   GN++ V+++
Sbjct: 479 DNDSDIEKYNADNKVLLEVVTSNIPSANQAPGYSSTLINRSTIQPSGNMYAVSNA 533

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  389 bits (999), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/529 (44%), Positives = 314/529 (59%), Gaps = 78/529 (14%)

Query: 12  SSLFASQV----LGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLE--------NVGSDKK 59
           S LF + V    LG ++     R    N+ F+ L F+KLYG S +        N+G    
Sbjct: 6   SQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNL 65

Query: 60  --PEVRLLKRADG-YEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPY 116
              +  L KRA   Y+E+ I NQQSFYS+DL +GTP QNVTV +DTGSSDLW+ GS+NPY
Sbjct: 66  NFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPY 125

Query: 117 CSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQS 176
           C+                     GS  +D                              +
Sbjct: 126 CN---------------------GSTFSD------------------------------T 134

Query: 177 VPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGL 236
           VP+ E   +C QY                 F I YGD TFASGT+G DV+ ++ LNVTGL
Sbjct: 135 VPSREL-FNCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVTGL 193

Query: 237 SFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSL 296
           +FAVAN +NS+  VLGIGL +LE TY+GS +SHS   Y Y NFP+VLKN+G  +S +YSL
Sbjct: 194 TFAVANASNSSNSVLGIGLTQLETTYNGSNSSHS---YTYANFPVVLKNAGLTESISYSL 250

Query: 297 YLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXX 356
           +LN+ DA  G+ILFGAVDHSKY+G LYT+P+VNT    GF +PI+F VT           
Sbjct: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK 310

Query: 357 XXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDS--MEI 414
              T+T TK+ A+LDSGT+LT LP T++  IA+ L  +YS  I  Y++ C   +S    +
Sbjct: 311 KT-TITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNL 369

Query: 415 VFDFGGFHINAPLSSFILS-TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEIS 473
           VFDFGGF I   LS+FIL      C+LG + + D+   ILGD+FL +AYVVYDLENL+IS
Sbjct: 370 VFDFGGFTIKGTLSNFILEIEDDICILG-LSSVDENSVILGDTFLASAYVVYDLENLQIS 428

Query: 474 MAQARYNTTSENIEII--TSSVPSAVKAPGYTNTW-STSASIVTGGNIF 519
           MAQA+++ ++ +I++I   S VPSA+KAPGY++TW +T +SI TGGNIF
Sbjct: 429 MAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  370 bits (949), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 268/379 (70%), Gaps = 15/379 (3%)

Query: 145 DINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXX 204
           D NPFGW    GS                  S+  S+AT++C  Y               
Sbjct: 229 DWNPFGW----GSTATATTGGNSGYQT---MSLDPSQATINCDTYGTFDIEDSSTFQSNK 281

Query: 205 XYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 263
             F+I Y D ++A+G +G DVL  SD LNVTGLSFAVAN+TNST+GVLGIGLP+LEVTYS
Sbjct: 282 TSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYS 341

Query: 264 GSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG-TL 322
           G     S K Y YDNFP+VLKNSGAI  + YSLYLN  +A +G +LFGAVDHS+Y G TL
Sbjct: 342 G--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTL 399

Query: 323 YTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQT 382
           YT+P+VN  S+SG+S+PI+FD+T                TTT+I ALLDSGTTLTY P+ 
Sbjct: 400 YTVPLVNGDSSSGYSTPIEFDITLQGLGVTDNTNNYTV-TTTQIVALLDSGTTLTYFPKD 458

Query: 383 VVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILSTGT-TCLL 440
           +++++A  + A YS  +GYYV++CP SDD+ +IVFDFGGFHINA L++F+LS+ +  C+L
Sbjct: 459 MLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVL 518

Query: 441 GIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAP 500
           G++P + ++  ILGD FLT+AYVVY+L++LEISMAQA Y+ ++E+IE+ITS+VP+AVKAP
Sbjct: 519 GLLPYNGNSA-ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAP 577

Query: 501 GYTNTWSTSASIVTGGNIF 519
           GY+ T+STS SIV+GGNIF
Sbjct: 578 GYSYTYSTSKSIVSGGNIF 596

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 76/129 (58%), Gaps = 25/129 (19%)

Query: 23  IIPAANKRDDDS----NSKFVKLPFHKLYGDSLENVG---------------------SD 57
           I P  N  +D      NS F+KL F K Y DS+ ++                       +
Sbjct: 22  IPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKE 81

Query: 58  KKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117
            KP V L+KR DGYEEI I NQQSFYSV+L +GTP Q++TVLVDTGSSDLW+ GSDNPYC
Sbjct: 82  SKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141

Query: 118 SSNSMGSSR 126
            SNS  S+ 
Sbjct: 142 KSNSGKSTN 150

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  362 bits (928), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 248/353 (70%), Gaps = 9/353 (2%)

Query: 177 VPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGL 236
           +P SE T+DCQ+Y                 FSISYGD TFASGT+  DVL+LSDLNVTGL
Sbjct: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294

Query: 237 SFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSL 296
           SFAVAN TNST+GVLGIGLP LE TYSG++ +   + Y+Y NFP+VLK SGAI + TYSL
Sbjct: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354

Query: 297 YLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXX 356
           +L+D D  HG++LFGA+DHSKYTG LYT+P++N +  SG+S+PIQFDVT           
Sbjct: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414

Query: 357 XXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDS-MEIV 415
              TLTTTK+ ALLDSGTT++Y P +VV ++A ++ AQYS+R+G+Y + C S  S   +V
Sbjct: 415 NL-TLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLV 473

Query: 416 FDFGGFHINAPLSSFILSTG-TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISM 474
           FDFGGFHI+ PL  F++ T   TC+L + P  +    ILGD FLT+AYVVYDL+N  I++
Sbjct: 474 FDFGGFHISGPLQDFLIQTSQQTCILAMAP-QESQHVILGDIFLTHAYVVYDLDNYVIAL 532

Query: 475 AQA----RYNTTSENIEIIT-SSVPSAVKAPGYTNTWSTSASIVTGGNIFTVN 522
           AQA       ++S +IE+IT S++P A++AP Y+ TW+ +  + +GGNIF  N
Sbjct: 533 AQADTSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGN 585

 Score =  119 bits (298), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 7/101 (6%)

Query: 37  KFVKLPFHKLYGDSLENVGSDKKPEVRLLKRAD----GYEEIIITNQQSFYSVDLEVGTP 92
           K+VKLPF K  GDS E+   + KP  +LLKR +    GYE++ ITNQQSFYSV+L +GTP
Sbjct: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115

Query: 93  PQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKR 133
           PQ+VTVLVDTGS+DLW+ GS NP+C S S+ S  R V+ KR
Sbjct: 116 PQHVTVLVDTGSADLWVTGSMNPFCQS-SLNS--RNVVIKR 153

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  362 bits (928), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/348 (53%), Positives = 232/348 (66%), Gaps = 6/348 (1%)

Query: 178 PASEATMDCQQYXXXXXXXXXXXXXXXXY-FSISYGDGTFASGTFGTDVLDLSD-LNVTG 235
           P   + M+C QY                  F  SYGDGTFA G FG D L  S  L+++G
Sbjct: 96  PYCGSAMNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSG 155

Query: 236 LSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYS 295
           LSFAVAN++NST+GVLGIGLP LEVTYSG  A    ++Y+YDNFP+ LK SGAI +  YS
Sbjct: 156 LSFAVANKSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAYS 215

Query: 296 LYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXX 355
           L+LND     G++LFGAVDHSKY G LYTIP+VN   A G+  P+ FDVT          
Sbjct: 216 LFLNDETQTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRA 275

Query: 356 XXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS--DDSME 413
               TLTTT+IPALLDSGTTLTYLP   V+++A  L A +S  +GYY   CP+  D++  
Sbjct: 276 HNT-TLTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATS 334

Query: 414 IVFDFGGFHINAPLSSFILSTGT-TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEI 472
           +VFD GGFHINAPLS F + T   TC+L I+P + +   ILGDSFL +AYVVYDL+N E+
Sbjct: 335 VVFDLGGFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEV 394

Query: 473 SMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFT 520
           S+AQA+Y +  E+IE I SSVP A +APGY +TW   AS+ +GGNIFT
Sbjct: 395 SLAQAKYGSGKEDIEAIRSSVPGATRAPGYNSTWVNYASVTSGGNIFT 442

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 80/137 (58%), Gaps = 20/137 (14%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           MK+ +  +AV  +L  S V+G ++P         N K+V++PF K              P
Sbjct: 1   MKILSATTAVSLALLNSLVVGSVLP---------NVKYVRIPFAK----------RQNGP 41

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
              L KRA G E  +++N+QSFYSV+L +GTP QNVTVL+DTGS+DLW+  + NPYC S 
Sbjct: 42  GSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNANPYCGS- 100

Query: 121 SMGSSRRRVIDKRDDSS 137
           +M   +  V DK + S+
Sbjct: 101 AMNCDQYGVFDKANSST 117

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  353 bits (906), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 225/586 (38%), Positives = 320/586 (54%), Gaps = 74/586 (12%)

Query: 10  VLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRAD 69
           +L  L A   LG  + A+++    S +K+V++ FHK    S    G D      L +RAD
Sbjct: 2   LLEQLVAGSFLGGAVLASSQA---SPNKYVQMGFHKSRSFS---SGGDS-----LARRAD 50

Query: 70  GYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRV 129
            Y  + + NQQ +YSV+L VGTPPQNV+VL+DTGSSDLW+   DNPYC       S +  
Sbjct: 51  DYLSVDVENQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCIGFKQPGSAKFA 110

Query: 130 IDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEAT------ 183
           +++++  ++  +++   N  G                        +S  A++AT      
Sbjct: 111 LEEKE--AANATVLTAQNAEG----------------------PTRSSKAAKATGGHLDQ 146

Query: 184 MDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 243
            DC                    F   Y D TFASG +GTDV+ + D++V+ +S AV N 
Sbjct: 147 FDCALLGTFNNSESSSFKSNNTDFLTGYADNTFASGFWGTDVVRIGDVDVSDVSLAVVNL 206

Query: 244 TNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDA 303
           TNST  VLGIG+P LE + +G  A+ +  +Y+YDNFP+ LKN G I+   YSL+LNDSDA
Sbjct: 207 TNSTSPVLGIGMPVLESSNAGRLAAETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDA 266

Query: 304 MHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTT 363
             G++LFGAVDHSKY   L+T+P+VNT    G   PI+F VT              T+TT
Sbjct: 267 TEGSVLFGAVDHSKYENGLFTVPMVNTYKDQGVQHPIEFYVT-MYGLGFKKDGFLNTITT 325

Query: 364 TKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFH 422
           T  P LLDSG+T +YLP T+VSM+A+ L A +S +I  Y L CPS +D+  + FD GGF 
Sbjct: 326 TNFPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGFL 385

Query: 423 INAPLSSFILST-GTTCLLGIIPTSD-DTGTILGDSFLTNAYVVYDLENLEISMAQARYN 480
           I+ PLS  +       C+L +    + + G ILGD+FL++AYVVYDLE+ EIS+ QA   
Sbjct: 386 IDVPLSDLVAKRHKNQCVLMVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQASTG 445

Query: 481 TTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFT---------------VNSSQ 525
             +E+IE+I S+VP AV+AP Y   W+    I   GNI T                NSS 
Sbjct: 446 DAAEDIEVIKSTVPGAVRAPFYDRPWTGGTVISMSGNISTGPINGSYNGMGATKPRNSSS 505

Query: 526 TASFSGNLXXXXXXXXXXXXKRNVG--DHIVPSLPLTLISLLFAFI 569
           + + SGN+            ++N+G     +PSL   +++L+ +F+
Sbjct: 506 STTLSGNV------------RKNIGVASAGMPSLVTAILALIMSFL 539

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  350 bits (899), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 218/537 (40%), Positives = 300/537 (55%), Gaps = 70/537 (13%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           MK  T+ +     + AS V G  I   N R + S  K ++L F+K       + G+    
Sbjct: 1   MKFTTLNAI---GILASTVSGAAI--ENHRREVS-PKIIQLSFNK-------HGGAANNK 47

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
           ++      +    +  TN+  FYSV+L VGTP Q ++VL+DTGSSDLW+ G+DN +C ++
Sbjct: 48  DILTPTSQNTDISVNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENH 107

Query: 121 SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPAS 180
           ++  S     DK   S +                                      +P+ 
Sbjct: 108 AVSDSNS--TDKPLKSPT--------------------------------------LPSP 127

Query: 181 EATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 240
           + T+DC QY                   I YGD ++A G FG D ++++ L++  +S  V
Sbjct: 128 QPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGV 187

Query: 241 ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND 300
           A++ N T GVLGIGL  LE T +G +++ + K+Y Y+NFP VLK+ G I +N YSL+LN 
Sbjct: 188 AHQANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNS 247

Query: 301 SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXX-----------XX 349
             A  G ILFG VDHSKYTG LYT+PI+NT  A G  +PIQF VT               
Sbjct: 248 PGASQGGILFGGVDHSKYTGPLYTVPIINT-GAPG--NPIQFQVTLQGVGISLDKSNGTN 304

Query: 350 XXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS- 408
                     TLT +K P LLDSGTTL  LP+ V   +A +LGA Y+S   YY L CPS 
Sbjct: 305 TNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQ 364

Query: 409 DDSMEIVFDFGGFHINAPLSSFI-LSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDL 467
           +D+  ++ DFGGF +NA +++ I  S    CLLGI P+  D+GT LGD FL +AYVVYDL
Sbjct: 365 NDNTRLILDFGGFQVNAKITNHITRSQNGECLLGITPSDTDSGT-LGDVFLVDAYVVYDL 423

Query: 468 ENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSS 524
           +N EIS+AQA ++ ++++IE I+SSVPSA KAPGY+NTW+ S SI TGGNIFT  +S
Sbjct: 424 DNYEISLAQADFSDSAQSIEPISSSVPSATKAPGYSNTWTGSESIKTGGNIFTAQTS 480

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  352 bits (903), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/493 (40%), Positives = 288/493 (58%), Gaps = 36/493 (7%)

Query: 29  KRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLE 88
           + ++ S+ K VK  F+K  G +     S++      L + D      + N+Q+FYS+ L 
Sbjct: 28  EEEEASSPKLVKFSFNKHQGRTF--TASEE------LSKRDKDVTFDLKNEQNFYSIKLS 79

Query: 89  VGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINP 148
           VGTP Q V VL+DTGSSDLWI GSDNPYC  +S  S   +    +++ + G        P
Sbjct: 80  VGTPGQEVVVLLDTGSSDLWIPGSDNPYCKESSSFSISNQ---GKENGAEG--------P 128

Query: 149 FGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFS 208
           F  L G                         + AT+DC+++                 FS
Sbjct: 129 FQTLPG-------------GVTATNMSGGSTASATLDCKEFGTFNREDSKTFHSNDTEFS 175

Query: 209 ISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS 268
           +SYGD ++A GT+G D ++++D+N+T +S  VAN+TNS++G++GIGL  LE TY+G    
Sbjct: 176 VSYGDTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGLSNLENTYTGVENV 235

Query: 269 HSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIV 328
            +   +KY NFP++LK  G I+ N YSL+LN  +A  G+ILFGAVDHSKY+G LYT+P++
Sbjct: 236 KNRNTHKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDHSKYSGQLYTVPML 295

Query: 329 NTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIA 388
           N     G   P+Q  VT              T +TT +PALLDSGTTL YLP  +++M+A
Sbjct: 296 NLYQQQGLKDPLQLQVTLQGVGIEANNMTNTT-STTPVPALLDSGTTLVYLPDKMLAMLA 354

Query: 389 TELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTG--TTCLLGIIPTS 446
            +L A +   IGYYV DC   D+  + F+FGGF+I + +S++++S     +C+LG+ P  
Sbjct: 355 EQLNAHWDRGIGYYVTDCSRVDNTNLYFNFGGFNIVSNMSTYVVSRSNENSCVLGLQPGG 414

Query: 447 DDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTW 506
            +   ILGD F+ +AY+V+DL++ EISMAQA Y      +E +T  VPSA+KAPGY++T+
Sbjct: 415 PEA-AILGDMFMQHAYIVFDLDDFEISMAQANYAGGKNQLEAVTQQVPSAMKAPGYSHTF 473

Query: 507 STSASIVTGGNIF 519
           S S  I  GGNIF
Sbjct: 474 SGSQGITGGGNIF 486

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  353 bits (907), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/318 (57%), Positives = 244/318 (76%), Gaps = 8/318 (2%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGS 265
           F+I Y D +FASG +G DVL  SD LNVTGLSFAVAN+TNST+GVLGIGLP+LEVTY+G 
Sbjct: 305 FAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYAG- 363

Query: 266 TASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG-TLYT 324
               + K Y YDNFP+VLKNSGAI  + YSLYLN   A +G +LFGA+DHS+Y G TLYT
Sbjct: 364 -VYQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQSAKNGNVLFGAIDHSQYQGDTLYT 422

Query: 325 IPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVV 384
           IP+VN+ ++SG+S PI+FDVT              T+TTT+I ALLDSGTTLTY P+ ++
Sbjct: 423 IPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTVTTTQIVALLDSGTTLTYFPKDML 482

Query: 385 SMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILSTGT-TCLLGI 442
           +++A  + A YS  +GYYV++CP S D+ ++VFDFGGFHI   L++F+LS+ +  C+LG+
Sbjct: 483 NLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGGFHIKTNLTNFVLSSASGKCVLGL 542

Query: 443 IPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNT-TSENIEIITSSVPSAVKAPG 501
           +P + ++  ILGD FLT+AYVVY+L++LEISMAQA +N    E+IE+I+S++P+AVKAPG
Sbjct: 543 LPYNGNSA-ILGDIFLTHAYVVYNLDDLEISMAQANFNNGNDEDIEVISSTIPNAVKAPG 601

Query: 502 YTNTWSTSASIVTGGNIF 519
           Y+ T+S S SIV GG+IF
Sbjct: 602 YSYTYSVSKSIVPGGDIF 619

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 69/100 (69%), Gaps = 15/100 (15%)

Query: 37  KFVKLPFHKLYGDSLENVG---------------SDKKPEVRLLKRADGYEEIIITNQQS 81
           KF+KL F K Y DS+ ++                 + KP ++L+KR DGYE+I I NQQS
Sbjct: 39  KFLKLEFQKFYADSVNDIPPRDYSFNKRDSVLDLKNSKPYIKLIKRHDGYEKIQIINQQS 98

Query: 82  FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121
           FYSV+L++GTP Q++TVLVDTGSSDLW+ GS+NPYC  NS
Sbjct: 99  FYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYCKGNS 138

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  348 bits (892), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 273/472 (57%), Gaps = 52/472 (11%)

Query: 40  KLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVL 99
           KL F+KL G++ E          + +  ++G+    I NQQ+FYSV+L+VGTP QNV VL
Sbjct: 27  KLSFNKLRGETFE----------KAVGNSNGHANFDIKNQQNFYSVELKVGTPAQNVLVL 76

Query: 100 VDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXX 159
           +DTGSSDLWI GS NPYCS     S+R   +     +SS              T  G   
Sbjct: 77  LDTGSSDLWITGSGNPYCSP----STRNSHLGSAGSNSS--------------TNNGPSS 118

Query: 160 XXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASG 219
                           + P+S AT+DC QY                 F ++YGDG+FA G
Sbjct: 119 TA--------------NFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKG 164

Query: 220 TFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNF 279
            +G D + L  LNV+ +SFAVANE+NST+GV G+GLP  E T    T   +G  Y+Y NF
Sbjct: 165 LWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGVGLPGEEATV---TPGVNGNHYQYKNF 221

Query: 280 PIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSP 339
           P VLK++G ++ N YSLYLN  D+  G ILFGAVDHSKY+G LYT+PIVNT +  G  +P
Sbjct: 222 PQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGV-AP 280

Query: 340 IQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRI 399
            +FDVT                ++ K  ALLDSGTTL YLP  +   +A  LG ++S   
Sbjct: 281 REFDVTVQGITVGNSSSNSTV-SSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPST 339

Query: 400 GYYVLDCPSD-DSMEIVFDFGGFHINAPLSSFILSTG---TTCLLGIIPTSDDTGTILGD 455
           GYY++  PS+ D  +I FDFGGFHI   LS++IL         +LGI+ T  D   I GD
Sbjct: 340 GYYLIPKPSENDDTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDR-AIFGD 398

Query: 456 SFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWS 507
            FL +AYVVYDLE+ EIS+AQA +N+ S +IE I+ SVP A +APGY+ T++
Sbjct: 399 VFLVDAYVVYDLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYT 450

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  349 bits (896), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/487 (43%), Positives = 275/487 (56%), Gaps = 30/487 (6%)

Query: 37  KFVKLPFHKLYGDSLENVGSDKKPEVRLLKRA------DGYEEIIITNQQSFYSVDLEVG 90
           KF++L F + YG+S E+    K   V L KR         YE++I+TNQ +FYSV+L++G
Sbjct: 45  KFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVELDIG 104

Query: 91  TPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLIND-INPF 149
           TP Q VTV+VDTGSSDLWI  + NP+CS+           D  +DS     L+ D I+P 
Sbjct: 105 TPAQKVTVVVDTGSSDLWITETSNPFCSTGD---------DDTEDSVWSPFLLKDKIDP- 154

Query: 150 GWLTGTGSXXXXXXXXXXXXXXXXXQSVP-------ASEATMDCQQYXXXXXXXXXXXXX 202
             L   G                   S+          E  ++C ++             
Sbjct: 155 RVLKHKGKRTTSIDVTATATTGSINISIDLGSNFTLPPEFLINCTEFGTFNTKKSSTFKN 214

Query: 203 XXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTY 262
               F ISYGD TFASG +G DVL   D+NVTGLSF VAN TNST+GVLGIGLPELE TY
Sbjct: 215 NHTDFFISYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTY 274

Query: 263 SGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTL 322
            G+  S +  +Y Y+NFP VLKNSG I    YSL+LN SD+  G++L GAVD SK+   L
Sbjct: 275 FGTVNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKL 334

Query: 323 YTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQT 382
           YT+P++N   + G++ P  F +                + +++IP LLDSGTT+ YLP++
Sbjct: 335 YTVPMLNINPSKGYTDPSAF-LVLMQKMTRYKYGQGHLVPSSRIPVLLDSGTTMVYLPRS 393

Query: 383 VVSMIATELGAQYSSRIGYYVLDCPS---DDSMEIVFDFGGFHINAPLSSFILSTGT-TC 438
           +V  I     AQY   +  Y + CPS    +     FDFGGF I A LS FI+ T    C
Sbjct: 394 IVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPTDNGQC 453

Query: 439 LLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVK 498
           + G+IP   + G ILGDSFLT+AYVVYDLE+ EISMAQA Y+    N   I S+VPSAV+
Sbjct: 454 IFGMIPQDMNVG-ILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIVSTVPSAVR 512

Query: 499 APGYTNT 505
           A  Y+ T
Sbjct: 513 AKYYSAT 519

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  339 bits (870), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 217/488 (44%), Positives = 276/488 (56%), Gaps = 62/488 (12%)

Query: 38  FVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVT 97
           FV + F K YG S+ +    K     L+KR+ G +E+ + N+  FY++D+E+GTP Q+VT
Sbjct: 27  FVGVQFSKRYGKSISDSSLAKG---NLVKRSSGTDEVELINESVFYAIDMEIGTPKQSVT 83

Query: 98  VLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS 157
           VLVDTGSSD W+  S NPYC S S                                    
Sbjct: 84  VLVDTGSSDFWVPSSTNPYCESKS------------------------------------ 107

Query: 158 XXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFA 217
                             S  AS   +DC  Y                 F   Y DG+ A
Sbjct: 108 ----------------ATSTIASSDLIDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSA 151

Query: 218 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKA-YKY 276
           +G +G DV+D     ++ +S AVA++T+S+ GVLGIGL  LE TYSGS A+ S    Y+Y
Sbjct: 152 TGFWGHDVVDFGGQELSDISIAVADQTDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQY 211

Query: 277 DNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGF 336
           DNFPI L     I++N YSLYL+ +    GTILFG VDH+KY+G L TIP++NTL A+G+
Sbjct: 212 DNFPIRLVQENVIQANAYSLYLDPATGSSGTILFGGVDHNKYSGDLNTIPLINTLEANGY 271

Query: 337 SSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYS 396
           +SPI+  VT                TTT+IPALLDSGTTLTYLP  +  ++A ++GA YS
Sbjct: 272 TSPIKLQVTLNGLGVSDGSSTSTV-TTTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYS 330

Query: 397 SRIGYYVLDCPS--DDSMEIVFDFGGFHINAPLS-SFILSTGTTCLLGIIPTSDDTGTIL 453
           S    YVL C +  +DSM IV+DFGGF I  PL+ S    +   C L I  TS    T L
Sbjct: 331 STSNGYVLSCANVDEDSM-IVYDFGGFQIQTPLAGSLYQLSDDQCELAIGSTSSSYAT-L 388

Query: 454 GDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIV 513
           GD FLT+AYVVYDL+N EISMAQ  YN T+E+IEII+ SVP A KA GY NTW+TS SI 
Sbjct: 389 GDLFLTHAYVVYDLDNKEISMAQINYNATTEDIEIISDSVPGATKAAGYYNTWTTSESIT 448

Query: 514 TGGNIFTV 521
            GGNIFT+
Sbjct: 449 AGGNIFTL 456

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  321 bits (823), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 202/477 (42%), Positives = 262/477 (54%), Gaps = 42/477 (8%)

Query: 38  FVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEII---ITNQQSFYSVDLEVGTPPQ 94
           +V + F K  G S ++     +P  +L KRA    E +   + N   FYSV L++GTPPQ
Sbjct: 35  YVAIDFAKAKGISYQDARVGARP-AKLQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQ 93

Query: 95  NVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTG 154
            VTVL DTGSSDLW+  +DNPYCS+   G S     + R D  S  +L     P   ++G
Sbjct: 94  QVTVLFDTGSSDLWVSSNDNPYCSN---GDSTESYANYRADLKSSSALT--AAPTTTISG 148

Query: 155 TGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXY-FSISYGD 213
                                       T+DC QY                  F +SY D
Sbjct: 149 I-----------------------TIAPTIDCAQYGTFNADRSTSLFANYSKPFFVSYND 185

Query: 214 GTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKA 273
            ++A G +  D L +   +++ L FAVA  +NST+GVLG+GL  LE T    + + S   
Sbjct: 186 DSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGVGLQGLESTVHYRSPNISSI- 244

Query: 274 YKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSA 333
             Y NFP+VLK +GAI    YSLYLN  DA  G++LFG VDHSKYTG LYT+P+VNT   
Sbjct: 245 --YPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKD 302

Query: 334 SGFSSPIQFDVTXXXX-XXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELG 392
            G  +P+QFDVT              +T TTTKI AL+DSGTTL Y    +V+ IA  + 
Sbjct: 303 YGVKTPVQFDVTVQGIGIESEKACRQETFTTTKIAALMDSGTTLMYTAPEIVNKIALYVN 362

Query: 393 AQYSSRIGYYVLDCPSD-DSMEIVFDFGGFHINAPLSSFILSTG--TTCLLGIIPTSDDT 449
           A +S   G ++  CPSD D  + +FDFGGF I +PLS++IL T     C LG+I  S + 
Sbjct: 363 ASFSPGYGLFMFRCPSDGDDTQFIFDFGGFQIKSPLSNYILRTDDENICGLGLI--SSNQ 420

Query: 450 GTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTW 506
           GTI GD FL +AYVVYDLENLE+S+AQA +N  S  IE I S +P A +A  Y NTW
Sbjct: 421 GTIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVSEIPRAQRASQYWNTW 477

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  313 bits (802), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 210/540 (38%), Positives = 296/540 (54%), Gaps = 44/540 (8%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           M+L++V  AVL  L  +  +G +I       +   SK V +PF K  G +        K 
Sbjct: 1   MRLESVF-AVL--LLPALGVGSVI-------EPETSKHVSIPFKKAKGKTFSGSADSNKW 50

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
             RL KR D YE + +   +  Y V+L +GTP Q   V +DTGSSDLW+  S NPYC   
Sbjct: 51  RNRLSKRGDDYENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYC--- 107

Query: 121 SMGSSRRRVIDKRDDSSSGGSLIND--INPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVP 178
            M S          +++ G +  +   ++ F  L  + +                 ++VP
Sbjct: 108 -MPSETTHNEKVYGEAAYGETAFDQTALDQFETLLASATEDDPSYTQT--------EAVP 158

Query: 179 ASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSF 238
           +SEAT+DC  +                 F ISY D T A G +  DVL L DL ++ + F
Sbjct: 159 SSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPF 218

Query: 239 AVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL 298
           AVA   +    V G+G P  E T +GS+     + Y+Y NFP++LK+ G +K   YSL+L
Sbjct: 219 AVAVVGDVQTPVFGVGFPGTEST-AGSSVK---EPYEYANFPVLLKSQGYVKKVVYSLFL 274

Query: 299 NDSDAMHGTILFGAVDHSKYTGTLYTIPIV------NTLSASGFSSPIQFDVTXXXXXXX 352
           +  D+  G+ L GAVDHSKY+G LYT+P+       +TLS    S+P +F +T       
Sbjct: 275 DAQDSSSGSFLLGAVDHSKYSGGLYTLPMYSGTDGDDTLS----STPSRFIITLQGLGIS 330

Query: 353 XXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS-DDS 411
                 KT+ TT+    LDSG+T T  P     +IA  LGA YS     YV+ CPS DD 
Sbjct: 331 DKGEN-KTVATTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSKDDD 389

Query: 412 MEIVFDFGGFHINAPLSSFILSTG--TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLEN 469
              V+DFGGF I++PLS+++ +TG  + C+L I  T D    +LGD+FL +AYVVYDLE+
Sbjct: 390 TNFVYDFGGFTISSPLSNYMEATGDDSVCVLDI-DTDDIPYIVLGDAFLVSAYVVYDLED 448

Query: 470 LEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFT-VNSSQTAS 528
            EIS+AQA Y+  SENIE+++ S+PSAVKAP Y++TWST  +  +GGNIFT V +++TAS
Sbjct: 449 YEISIAQANYDGGSENIEVVSDSIPSAVKAPFYSSTWSTYVTATSGGNIFTAVANAKTAS 508

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  309 bits (791), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 166/355 (46%), Positives = 226/355 (63%), Gaps = 13/355 (3%)

Query: 184 MDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 243
           +DC +Y                 F ISYGD +FASG +GTD LDL DLN  GL+FAVA  
Sbjct: 120 LDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNADGLTFAVATA 179

Query: 244 TNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDA 303
           +NS++ VLGIGL  +EVT +          Y+YDN PIVLK +G I    YSLYLND DA
Sbjct: 180 SNSSVAVLGIGLTGIEVTRASGD-----NGYEYDNLPIVLKRNGVIDKTAYSLYLNDLDA 234

Query: 304 MHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTT 363
             G++LFGAVDHSKYTGTL T+P+VN  +  GF  PI+  +T              T++ 
Sbjct: 235 TSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHIT-LNGLGFSSGKKRGTISA 293

Query: 364 TKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDC--PSDDSMEIVFDFGGF 421
           TK+PALLDSGTTL+Y P  + + IA+ +GA +++R+  +++ C     ++++++++FGG 
Sbjct: 294 TKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDLIYNFGGV 353

Query: 422 HINAPLSSFILSTGT--TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARY 479
            I +PL +++  T     CLLGI+PTS +   ILGD FLT+ Y VYDLE LE+S+AQA Y
Sbjct: 354 EITSPLVNYLSETNVEDVCLLGIVPTSSND-IILGDVFLTSVYTVYDLEALEVSIAQAAY 412

Query: 480 NTTS--ENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGN 532
             ++  ENIE+I S+VP A KAPGY+NTWST A I TGGN+F   ++ +    G 
Sbjct: 413 GASAEKENIEVIKSTVPGATKAPGYSNTWSTYAPISTGGNMFNAAANHSEESQGQ 467

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%)

Query: 36  SKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQN 95
           + +V+    K  G+   +      P   L KR D Y ++ I N+Q+FYSV+L +GTP Q 
Sbjct: 29  AAYVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDEYVDVKIHNEQTFYSVNLSIGTPAQE 88

Query: 96  VTVLVDTGSSDLWIMGSD 113
           VTVLVDTGSSDLWI+G+D
Sbjct: 89  VTVLVDTGSSDLWIIGAD 106

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  313 bits (801), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 264/482 (54%), Gaps = 49/482 (10%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEI---IITNQQSFYSVDLEVG 90
           SN  +V   F K  G S        +P  +L +R  G  +    ++ N++ FYSV L +G
Sbjct: 24  SNGDYVSFNFGKSLGSSFHGARGGSRPG-KLHRRDSGSSDSALSVLKNEEVFYSVKLNIG 82

Query: 91  TPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFG 150
           TPPQ++TVL DTGSSDLW+  + NP+C ++  G +RR   D +  S+   +    I+ F 
Sbjct: 83  TPPQDITVLFDTGSSDLWVSSNSNPFCEAD--GVNRRA--DLKSSSTYSVAPSTTIDGF- 137

Query: 151 WLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXX-XXXXYFSI 209
                                   +  P    T+DC ++                  F I
Sbjct: 138 ------------------------EVAP----TVDCAEFGTFNPNKSSTFRPQGNDTFMI 169

Query: 210 SYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASH 269
            YGDGTFA+G +  D L L   +++ L FAVAN ++S +GVLG+GL  LE     S    
Sbjct: 170 MYGDGTFANGLWAKDTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLE----SSADPF 225

Query: 270 SGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVN 329
             +  +Y NFP+VLK +  I    YSLY+N  DA  G++LFGAVDHSKYTG LYTIP+VN
Sbjct: 226 DDEPSQYPNFPVVLKQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVN 285

Query: 330 TLSASGFSSPIQFDVTXX-XXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIA 388
            L+       ++FDVT              KTLTT + PAL+DSGTTL Y+   +   IA
Sbjct: 286 ALAQYFVDEILEFDVTVQGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIA 345

Query: 389 TELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFILSTG--TTCLLGIIPT 445
             LGA  S     Y  +CP+ DD  ++VFDFGGF I  PLS+++L T     C LG++P+
Sbjct: 346 DSLGATMSDDYELYTFECPAKDDDTQLVFDFGGFQITNPLSNYVLETDDEKVCGLGVVPS 405

Query: 446 SDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNT 505
             +   ILGD FL +AYVV+DLENLE+S+ QA  N   E+IE I S+VP A KAPGY++T
Sbjct: 406 YSN---ILGDEFLASAYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSST 462

Query: 506 WS 507
           W+
Sbjct: 463 WT 464

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  310 bits (793), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 193/525 (36%), Positives = 286/525 (54%), Gaps = 30/525 (5%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           MK   +R+ + +S+ AS     I+    ++   + +K++KL F     ++ E   S + P
Sbjct: 1   MKALNLRAILATSVIASLTSALIVDKNVEQLSSNENKYLKLDFAS---ETFEK--SSRLP 55

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN 120
               L++ D Y  + I+  + +Y V L VGTP QNVT+LVDT SSD+W+   DNP C  +
Sbjct: 56  ----LQKRDTYATVNIS-AEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLCDGD 110

Query: 121 SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPAS 180
               +  +       +++  S ++D +  G L G                      +  +
Sbjct: 111 IFYDNVEKTAKHVVVAAAEESTVSDGDSNGLLDG----------EPVSTTPFESSVIYPA 160

Query: 181 EATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 240
           E  +DC  +                 F I+Y D + A G +G DVL +  L+++G+ FAV
Sbjct: 161 EGLVDCGFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAV 220

Query: 241 ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND 300
           AN TNS++GVLGIGLP       GS  ++   +Y YDN P+VLK SG I S  YSL L  
Sbjct: 221 ANYTNSSLGVLGIGLP-------GSETTYLTNSYMYDNLPMVLKKSGVIDSAAYSLLLAA 273

Query: 301 SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKT 360
            +     +LFGAVDHSKY+G+LYTIP++N   + G+ SP++FDVT              T
Sbjct: 274 YNNYTSGLLFGAVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSNT-T 332

Query: 361 LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGG 420
           + T K PALLDSG+T  + P T++++ A +L A YS   G Y +   S  ++  VFDFGG
Sbjct: 333 IATMKTPALLDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLYTIPY-SPANISFVFDFGG 391

Query: 421 FHINAPLSSFI-LSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARY 479
           FHIN P+     +S G    +  I   ++   +LG++FL  AYVV+D EN EISM Q+ Y
Sbjct: 392 FHINLPIRELCSVSYGEPEYILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSY 451

Query: 480 NTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSS 524
           +   E+IE I S+VP AVK   Y+N+WS+  SI +GG+IFT++S+
Sbjct: 452 DYAEEDIEAIISTVPGAVKVASYSNSWSSFGSITSGGDIFTISSN 496

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  307 bits (787), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 206/570 (36%), Positives = 302/570 (52%), Gaps = 44/570 (7%)

Query: 37  KFVKLPFHKLYGDSLENVGSDKKPEVRLLKRA-DGYEEIIITNQQSFYSVDLEVGTPPQN 95
           K++KL F K   D  E +        +L KRA D      +  Q+++YS++LEVGTPPQN
Sbjct: 20  KYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPLVAQENYYSINLEVGTPPQN 79

Query: 96  VTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGT 155
           V++L+DTGSSD+W++GS+N YC  NS   SR       +  +   S +   +P       
Sbjct: 80  VSLLLDTGSSDMWVIGSNNGYCK-NSDNKSRNLDALGSNRFAKRASSVASASPSSATDSD 138

Query: 156 GSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGT 215
           G                    +PA+  T+DCQ                   F  SYGD +
Sbjct: 139 GGDDGDDSGDAEQFYPTAASEIPAAAKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNS 198

Query: 216 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELE---------------- 259
           +ASG +GTD + L +L++  + FAVAN +NS+ GVLG+GLP LE                
Sbjct: 199 YASGLWGTDDVRLGNLSIADVFFAVANFSNSSTGVLGVGLPALESYNPALSDNFNVSDYL 258

Query: 260 -VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKY 318
            V  S +   +  K   Y NFP +LK    I+   YSL+LND++A +G ILFGAVDHSKY
Sbjct: 259 PVNASDADIDNISKP-TYANFPQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSKY 317

Query: 319 TGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTY 378
           TG+L T+P+VN+L   G +   Q ++T              T+   K+PALLDSGTT++Y
Sbjct: 318 TGSLSTLPLVNSLYVEGINDTTQLEITLDGMGLKNSQGQF-TIYNQKMPALLDSGTTVSY 376

Query: 379 LPQTVVSMIATELGAQYSSRIGYYVL-DCPS-DDSMEIVFDFGGFHINAPLSSFI-LSTG 435
           LP  + S++A +L      + G+  L +CP+ +D+ ++VF+FGG  I+   + FI  S  
Sbjct: 377 LPIDLHSLVAKQLKGIVDPQTGFIELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKSDD 436

Query: 436 TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPS 495
             C +  +P   + G +LGD+FL NAY+VYDLE++EIS+AQA +N  +ENIE I  +VPS
Sbjct: 437 DNCYVTFMPQG-EPGILLGDNFLRNAYIVYDLEDMEISIAQANFNGGAENIEAIVKNVPS 495

Query: 496 AVKAPGYTNTWST-SASIVTGGNIF----------------TVNSSQTASFSGNLXXXXX 538
           AVKAPGY+ +++   +S  T GNIF                T+ SS+T+  +        
Sbjct: 496 AVKAPGYSASFTEFPSSYATTGNIFSGYNSTNSTGSAGSKTTMTSSRTSRNTNTASAAGN 555

Query: 539 XXXXXXXKRNVGDHIVPSLPLTLISLLFAF 568
                  K+N G      +P++ IS++  F
Sbjct: 556 SSSSTRAKKNAG--FAHEVPVSAISVIMVF 583

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  295 bits (754), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 178/449 (39%), Positives = 229/449 (51%), Gaps = 65/449 (14%)

Query: 64  LLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMG 123
           L KR      + + N+Q FY+ DL VGTPPQN+TVL+DTGSSDLW+ GSDNPYC SN   
Sbjct: 41  LWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSNETT 100

Query: 124 SSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEAT 183
           +   + I K                                                 + 
Sbjct: 101 TEPSKNITK-------------------------------------------------SV 111

Query: 184 MDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 243
           +DC +Y                 F I+Y D TFA+G +  DV+   D  +  + FAVANE
Sbjct: 112 VDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFAVANE 171

Query: 244 TNSTMGVLGIGLPELEVT--YSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDS 301
           TNST+GVLGIG   LE    Y G+  ++      Y NFP+ LKN+G I    YSLYLN  
Sbjct: 172 TNSTVGVLGIGFERLESVKGYEGAPNTY------YQNFPLALKNNGVIDKTAYSLYLNSL 225

Query: 302 DAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTL 361
           D+  G+ILFG +D +KYTG LYT P+VN +  S  + P +F VT               L
Sbjct: 226 DSSSGSILFGGIDSNKYTGDLYTFPLVN-IHPSVVNKPAKFHVTVQGIGVQSSGSEQSIL 284

Query: 362 TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDC-PSDDSMEIVFDFGG 420
            +TK PALLDSGTTL   PQ     +A  + A Y+   G Y + C P +D  E +FDFG 
Sbjct: 285 MSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDFGD 344

Query: 421 FHINAPLSSFILS--TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQAR 478
             I  PL +FIL+      C  G++PT D    ILGD FL+ AYVVYDLE+ E+S+AQA 
Sbjct: 345 LKIKVPLKNFILAPEDNEYCGFGVLPTVD--TMILGDMFLSAAYVVYDLESYEVSLAQAN 402

Query: 479 YNTTSENIEIITSSVPSAVKAPGYTNTWS 507
           +N+    I+ I  +VP A KA     TWS
Sbjct: 403 WNSDESEIQAIRHTVPGATKATA--ATWS 429

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  288 bits (738), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 189/491 (38%), Positives = 265/491 (53%), Gaps = 26/491 (5%)

Query: 40  KLPFHKLYGDSLENVGSDKKPEVRLLKRADGY--EEIIITNQQSFYSVDLEVGTPPQNVT 97
           K+PF K YG S      D+  ++   ++  G   +EI I+NQ  +YS  + +GTP Q +T
Sbjct: 31  KIPFSKRYGKSF-----DESRQISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQELT 85

Query: 98  VLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINP--FGWLTGT 155
           +L+DTGSSDLWI      +C S+S  +++ +         S  S     +P     L G+
Sbjct: 86  LLLDTGSSDLWIPQKGGYHCQSDSDDATKGKSSGIASQLFSIASAEGGPSPSLTTTLIGS 145

Query: 156 GSXXXXXXXXXXXXXXXXXQSVPASEATMDCQ----QYXXXXXXXXXXXXXXXXYFSISY 211
                               ++ AS     CQ     +                +F I Y
Sbjct: 146 SGGSHPDPLEPTNRNVQPPAAITASALEESCQSSSGNFDPNSSSSFNKNDTVDGFF-IEY 204

Query: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSG 271
           GD ++ASG + TD L + D++V  ++ AVA++TNS++ V GI    LE +  G       
Sbjct: 205 GDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGLESSVFGDNLQ--- 261

Query: 272 KAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL 331
             ++Y+NFP +LK+ G +K N YSLYLN + A  G ILFG VDH+KY+G LYT+P+   L
Sbjct: 262 DPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSGDLYTLPV---L 318

Query: 332 SASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATEL 391
                S P +  V               TLTTT    LLDSGTT  YLP+ V  M+A   
Sbjct: 319 KGQEDSDPWERFVVTVQGIGIKGSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVANAY 378

Query: 392 GAQYSS--RIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGT-TCLLGIIPTSDD 448
           G  +     +  YV+ CPSDD  +IVF+FGGF+I   LS++I   G   C+L I PTSD 
Sbjct: 379 GGSFDDDPEVQSYVISCPSDDE-KIVFNFGGFNIETSLSNYITDNGNGQCILNISPTSDY 437

Query: 449 TGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWST 508
            G ILGDSFL ++YVVYD++N EIS+AQA +++T E++E IT  VP A KAPGY++T+S 
Sbjct: 438 MG-ILGDSFLRDSYVVYDMDNNEISLAQANFDST-EDVEAITGPVPGATKAPGYSSTYSG 495

Query: 509 SASIVTGGNIF 519
             +  TGGNIF
Sbjct: 496 PQTFQTGGNIF 506

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  282 bits (721), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 149/318 (46%), Positives = 195/318 (61%), Gaps = 12/318 (3%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F I YGD T+A GT+GTD LDL   NV GL+FAVA+ +NS++ VLGIGLP +E T S   
Sbjct: 141 FHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHASNSSVAVLGIGLPAMETTMSSQQ 200

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIP 326
                  Y+YDN P+VLK +  IK   YS+++N+ +A  G++LFGAVDHSKY GTL T+P
Sbjct: 201 F-----GYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVP 255

Query: 327 IVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXK--TLTTTKIPALLDSGTTLTYLPQTVV 384
           +VN       + P++  VT             K  TL  +K+PALLDSGTTLTY P  + 
Sbjct: 256 LVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLA 315

Query: 385 SMIATELGAQYSSRIGYYVLDCPSDDSMEI--VFDFGGFHINAPLSSFILSTGT--TCLL 440
             +A   GA++ S    Y++DC S    +   ++DFGGF I +PLS + + T    TC  
Sbjct: 316 DRLARAAGARWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRF 375

Query: 441 GIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAP 500
           GI+P S D   ILGD FLT AYVV+DLE LE+SMAQA Y    E IE+I  +VP AV+AP
Sbjct: 376 GIMPHSSDY-VILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAP 434

Query: 501 GYTNTWSTSASIVTGGNI 518
           GY + W     +V  G +
Sbjct: 435 GYNDPWKAYTPLVFNGEL 452

 Score = 82.0 bits (201), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 59/94 (62%), Gaps = 1/94 (1%)

Query: 19  VLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITN 78
           VL   +  A+  + +  ++FV++ F K  G S     S +    RL KR D + +I I N
Sbjct: 11  VLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDN 69

Query: 79  QQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGS 112
           QQ FYSV+L +GTPPQ V VL+DTGSSDLW++G+
Sbjct: 70  QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  279 bits (714), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 168/474 (35%), Positives = 256/474 (54%), Gaps = 45/474 (9%)

Query: 57  DKKPEVR--LLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDN 114
           +K P+    L+KR D Y  + + N    Y V L VGTPPQN+TV +DTGSSDLW   +DN
Sbjct: 22  EKSPKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADN 81

Query: 115 PYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXX 174
           P+C  N   + + + +   DDS             G+ + +                   
Sbjct: 82  PFCKENKKYAPKGKDVQPLDDS-------------GYPSAS------------------- 109

Query: 175 QSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 234
             VP S  T++C++Y                 F +SY D +FA+G +G+DV+  ++LN++
Sbjct: 110 NQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNELNIS 169

Query: 235 GLSFAVANETNSTMGVLGIGLPELEVTYSGSTA---SHSGKAYKYDNFPIVLKNSGAIKS 291
            ++FA+ +  NS+ GVLG+GLP++E TY G  A    +   +++Y NFPI LK +G I  
Sbjct: 170 NVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQNGVIDK 229

Query: 292 NTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXX 351
             YSLYLN S +  G++LFGAVDH++Y G LYT+P+ N+L    F+ P Q ++T      
Sbjct: 230 IAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSL-FQNFTDPFQLEITMNGLGL 288

Query: 352 XXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVL-DCPS-D 409
                   TL   K  ALLDSGTTLT + + +  +IA ++    + +     L  CPS  
Sbjct: 289 QGNDANI-TLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKCPSKK 347

Query: 410 DSMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSD--DTGTILGDSFLTNAYVVYDL 467
           ++ +++F+F G  +   ++  +      C L      D  +   I GD+FL + Y+VY+L
Sbjct: 348 ENKKLIFNFSGAEVAVDINQMMNKHKGKCYLQFAVHEDTSNDAIIFGDNFLRSVYLVYNL 407

Query: 468 ENLEISMAQARYNTT-SENIEIITSSVPSAVKAPGYTNTWSTSA-SIVTGGNIF 519
           E+ EIS+A A +N++  ENIE I S+VPSA++AP Y NT+S  A +    G+IF
Sbjct: 408 EDKEISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAVTGDIF 461

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  278 bits (712), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 174/462 (37%), Positives = 249/462 (53%), Gaps = 40/462 (8%)

Query: 64  LLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMG 123
           L KRAD    + + N    Y V L VGTPPQ V+V +DTGS+DLW  G+DNPYC +N   
Sbjct: 30  LEKRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNKKK 89

Query: 124 SSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEAT 183
           + + + +   D+S             G+ T                       +      
Sbjct: 90  APKSKDLQPVDNS-------------GFPTNP-------------------DQIGKKARN 117

Query: 184 MDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 243
           +DC++Y                   + Y D +F  GT+GTDV+ L  LN++G++FAVA  
Sbjct: 118 LDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEI 177

Query: 244 TNSTMGVLGIGLPELEVTYS-GSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSD 302
           +NS+ GVLG+ LP  E TYS  S  + +   Y+Y N P+ LK  G I   TYS+YLND+ 
Sbjct: 178 SNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTK 237

Query: 303 AMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLT 362
           + +G+ILFGAVDHSKYTGTLYT+P+VN+      + P + D+T              TL 
Sbjct: 238 SKYGSILFGAVDHSKYTGTLYTLPLVNS-EYDVVNKPYELDITLNGIGYQSMSSNM-TLY 295

Query: 363 TTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSR-IGYYVLDCPS-DDSMEIVFDFGG 420
             K+ AL+DSGTT++  P  +V ++A ++ A       G  +  CPS  D+ +++F+ GG
Sbjct: 296 DQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNAKLLFNLGG 355

Query: 421 FHINAPLSSFILSTGTTCLLGIIPTSDDTG-TILGDSFLTNAYVVYDLENLEISMAQARY 479
             I   +  F       C L IIP+  ++   ILGD+F+ + Y V+DLE  E+S+AQA +
Sbjct: 356 ALIYVDIKEFTTKVKGKCYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEVSIAQANF 415

Query: 480 NTT-SENIEIITSSVPSAVKAPGYTNTWSTSASIVT-GGNIF 519
           N++    IE I S+VPSAVKAP Y NT+S  ASI +  G+IF
Sbjct: 416 NSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASISSVTGDIF 457

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  275 bits (703), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 181/501 (36%), Positives = 256/501 (51%), Gaps = 58/501 (11%)

Query: 38  FVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVT 97
           +V L F K +GD L             +KR     ++I + +   Y++ L VGTPPQN+T
Sbjct: 14  YVALDFEKSHGDDL-------------VKRDVQDVKLINSQKAMLYNIQLSVGTPPQNIT 60

Query: 98  VLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS 157
             +DTGSSDLW   S NPYC +N           K+    S  SL     P         
Sbjct: 61  AQLDTGSSDLWFPDSTNPYCKAN-----------KKQAPKSIASLDAGTRP--------- 100

Query: 158 XXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFA 217
                              VP S   +DC ++                 F ISY D ++A
Sbjct: 101 --------------TSPAQVPKSLRNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYA 146

Query: 218 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYD 277
            G + TD L L+ LN++GL+F +A  +NS+  VLG+GL  LE +Y           ++Y 
Sbjct: 147 EGVWATDNLYLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYP 206

Query: 278 NFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 337
           NFP +LK  GAI   TYSLYLND+ + +G ILFG VDHSKY G LYTIP+VN+       
Sbjct: 207 NFPQILKQKGAISKVTYSLYLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPG 266

Query: 338 SPIQFDVTXX-XXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYS 396
                +VT               TL T K+PAL DSGT+ +Y+P T+  +IA+++     
Sbjct: 267 VIADLEVTLNGLGIRDNTTNTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTID 326

Query: 397 SRIGYYVL-DCPS-DDSMEIVFDFGGFHINAPLSSFILSTGTTCLLGII--PTSDDTGTI 452
           ++     L  CPS  D+ E+VF+F G  I  PL  F       C L ++  P ++  G +
Sbjct: 327 NKTEAIRLPKCPSKKDTREVVFNFNGVEIAIPLKQFYQKKSGKCYLDLMVAPPNNGPGLL 386

Query: 453 LGDSFLTNAYVVYDLENLEISMAQARYNTT-SENIEIITSSVPSAVKAPGYTNTWST--S 509
           LGD+FL   Y V+DLE  E+S+A+A +N++   ++E I S+VPSA+KAP Y NT+S   +
Sbjct: 387 LGDTFLRQVYTVFDLEAQELSIARANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDN 446

Query: 510 ASIVTGGNIFTVNSSQTASFS 530
           A+ V  GNIF  +++ TAS +
Sbjct: 447 ATQVV-GNIF--DATATASMA 464

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  275 bits (703), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 178/525 (33%), Positives = 250/525 (47%), Gaps = 36/525 (6%)

Query: 7   RSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLK 66
           RS +L  L  S  LG    A+           VKLP  K      +   +    ++   K
Sbjct: 6   RSMLLKELIVSLCLGTAAIAS----------VVKLP-KKYVQMGFDKSCTSATGDMVFAK 54

Query: 67  RADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSR 126
           R   Y  + + N++  Y+V L VGTPPQN+TV ++ GS+D W+   DNPYC         
Sbjct: 55  RDGDYVLVDLINEKILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIKKHSGYE 114

Query: 127 RRVIDKRDDSSSGGSLINDINPFGWLT-GTGSXXXXXXXXXXXXXXXXXQSVPASEATMD 185
           ++V      S       + +   G +T GT S                       +  +D
Sbjct: 115 KQVGANTSVSLLSSLSNDRVTMSGTVTTGTSSSMV--------------------QPIID 154

Query: 186 CQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETN 245
           C  Y                 F++ Y D T AS  +GTDV+ +  L +  +SF VAN  N
Sbjct: 155 CTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEILDMSFGVANVFN 214

Query: 246 STMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMH 305
           +T GV GIG P LE T   +       +Y+Y NFP  L N G++    YSL+LNDS AM 
Sbjct: 215 ATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLNDSHAMK 274

Query: 306 GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTK 365
           G++LFGAVDHSKY   L+T+P+VN     G   P  F+V              +     +
Sbjct: 275 GSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNV-FNARRGCPNKRRPQNRRHDE 333

Query: 366 IPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIV-FDFGGFHIN 424
              +LDSG T++ LP  +V  +   L A +   +  Y L CPS     +  FD G FHI+
Sbjct: 334 FIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSVASFDIGRFHID 393

Query: 425 APLSSFILS-TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTS 483
            PLS+F+       C+L + P +D+   IL D+FL+ AYVV+DLE+ EISM QA      
Sbjct: 394 GPLSNFVRKYEKNKCILRLDP-ADNQPYILCDNFLSRAYVVHDLESYEISMGQANTEYAP 452

Query: 484 ENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTAS 528
           E IE I S VP  V+AP Y  TW     +   GNI+TV+++ T++
Sbjct: 453 EQIEAIKSKVPGTVRAPSYDKTWGNGTDVSPSGNIYTVSTNGTST 497

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  273 bits (698), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 182/503 (36%), Positives = 257/503 (51%), Gaps = 25/503 (4%)

Query: 24  IPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKR---ADGYEEIIITNQ- 79
           +PA +  D  S+    K+ F+K+YG S     +D+K  V L +    +D  +E+ + N  
Sbjct: 19  LPAVH--DSRSSQSVAKIGFNKVYGKSFSEATADRK-YVNLFRNKNISDDNDEVALQNNA 75

Query: 80  QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDD---- 135
            ++YSV++ +GTP QN+T+ +DTGSSDLW++      C+ N     ++R  +  D+    
Sbjct: 76  NTYYSVNISLGTPGQNMTIQLDTGSSDLWVIKPGGLQCTDNDTNLFKKRSENDNDNDAIS 135

Query: 136 ------SSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQ- 188
                  S  GS      P     GT +                      S+ + +C   
Sbjct: 136 SFISQLESYEGSFSTLFGPGPGSVGTPTGTISSSMPAPTGNGSYDGGDSDSDGSNNCNAT 195

Query: 189 -YXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNST 247
            +                Y+ I Y D ++ASG +GTD L L DL V  +SFAVAN+TNST
Sbjct: 196 AFFEADNSKTFHRNRTDPYY-IQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVANDTNST 254

Query: 248 MGVLGIGLPELEVTYSGSTASH-SGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHG 306
             V GIG P  E +++     + +   ++Y NFP  LKN G I+   YSLYLN  ++ +G
Sbjct: 255 TPVFGIGFPGGESSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPNSTYG 314

Query: 307 TILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI 366
            +LFG VDHS+Y G LYT+PI+   + +    P                     + T  I
Sbjct: 315 NVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKVKTKPI 374

Query: 367 PALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINA 425
           P +LDSGTT  YLP  +   IA+            Y++DCP S D+  I FDFGG  I  
Sbjct: 375 PVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGVTIKT 434

Query: 426 PLSSFIL-STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSE 484
            + ++I   +   CLLGIIP SD    + GD FLT+AYVVYDLE  EIS+AQA +N++SE
Sbjct: 435 DIRNYIFEQSENKCLLGIIPNSDILA-VFGDVFLTDAYVVYDLEGKEISLAQASFNSSSE 493

Query: 485 NIEIITSS-VPSAVKAPGYTNTW 506
            IE ITSS VP A +APGY+ TW
Sbjct: 494 QIEAITSSGVPGAKRAPGYSKTW 516

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  270 bits (690), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 172/480 (35%), Positives = 249/480 (51%), Gaps = 43/480 (8%)

Query: 57  DKKPEVRLL--KRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDN 114
           +K PE  L   KR D   ++ + N    Y+V L VGTPPQN+TV +DTGSSDLW     N
Sbjct: 22  EKVPEQNLALNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEAN 81

Query: 115 PYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXX 174
           PYC +N   S ++  I+  +D+    S                                 
Sbjct: 82  PYCKNNRKHSPKKSQIEPLNDADYPTS--------------------------------P 109

Query: 175 QSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 234
             +P S   +DC+ +                 F++SY D TFASG +G D L  + + V 
Sbjct: 110 NQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVD 169

Query: 235 GLSFAVANETNSTMGVLGIGLPELEVTYS-GSTASHSG-KAYKYDNFPIVLKNSGAIKSN 292
            ++F +A  +NST  V GI LP  E T    +  S  G  +Y+Y NFP++LK  G +K  
Sbjct: 170 NVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKI 229

Query: 293 TYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXX 352
            YS+YLND+ + +G+ILFGAVD SKY GTLYT+P+VN+L     S P QF++T       
Sbjct: 230 AYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQ-VSKPFQFEITLNGIGLQ 288

Query: 353 XXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLD-CPS-DD 410
                  TL   K+  LLD+G T + LP  V +++A+++        G+  LD CP+  +
Sbjct: 289 TADKNY-TLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKE 347

Query: 411 SMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENL 470
              +VF+FGG  I+  +          C L +    D     LGD FL + YVVY+LE+ 
Sbjct: 348 KRTVVFNFGGAEISIDIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDE 407

Query: 471 EISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWST--SASIVTGGNIFTVNSSQTAS 528
           EIS+A A +N ++ +I+ I S+VP AVKAP Y NT+S   +A+ VT G++FT  ++ + S
Sbjct: 408 EISIANANFNYSTPDIQEIVSTVPGAVKAPQYYNTYSVYPTATAVT-GDVFTPEATMSMS 466

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  266 bits (680), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 171/476 (35%), Positives = 250/476 (52%), Gaps = 41/476 (8%)

Query: 57  DKKPEV--RLLKRADGYEEII-ITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSD 113
           +K P++   L KRAD    I  + N    Y+V + VGTPPQN+TV +DTGSSDLW + + 
Sbjct: 22  EKTPKISDELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSAS 81

Query: 114 NPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXX 173
           NPYC +N   + +++                D+ P     G  +                
Sbjct: 82  NPYCKNNKKFAPKKQ----------------DLMPITSDDGFPTSP-------------- 111

Query: 174 XQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNV 233
              VP +   ++C +Y                 FS+SYGD TFASG +GTD + L+ + V
Sbjct: 112 -NQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKV 170

Query: 234 TGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKA-YKYDNFPIVLKNSGAIKSN 292
             ++F +A+ +NST  V GIGLP  E TY+  +   +G    +Y NFP+ LK  G I   
Sbjct: 171 ENVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKV 230

Query: 293 TYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXX 352
            YS+YLN + +  G+ILFGAVDHSKY+G LYT+PIVN        +P + +VT       
Sbjct: 231 AYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRF-GHLVENPYELEVTLSGLGLQ 289

Query: 353 XXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVL-DCPSDDS 411
                  TL    +PALLD+GTT TY+P +V   +A +       +     L  CPS  S
Sbjct: 290 RATSNI-TLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKS 348

Query: 412 ME-IVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENL 470
            + IVF+F G  I   +  F+      C L  + + + +  +LGDSF+ + Y V+DL++ 
Sbjct: 349 NDTIVFNFSGAQIKIKMVDFVEKHKGKCYLPCV-SQESSFFLLGDSFMRHVYTVFDLDDK 407

Query: 471 EISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTW-STSASIVTGGNIFTVNSSQ 525
           EIS+AQA +N+T E+IE I+S+VPSAVKAP Y +++      I   G+IF   +++
Sbjct: 408 EISIAQANFNSTKEDIEEISSTVPSAVKAPQYYSSYVDFPTEISVTGDIFAPQATE 463

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  259 bits (661), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/504 (33%), Positives = 262/504 (51%), Gaps = 49/504 (9%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIIT--NQQSFYSVDLEVGT 91
           S++ +VKL   KL   ++ N+       +   KR++ +   +I   +    Y V +E+GT
Sbjct: 23  SSNSYVKLLVQKL--ANIPNINLQGASGIS--KRSEAFNSTLINMFSSAGMYVVKMEIGT 78

Query: 92  PPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGW 151
           PPQ   + +DTGSSD+ I  +D  YC S         + D+ + S+S   L         
Sbjct: 79  PPQTAYLQLDTGSSDMCINEADAAYCES---------LADENNISTSNYEL--------- 120

Query: 152 LTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISY 211
            T T                    + P++     C  +                 F+++Y
Sbjct: 121 -TATA-------------IEILSTAAPSAAYNAPCSYWGTFSPNSSSTFKYNETIFNLTY 166

Query: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTA-SHS 270
           GD ++ +GT+GTDV+ L ++ ++  +F V+N+T +  G+LG+ LP  EVT     A S +
Sbjct: 167 GDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTNNGGILGVSLPSAEVTDDTEDALSSN 226

Query: 271 GKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIV-- 328
              + Y+NFP+ LK+ G IK   YSL+LN+  A  G+ILFGAVD S+Y+G LYT+P++  
Sbjct: 227 TTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARFGSILFGAVDKSEYSGQLYTLPMLQA 286

Query: 329 -NTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMI 387
            NTL A+         VT             KT++  + P L DSGT+ + LP  +   I
Sbjct: 287 YNTLDATD----AGMFVTAQSVAILDSKSGNKTVSEVQFPVLFDSGTSTSVLPTKIADAI 342

Query: 388 ATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSD 447
                 +YSS    Y+ DC   ++  + FDFGGF+I+A +S+F+      C+L I+P+  
Sbjct: 343 GRSFDGKYSSDDQGYIFDCAKVNNTLLSFDFGGFNISANISNFVTPAKDHCILQILPS-- 400

Query: 448 DTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWS 507
           DT  +LGD+FL + YVVYDLEN E+S+AQA ++   E+I II+ SVP A  APGY++TW 
Sbjct: 401 DTIFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKEEDIGIISDSVPGATPAPGYSSTWR 460

Query: 508 -TSASIVTGGNIFTVNSSQTASFS 530
            T  S +  G+   V+ +  + FS
Sbjct: 461 YTPGSPIGSGDFLNVSWTSYSEFS 484

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  257 bits (656), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 163/435 (37%), Positives = 229/435 (52%), Gaps = 42/435 (9%)

Query: 82  FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGS 141
            Y+V L VGTPPQNVTV +DTGSSDLW   + NPYC  N+  + ++     +   ++G +
Sbjct: 52  MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAPKKV----KALPATGFA 107

Query: 142 LINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQY-XXXXXXXXXXX 200
             ND                               V     T DC  +            
Sbjct: 108 TEND------------------------------QVAKKLRTFDCDAFGLFNSSMSSSFK 137

Query: 201 XXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEV 260
                 F + Y DGT+ASG +GTD   L+  NV+ ++FA+AN  N++MGVLG+G P  E 
Sbjct: 138 SNDSSEFFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALANIANASMGVLGVGFPAEET 197

Query: 261 TYSGSTASHSGKA-YKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYT 319
           T   S  S   K  Y+YDNFPI LK +  IK  +YS++LND+++  G ILFG VDHSKY 
Sbjct: 198 TDDPSPGSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQ 257

Query: 320 GTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYL 379
           GTL+T+P+VN L     ++  + ++T              TL   KIP LLD+GTTL Y 
Sbjct: 258 GTLWTVPMVNNLLTLNQTTTSRPEITLNGLGFRDDKKNV-TLWGEKIPVLLDTGTTLAYA 316

Query: 380 PQTVVSMIATELGAQYSSRIGYYVL-DCP-SDDSMEIVFDFGGFHINAPLSSFILSTGTT 437
           P+ VV +IA  +     S+ G   L  CP + D+ E++F+F G  I   L + +      
Sbjct: 317 PKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAGAEIPVSLLNMVEKRKGK 376

Query: 438 CLLGIIPTSD--DTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSE-NIEIITSSVP 494
           C L I    +   TG +LGD F+ + Y V+++E++E+S A A  N ++   IE I S VP
Sbjct: 377 CYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVP 436

Query: 495 SAVKAPGYTNTWSTS 509
           SAVKAP Y NT+++S
Sbjct: 437 SAVKAPQYYNTFASS 451

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  255 bits (651), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 243/475 (51%), Gaps = 42/475 (8%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPP 93
           S S +VK P  KL  D +     D      + KR +     +I N    Y V +E+GTPP
Sbjct: 23  SASSYVKFPVQKL-ADIINICTQDVS---TVFKRNEVLNTTVI-NGIGVYVVKMEIGTPP 77

Query: 94  QNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLT 153
           Q + + +DTGSSD+ +  +D  YC S S GS      D  + +++          F  L 
Sbjct: 78  QTLYLQLDTGSSDMIVNNADIAYCKSMSDGSDYAST-DNYELTAT----------FNGLP 126

Query: 154 GTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGD 213
            T                    ++ +      C  +                +F+ +YGD
Sbjct: 127 ST--------------------TISSEAYNTLCSYWGTFDASNSSTFENNATFFNNTYGD 166

Query: 214 GTFASGTFGTDVLDLSDLNVTGLSFAVANET-NSTMGVLGIGLPELEVTYSGSTASHSGK 272
           GT+ +GT+GTDV+   ++ +   +F V+N+T  +  G+LGI LP  E T     A    +
Sbjct: 167 GTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNPSGILGISLPIAEFTDGIEYALALNR 226

Query: 273 A-YKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL 331
             + YDNFP+ LKN G I    YSL+LN  DA  G+ILFGAVD SKYTG LYT+P++   
Sbjct: 227 TPFIYDNFPMELKNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQAF 286

Query: 332 SASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATEL 391
           +  G S+P    +T             KT++  + P +LDSGTT +YLP  +   I    
Sbjct: 287 NTLG-SNPGMI-ITAQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSF 344

Query: 392 GAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGT 451
             +YSS    Y+ DC   +   +  DFGGF+I+A +S+F+ S    C+L +     ++  
Sbjct: 345 DGEYSSDDQGYIFDCSKVNDTLLSVDFGGFNISANISNFVTSAKDRCVLNV--KQSESTY 402

Query: 452 ILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTW 506
           +LGD+FL +AYVVYDLEN EIS+AQA +N   E+IE+I+ +VP A  APGY +TW
Sbjct: 403 MLGDAFLVDAYVVYDLENYEISIAQASFNNQEEDIEVISDTVPGATPAPGYFSTW 457

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  254 bits (648), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 167/485 (34%), Positives = 250/485 (51%), Gaps = 53/485 (10%)

Query: 38  FVKLPFHKLYGDSLENVGSDKKPEVRLLKRADG-YEEIIITNQQSFYSVDLEVGTPPQNV 96
           +++LPF K+  +SL              KRAD  Y  + + N+Q FY V++ +G+  QN+
Sbjct: 15  YLRLPFTKITDNSLA-------------KRADDDYLNVQLDNEQIFYGVEVSIGSDKQNM 61

Query: 97  TVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTG 156
           T+LVDTGSSD W++G+ NPYC SN     R +   K+D  SS     N     G+ T   
Sbjct: 62  TLLVDTGSSDFWVLGAQNPYCKSN-----RGKKPKKKDQPSSVDPGRN-----GYPT--- 108

Query: 157 SXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTF 216
                             +++P +E T DC  +                 F I+YGDG++
Sbjct: 109 ----------------KAEAIPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSY 152

Query: 217 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTA----SHSGK 272
             GT+GTD + L+   +  ++FAVA  TN++ G+LGIGLPELE + +  TA    + S K
Sbjct: 153 VEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVK 212

Query: 273 AYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLS 332
              Y NFP  LK +  I    YS+YLN ++   G+ILFGAVDH++Y G L T+P+V +  
Sbjct: 213 KNPYMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPLVFSNR 272

Query: 333 ASGFSSPIQFDVTXXXXXXXXXXXXXKTL--TTTKIPALLDSGTTLTYLPQTVVSMIATE 390
             G   P +  VT               +   T+K PALLD+G+T T+LP  V + +A  
Sbjct: 273 DFGTPRPNELMVTLNGMSFEATDGNVTQILNATSKFPALLDTGSTDTHLPVDVYNALAES 332

Query: 391 LGAQY-SSRIGYYVLDCPSDDSMEIV-FDFGGFHINAPLSSFILSTGTTCLLGIIPTSDD 448
               Y  ++    +  C S     I+ F  GG +I  P    +      C + + PT  D
Sbjct: 333 TNGTYDQTQNKIRIPKCLSKKDKTILNFSLGGVNIGVPYKEMVKKIKGKCYINVAPTGSD 392

Query: 449 TGTILGDSFLTNAYVVYDLENLEISMAQARYNTT-SENIEIITSSVPSAVKAPGYTNTWS 507
              ILGD  +  AY+V+DLE+ EIS+AQA +N T  E+IE++ S++P A +A  Y+ T+S
Sbjct: 393 FA-ILGDDVIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVVSTIPGATRASAYSETYS 451

Query: 508 TSASI 512
            + ++
Sbjct: 452 PTFAV 456

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  251 bits (640), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/490 (33%), Positives = 254/490 (51%), Gaps = 57/490 (11%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIIT--NQQSFYSVDLEVGT 91
           S++ +VKLP  KL   ++ N  S       + KR++ +   +I   +    Y V++E+GT
Sbjct: 23  SSNSYVKLPVQKL--ANIPNSAS------GISKRSEAFNSTLINMFSSAHIYVVEMEIGT 74

Query: 92  PPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGW 151
           PPQ     +DTGSSD+         C++ +  S      D+ +  +S   L         
Sbjct: 75  PPQAAYFQLDTGSSDM---------CANEADSSYCESFTDESNIWTSNYEL--------- 116

Query: 152 LTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXYFSISY 211
            T T S                  +  +      C  +                 F+ISY
Sbjct: 117 -TATASEISST-------------ATSSKAYNTPCSYWGTFSPNVSSTFKYNETIFNISY 162

Query: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTA-SHS 270
            D  + +GT+GTDV+ L ++ ++  +F V+N+T  + G+LG+ LP +E T     A S +
Sbjct: 163 ADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEETDDIEDALSSN 222

Query: 271 GKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIV-- 328
              + Y+NFP+ LK+ G I+   YSL+LN+  A  G+ILFGAVD SKY+G LYT+P++  
Sbjct: 223 TTPFVYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILFGAVDKSKYSGQLYTLPMLQA 282

Query: 329 -NTLSA--SGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVS 385
            NTL A  SG        VT             KT++  + P L DSGT+ + LP  +  
Sbjct: 283 YNTLDALYSGMF------VTAQSAAIIDSKSGNKTVSEVQFPVLFDSGTSTSVLPTEIAD 336

Query: 386 MIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILS-TGTTCLLGIIP 444
            I      +YSS    Y+ DC   ++ ++  DFGGF+I+A +S+F+   T   C+L I+P
Sbjct: 337 AIGRSFDGKYSSDDEGYIFDCSKVNNTQLSIDFGGFNISANISNFVTPLTKDHCVLQILP 396

Query: 445 TSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTN 504
           +  DT ++LGD+FL + YVVYDLEN E+S+AQA +N   E+IEII+ SVP A  APGY++
Sbjct: 397 S--DTVSVLGDAFLVDTYVVYDLENHEVSVAQASFNNEEEDIEIISDSVPGATPAPGYSS 454

Query: 505 TWSTSASIVT 514
           TW  +  I++
Sbjct: 455 TWRYNGYIIS 464

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  251 bits (641), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 159/466 (34%), Positives = 245/466 (52%), Gaps = 41/466 (8%)

Query: 72  EEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVID 131
           E   +T  +  Y V++ VGTPPQ V + +DTGSSDL+++   NPYC +N   + +++ ++
Sbjct: 39  EAAQLTFDKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPYCKNNKNKAPKKKDLE 98

Query: 132 KRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXX 191
              D                                         VP S+ T+DC++Y  
Sbjct: 99  SPGDD---------------------------------YPRTPNQVPKSDRTLDCKKYGF 125

Query: 192 XXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVL 251
                            I+YGD  F  GT+GTD + + +LN++ LS  V+  TN++ G+L
Sbjct: 126 YNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVSPMTNTSTGIL 185

Query: 252 GIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFG 311
           G+GLP  E T++ S+       Y+Y NFPI LK  G I+   YS+YLN++ + +G+ILFG
Sbjct: 186 GVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYLNETGSKYGSILFG 245

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLD 371
           AVDHSKY G LYT P+VN+    G S P QF++T              TL   K+P LLD
Sbjct: 246 AVDHSKYQGPLYTFPLVNSKYKEG-SDPFQFEITMNGVGLVGKTDNI-TLYDQKLPTLLD 303

Query: 372 SGTTLTYLPQTVVSMIATELGAQYSSRIGYYVL-DCPS-DDSMEIVFDFGGFHINAPLSS 429
           SG+T++ LP+ V  ++A ++      +     L  CPS  D+ +++F+F G   +  ++ 
Sbjct: 304 SGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSGAEFSVNVTD 363

Query: 430 FILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTT-SENIEI 488
           F+      C L           +LGD+F+ N Y V++L++ E+S+AQA YN++   +IE 
Sbjct: 364 FMEKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQANYNSSLKPDIEE 423

Query: 489 ITSSVPSAVKAPGYTNTWST--SASIVTGGNIFTVNSSQTASFSGN 532
           I  +VPSAV AP Y NT+S   +A+ VT GNIF   ++ + +   N
Sbjct: 424 IKDTVPSAVLAPQYYNTFSADPTATAVT-GNIFAPEATMSMAAPAN 468

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  244 bits (622), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 192/305 (62%), Gaps = 11/305 (3%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F+I+Y D ++ +GTFGTD++ L D+ ++  +F V+N+T    G+LGI LP  E+T SG  
Sbjct: 8   FNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAEITDSGQG 67

Query: 267 A-SHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTI 325
           A S +   + YDNFP+ LKN G I+   YSL+LN+ +A  G+ILFGAVD SKYTG LYT+
Sbjct: 68  ALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYTGQLYTL 127

Query: 326 PIV---NTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQT 382
           P++   NTL A G        VT             KT++  + P L DSGT+ + LP  
Sbjct: 128 PMLQAYNTLDALGGG----MLVTAQSVAILDSISGNKTVSEVQFPVLFDSGTSTSVLPTE 183

Query: 383 VVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILS-TGTTCLLG 441
           +   I      +YSS    Y+ DC   ++ ++  DFGGF+I+A +S+F+   T   C+L 
Sbjct: 184 IADAIGRSFDGKYSSDDEGYIFDCSKVNNTQLSIDFGGFNISANISNFVTPLTKDHCVLQ 243

Query: 442 IIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPG 501
           I+P+  DT ++LGD+FL + YVVYDLE+ E+S+AQA +N   E+IEII+ SVP A  APG
Sbjct: 244 ILPS--DTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISDSVPGATPAPG 301

Query: 502 YTNTW 506
           Y++TW
Sbjct: 302 YSSTW 306

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  239 bits (610), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 194/325 (59%), Gaps = 5/325 (1%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F  +YGDGT+  GT+GTDV+ L ++ +   SF VAN T +  G+LGI LP  E T+S   
Sbjct: 5   FDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGG 64

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIP 326
           A ++   ++Y+NFP+ LK+ G I+   YSL+LN+  A  G+ILFGAVD SKY+G LYT+P
Sbjct: 65  A-YNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLP 123

Query: 327 IVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSM 386
           ++         SP  F VT             KT++  + P L DSGTT + LP  V   
Sbjct: 124 MLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHA 182

Query: 387 IATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTS 446
           I      +YSS    Y  DC       +  DFGGF+I+A +S+F+  T   CLL I   +
Sbjct: 183 IGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANISNFVTRTKDHCLLNI--EA 240

Query: 447 DDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTW 506
            D+G +LGD+FL +AYVV+DLE+ E+S+AQA ++   E IE+I+  VP A++APGY++TW
Sbjct: 241 ADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 300

Query: 507 -STSASIVTGGNIFTVNSSQTASFS 530
             T  S +  G+ + V+ +  + +S
Sbjct: 301 VYTPGSPIGTGDFYNVSWTSYSGYS 325

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  243 bits (619), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 199/346 (57%), Gaps = 12/346 (3%)

Query: 179 ASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSF 238
           AS+ + +C+++                 F+I+Y  G    G +G D L +  +N TGLSF
Sbjct: 110 ASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSF 169

Query: 239 AVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL 298
            V + T S+ G+LGIGLP+ E T  G         YKYDNFP+VLKN G I    YS+YL
Sbjct: 170 GVVHTTTSSAGILGIGLPDTETTAVGQYGH-----YKYDNFPMVLKNKGIISHQGYSIYL 224

Query: 299 NDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXX 358
           + S + +G  L G VD SKYTGTLY +P+VN  + + FSSP  F VT             
Sbjct: 225 DSSSSTYGEFLLGGVDTSKYTGTLYKLPLVNWYN-TYFSSPGDFHVTLQGLGLITNSGSA 283

Query: 359 KTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDF 418
            TLT TK+  +LD+G+T+T +P T+ + + + LG  YSS  G YV  CP++ S ++VF+F
Sbjct: 284 VTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTETS-KLVFNF 342

Query: 419 GGFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQAR 478
           GG +   P+SSFI + G       + +  D+  ILGD FL N Y  +DLEN EI +A A 
Sbjct: 343 GGINYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAMAD 402

Query: 479 YNTTSEN-----IEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIF 519
           ++++S N     +  + S +P AV+AP Y+ TW T  ++VTGG++F
Sbjct: 403 FDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMF 448

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 3/91 (3%)

Query: 35  NSKFVKLPFHKLYGDSLENVGSDKK-PEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPP 93
           + K   +PF K Y DSLE +  +    E +L+KR DG E+I++TN+ +FYS ++EVGTP 
Sbjct: 26  DKKAAVIPFRKYYADSLEELDYNTSTSETKLVKR-DG-EDIVLTNRNTFYSAEIEVGTPA 83

Query: 94  QNVTVLVDTGSSDLWIMGSDNPYCSSNSMGS 124
           Q + V+VDTGSSDLW++G DN  C   S GS
Sbjct: 84  QTMNVIVDTGSSDLWVIGHDNLTCPLASDGS 114

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  233 bits (595), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 205/318 (64%), Gaps = 15/318 (4%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           FS  Y DGT A G +  D + L D  V+ ++FAV N+T+S  GVLG+GL  LE TY+ + 
Sbjct: 127 FSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDSNFGVLGLGLTGLEATYTNAL 186

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIP 326
           +S     Y+YDNFP+ L   G I++N YSLYLN +DA  G +LFGAVDH+KYTGTL+TIP
Sbjct: 187 SS----PYQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNVLFGAVDHAKYTGTLHTIP 242

Query: 327 IVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSM 386
            VNTL + G++S I+F VT              TLTT+K P L+DSG T +YLP  ++  
Sbjct: 243 FVNTLESLGYNSVIEFHVTLDGMDLSTNDGQT-TLTTSKFPVLVDSGNTFSYLPDNLLQQ 301

Query: 387 IATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFILSTG---TTCLLGI 442
           IA+++GA YS+    YVL CPS DD   I ++FGGF+I+ PLS  +   G    TC+L I
Sbjct: 302 IASQIGATYSNEYVGYVLTCPSEDDDTVISYNFGGFNIDTPLSGSVTELGDDSNTCILMI 361

Query: 443 IPTSDDTGTILGDSFLTNAYV--VYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAP 500
            P+  + G  LGD+FL N Y    + +E+L  S+AQA+Y T  E IEII+SS+P A+KA 
Sbjct: 362 APSGSEFGQ-LGDTFLENVYASSTWTIESL--SLAQAQY-TDEEEIEIISSSIPGAIKAA 417

Query: 501 GYTNTWSTSASIVTGGNI 518
           GY++ WS SA   T GN+
Sbjct: 418 GYSDIWSASAKNSTSGNV 435

 Score = 82.0 bits (201), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 71/113 (62%), Gaps = 9/113 (7%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           M+ +T+ S  L  L A Q +   + A     ++S+S FV + F++LYG S +   S  K 
Sbjct: 1   MRFQTISSVAL--LSAIQHVYAHLGA-----EESSSGFVSMNFNRLYGASPDTAVS--KR 51

Query: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSD 113
            +  +KR++ YE++ + N+  FYS+DL +G+  QNVTVLVDTGSSDLW+ G D
Sbjct: 52  SMSHIKRSENYEQVRLKNEACFYSMDLAIGSNHQNVTVLVDTGSSDLWVPGPD 104

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  236 bits (601), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 211/348 (60%), Gaps = 17/348 (4%)

Query: 185 DCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSD--LNVTGLSFAVAN 242
           +C++Y                   I+Y DGT   G +G D L+L++  + +      VA+
Sbjct: 92  ECKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVAD 151

Query: 243 ETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSD 302
            ++S  GV+G+G P LE T   +    +G++Y Y NFP+ LK  G   +  +++ L++S 
Sbjct: 152 SSDSVAGVIGLGFPGLETT---NNVQANGESYTYANFPMQLKQQGVTDATVFAIALDNS- 207

Query: 303 AMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLT 362
              G ILFGAVD  KY G LYT+P+VN   + G ++PI+ +VT             +T +
Sbjct: 208 -YGGDILFGAVDEGKYIGGLYTLPVVN---SRGTATPIRMEVTLQGIGVDSDGGDQETFS 263

Query: 363 TTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD-DSMEIVFDFGGF 421
           +T + AL+DSG+T+ YLP+ + + I  ++GA+Y      Y +DC ++ ++  ++FDFGGF
Sbjct: 264 STPMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVENDNLIFDFGGF 323

Query: 422 HINAPLSSFIL----STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
           HI+ P+S++I+    S+   CL GI+  S +T  +LGD+FL++AYVV+DL++ EISMAQ 
Sbjct: 324 HISTPVSNYIITDQRSSNGQCLFGILSQSGNT-VVLGDTFLSSAYVVFDLDHYEISMAQG 382

Query: 478 RYNTTSENIEIITS-SVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSS 524
             N    N++ +TS ++P+A KAP Y+ TWST+A + +GGNIFT+ S+
Sbjct: 383 NSNNGDGNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIFTLGST 430

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 13/79 (16%)

Query: 39  VKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTV 98
           V LPF ++            +   +L++R DG + + +  Q  FYS+DL +GTP Q VTV
Sbjct: 20  VNLPFKRV------------RQSPQLVRREDG-DSVHLGKQTGFYSIDLAIGTPSQKVTV 66

Query: 99  LVDTGSSDLWIMGSDNPYC 117
           L+DTGSSDLW+ G++NPYC
Sbjct: 67  LLDTGSSDLWVTGANNPYC 85

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  225 bits (573), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 158/454 (34%), Positives = 222/454 (48%), Gaps = 69/454 (15%)

Query: 70  GYEEIIITN-QQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRR 128
           G+ EI + + +Q++Y+  LE+GTPPQN+TVL D+GSSDLW+M + NPYC S   GS    
Sbjct: 48  GHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYCESQYTGSQTYN 107

Query: 129 VIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQ 188
                      GS IN                                     +T+DC  
Sbjct: 108 -----------GSSIN-----------------------------------QASTIDCSS 121

Query: 189 YXXXXXXXXXXXXXX-XXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNS 246
           +                  F   Y D TFA G++ T+ L ++ ++V+ L F + N  T  
Sbjct: 122 FMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQFGLGNCVTTP 181

Query: 247 TMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHG 306
             GVLGIG P  E       A +      Y NFP VLKN G I    YS++LN  ++  G
Sbjct: 182 VSGVLGIGFPRRESVKGYDNAPNE----FYPNFPQVLKNQGIIDVVAYSMFLNKLESDTG 237

Query: 307 TILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI 366
           +ILFGA+D SKYTG L T P++N              +              +T  T+KI
Sbjct: 238 SILFGAIDTSKYTGDLVTFPMLNIYPDVTDKPATLMVILQGLGAQDNANCKAETFVTSKI 297

Query: 367 PALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM---EIVFDFGGFHI 423
           P LLDSGTTL   P+ +  M+A  + A +S   G Y+++CP+ +++   + +FDFGG  I
Sbjct: 298 PVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIFDFGGVQI 357

Query: 424 NAPLSSFILST---GTTCLLGIIPTSDDTGT-ILGDSFLTNAYVVYDLENLEISMAQARY 479
             PLS+FILS    G  C   ++P  DD+ T +LGD FL++AYVV+DL+N +IS+A A  
Sbjct: 358 KVPLSNFILSAQSEGGPCGFAVLP--DDSNTMVLGDIFLSSAYVVFDLDNYQISLAAANL 415

Query: 480 -NTTSENIEIITSSVPSAVKAP----GYTNTWST 508
            N  S    II  ++PS    P       + WST
Sbjct: 416 DNNVSLEDSII--NIPSDGNIPNAKMATVDPWST 447

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  224 bits (571), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 159/462 (34%), Positives = 216/462 (46%), Gaps = 67/462 (14%)

Query: 59  KPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCS 118
           KP  R L++     E  +  Q  FY+V+L VGTP Q +  + DTGSSDLW+    NP+C 
Sbjct: 36  KPADRSLQKRSKSFESKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFCL 95

Query: 119 SNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVP 178
            N +                      D N      GT                   +  P
Sbjct: 96  GNKL----------------------DTNGTNEFHGT-------------------EITP 114

Query: 179 ASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSF 238
                +DC +                  FS  Y DG+++ G +  D + ++D  V  L F
Sbjct: 115 ----ILDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQF 170

Query: 239 AVANETNSTMGVLGIGLPELEVT--YSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSL 296
           AVAN +++  GVLG+GLP LE    Y G+  ++      YDNFP  LK++  I    YSL
Sbjct: 171 AVANISSAPSGVLGVGLPRLEAVRGYDGAPNAN------YDNFPQTLKSNRLINRVLYSL 224

Query: 297 YLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXX 356
           Y +  D   GT+LFG +D  KY G LYT+P+VN         P  FD+T           
Sbjct: 225 YFDSGDLESGTVLFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGIRSESN 282

Query: 357 XXKT-LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEI 414
              T +   K PALLDSG+T+   PQ  +  IA ELGA +S   G YVLDCP S+D    
Sbjct: 283 CKDTVIAHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTF 342

Query: 415 VFDFGGFHINAPLSSFIL---STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLE 471
            FDFG   +  P+   +    S    C L II + ++   ILGD  L +AYVVYDL+NLE
Sbjct: 343 YFDFGELKLKVPIHDLLYLPESGQNYCGLAIIASGEE--WILGDLVLKSAYVVYDLDNLE 400

Query: 472 ISMAQARYNTTSENIEII--TSSVPSAVKAPGYTNTWSTSAS 511
           IS+AQ +  T+   I+ +  T S+P   K+   +  WS S S
Sbjct: 401 ISIAQVK-TTSGSRIQTVSATGSLPQTRKS--NSTPWSLSGS 439

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  214 bits (546), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 155/488 (31%), Positives = 226/488 (46%), Gaps = 72/488 (14%)

Query: 63  RLLKRAD--GYEEIIITN-QQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
           R+ KR D  G+  + + + QQ++Y+  L+VGTPPQN+TVL+D+GSSD W+M S NP+C  
Sbjct: 33  RINKRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFCME 92

Query: 120 NSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPA 179
           N   S+    I K ++     +L                                     
Sbjct: 93  NYCNSTE---IPKYNNDLITQNL------------------------------------- 112

Query: 180 SEATMDC---QQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGL 236
              T+DC    +Y                 F + Y DG+F  G +  + + + + N+T L
Sbjct: 113 ---TIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQIDNYNITSL 169

Query: 237 SFAVAN-ETNSTMGVLGIGLPELEVT--YSGSTASHSGKAYKYDNFPIVLKNSGAIKSNT 293
             AVAN  T    G+LGI  P  E    Y G+   +      Y NFP VLKN   I    
Sbjct: 170 QLAVANYATTPVGGLLGISFPRRESVKGYDGALNEY------YPNFPQVLKNENIIDIVL 223

Query: 294 YSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL-SASGFSSPIQFDVTXXXXXXX 352
           YS+YLND +   G++LFGA+D SK+ G + T P+VN   +     + +   +        
Sbjct: 224 YSMYLNDLN-QDGSLLFGAIDTSKFEGDMITYPMVNVYPNVVDKPATLALTIQGVAAQNT 282

Query: 353 XXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDD-- 410
                 +T  T+K P LLDSGTTL   P+ +   +A  + A YS     Y+L+CPS +  
Sbjct: 283 NDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVL 342

Query: 411 -SMEIVFDFGGFHINAPLSSFILSTGT---TCLLGIIPTSDDTGTILGDSFLTNAYVVYD 466
             +E +FDFGG  +  PL  FIL +      C  G++P +     +LGD FL+  Y V+D
Sbjct: 343 NDIEYIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFVYAVFD 402

Query: 467 LENLEISMAQARYNTTSENIEIITSSVPSAVKAPGY----TNTWSTSASIVTGGNIFTVN 522
           L++ +IS+A    N  SE+ E    ++PS    PG        WST   I    NI  V+
Sbjct: 403 LDHYQISLANINKNANSESNEDSIINIPSNGAIPGAKVATVKPWSTHEPITVTTNI--VS 460

Query: 523 SSQTASFS 530
           S +  S S
Sbjct: 461 SCKAPSHS 468

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  211 bits (538), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 161/466 (34%), Positives = 228/466 (48%), Gaps = 70/466 (15%)

Query: 82  FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSM-GSSRRRVIDKRDDSSSGG 140
           FYS  LE+G+P Q + ++VD+GS+D W+M S NP+CSSN+  G+S+    + +       
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKNYTYNGK------- 98

Query: 141 SLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXX- 199
                                                 A   T+DCQ             
Sbjct: 99  --------------------------------------AITETIDCQGLTALDVNSSSQF 120

Query: 200 XXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPEL 258
                  F I+Y DG+F  G + TD +  +  +++GL F VA   +  + G+LG+G P  
Sbjct: 121 RDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYASEEIPGILGLGFPRR 180

Query: 259 EVTYSGSTASHSGKAYK-YDNFPIVLKNSGAIKSNTYSLYLNDSDAMHG-TILFGAVDHS 316
           E     S   + G   K YDNFP +LK  G I    YS+YLND +   G ++LFG VD S
Sbjct: 181 E-----SVRGYPGAPNKFYDNFPQMLKKDGIIDVVAYSMYLNDPNGSGGGSVLFGGVDPS 235

Query: 317 KYTGTLYTIPIVNTLSASGFSSPIQFDVTXXX-XXXXXXXXXXKTLTTTKIPALLDSGTT 375
           KY+G LYT P+ N    +  S P    VT              +T  T     LLDSGT+
Sbjct: 236 KYSGDLYTFPMANQY-PNIVSKPATLAVTLQGFGAQKKSEGRQETFDTNNYAVLLDSGTS 294

Query: 376 LTYLPQTVVSMIATELG--AQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFIL 432
           L   P+ VVS +A  +   A++S   G YV+DCP  DD  E VFDFG   I  P+S+ IL
Sbjct: 295 LMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEFVFDFGDLQIAVPVSTLIL 354

Query: 433 --STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN---TTSENIE 487
             S  + C LG++P  D T T LGD FL+ AY+V+DL+N ++SMA+A+++     S  I+
Sbjct: 355 PPSGESYCGLGVLP-KDGTWT-LGDVFLSYAYLVFDLDNYKVSMAKAKFSGDGDQSPQIK 412

Query: 488 IIT-SSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGN 532
           I T  ++P A  A      WS+S      G+IFT +S+ +   S N
Sbjct: 413 IQTDGTIPGAKSAS--AKPWSSSEPSTVSGSIFTKSSNVSLPHSSN 456

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  206 bits (523), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 146/474 (30%), Positives = 229/474 (48%), Gaps = 69/474 (14%)

Query: 70  GYEEIIITNQQS-FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRR 128
           G+ E ++ +++  +Y+  L++GTP Q++TVL DTGS+D W+            M SS   
Sbjct: 31  GHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWV------------MDSSNPF 78

Query: 129 VIDKRDDSSSGGSLIN--DINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDC 186
            +   + SS   +  N  ++ P                                  ++DC
Sbjct: 79  CLPNSNTSSYSNATYNGEEVKP----------------------------------SIDC 104

Query: 187 QQYXXXXXXXXXXXXXXXX-YFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ET 244
           +                    F I+Y DGTFA G++GT+ + ++ +++  + F VA   T
Sbjct: 105 RSMSTYNEHRSSTYQYLENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFGVAKYAT 164

Query: 245 NSTMGVLGIGLPELEVT--YSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSD 302
               GVLGIG P  E    Y G+   +      Y NFP +LK+   I    YSL+LN  D
Sbjct: 165 TPVSGVLGIGFPRRESVKGYEGAPNEY------YPNFPQILKSEKIIDVVAYSLFLNSPD 218

Query: 303 AMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXX-XXXXXXXXXXXKTL 361
           +  G+I+FGA+D SK++G L+T P+VN    +   +P    +T              +T 
Sbjct: 219 SGTGSIVFGAIDESKFSGDLFTFPMVNEY-PTIVDAPATLAMTIQGLGAQNKSSCEHETF 277

Query: 362 TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGG 420
           TTTK P LLDSGT+L   P+ +   +A+ + A YS   G Y+LDCP S   +E  FDFG 
Sbjct: 278 TTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDFGD 337

Query: 421 FHINAPLSSFILS---TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
             I+ PLSS ILS    G+ C   + PT+D    +LGD FL++AYVV+DL+N +IS+AQA
Sbjct: 338 LQISVPLSSLILSPETEGSYCGFAVQPTND--SMVLGDVFLSSAYVVFDLDNYKISLAQA 395

Query: 478 RYNTTSENIEIITSSVPSAVKAP--GYTNTWSTSASIVTGGNIFTVNSSQTASF 529
            +N +  + +++      ++          WST+       +I++    ++  F
Sbjct: 396 NWNASEVSKKLVNIQTDGSISGAKIATAEPWSTNEPFTVTSDIYSSTGCKSRPF 449

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  197 bits (501), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 178/318 (55%), Gaps = 29/318 (9%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F   + D TFASGT+  D +++  + +   +F VA ETN+T+G LG+GL   E+T  G  
Sbjct: 187 FFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQETNATIGSLGLGLEGNEITNEGD- 245

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG-TLYTI 325
                  Y Y+NFP  LKNSG IK   YS+Y    D   G++LFGAV+HS+Y G TLYT+
Sbjct: 246 -----YTYTYENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSLLFGAVEHSRYVGDTLYTL 300

Query: 326 PIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVS 385
           P+VN  +AS  S P++F VT              T+ + +  ALL++G  +TYLP  + S
Sbjct: 301 PLVNVNNAS--SDPVEFHVTLQNLVVSVNKTNT-TIMSDRYAALLNTGAIVTYLPTHLFS 357

Query: 386 MIATELGAQYSSR-IGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILST------GTTC 438
               + G   S +  G YV DC S+ S    +DFGGF I + L+ ++         G  C
Sbjct: 358 DFIKKTGLSESQKYYGMYVTDCSSEISFS--YDFGGFKIESSLNDYLFEIDESEIPGAKC 415

Query: 439 LLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARY---NTTSENI------EII 489
            +  I + D+   +LG  F ++AYVV+DLE LE+S+AQA +   N T  NI      EI+
Sbjct: 416 AV-TINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQAAHVYDNFTYSNIEDNPDVEIV 474

Query: 490 TSSVPSAVKAPGYTNTWS 507
             S+PSA KA  Y+NTW+
Sbjct: 475 IDSIPSATKAASYSNTWT 492

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 61  EVRLLKRADGYEEIIITNQ--QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117
           E + +KR     E+ + N+      +V + +G   QN+  + DTG SD W++G ++ YC
Sbjct: 79  EEKFIKRDGSARELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYC 137

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  191 bits (486), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 209/457 (45%), Gaps = 69/457 (15%)

Query: 80  QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC--SSNSMGSSRRRVIDKRDDSS 137
           +SFY+  L++G PPQ +TV+ D+GS+D W+M   NP+C  SSN   +  + + D      
Sbjct: 54  ESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSSNITANGLKTLYD------ 107

Query: 138 SGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXX 197
            G ++I  +                                      DC Q         
Sbjct: 108 -GKAIIPKV--------------------------------------DCSQIKTYNANRS 128

Query: 198 XXXXXXXX-YFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMG-VLGIGL 255
                     F I YGD TFA G +GT+  +   + +  + F +A+   + +G VLGIG 
Sbjct: 129 TSFQELNNGRFYIIYGDKTFADGIWGTETFEFGGVKIPNVQFGLADYATTPIGGVLGIGF 188

Query: 256 PELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDH 315
              E     + A        Y NFP VLKN G I +  YSL L  S      I+FGA+D 
Sbjct: 189 QRRESVKGYTNAPE----VFYPNFPQVLKNEGIIDTVAYSLSLGQSSH----IMFGAIDR 240

Query: 316 SKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXX-XXXXXXXXXKTLTTTKIPALLDSGT 374
           + Y G + T P++N    +  S P    +T              +T +TTK PALLDSG+
Sbjct: 241 NSYIGDMVTFPMINMF-PNAVSKPATLSITIQGLGAQNKQECKFQTFSTTKYPALLDSGS 299

Query: 375 TLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDS-MEIVFDFGGFHINAPLSSFIL- 432
           TL   P  +   +A  +GAQ+S   G Y L+CP+D + ++ +FDFG      PLS+ IL 
Sbjct: 300 TLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTNIDYIFDFGDMKFTLPLSNLILP 359

Query: 433 STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSS 492
           S G + + G      D   +LGD FL +  VV+DL++ +IS+A++   +++E+I     +
Sbjct: 360 SQGGSNVCGFGLQRSDNEIVLGDVFLCSTLVVFDLDHYQISLAKSNQKSSAEDI----VN 415

Query: 493 VPSAVKAPG----YTNTWSTSASIVTGGNIFTVNSSQ 525
           +PS  K PG        W+T   I    ++F    S 
Sbjct: 416 IPSDGKIPGAIIAKAEAWTTYEPITATTDMFETERSH 452

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  182 bits (462), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 161/306 (52%), Gaps = 20/306 (6%)

Query: 281 IVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPI 340
           + LK+ G I+   YSL+LN+  A  G+ILFGAVD SKY+G LYT+P++         SP 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 341 QFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIG 400
            F VT             KT++  + P L DSGTT + LP  V   I      +YSS   
Sbjct: 61  MF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQ 119

Query: 401 YYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTN 460
            Y  DC       +  DFGGF+I+A +S+F+  T   CLL I   + D+G +LGD+FL +
Sbjct: 120 GYTFDCSKVKDTLLSIDFGGFNISANISNFVTRTKDHCLLNI--EAADSGFVLGDAFLVD 177

Query: 461 AYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTW-STSASIVTGGNIF 519
           AYVV+DLE+ E+S+AQA ++   E IE+I+  VP A++APGY++TW  T  S +  G+ +
Sbjct: 178 AYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTWVYTPGSPIGTGDFY 237

Query: 520 TVNSSQTASFS---------------GNLXXXXXXXXXXXXKRNVGDHIVP-SLPLTLIS 563
            V+ +  + +S                +             K+N GD +   S P +L S
Sbjct: 238 NVSWTSYSGYSEYQSLVATAVVSSSDSSSSSSSRSAETTTEKQNAGDRLYQSSFPFSLAS 297

Query: 564 LLFAFI 569
            L  F+
Sbjct: 298 FLSYFL 303

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  187 bits (476), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/325 (36%), Positives = 179/325 (55%), Gaps = 21/325 (6%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTMGVLGIGLPELEVTYSGS 265
           F I Y D TF+ G++G + + ++ +++  + F +A   T    GVLGIG P  E     S
Sbjct: 126 FYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLAKYATTPVSGVLGIGFPRRE-----S 180

Query: 266 TASHSGKAYKY-DNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYT 324
              + G   KY  NFP +LK+   I    YSL+LN  D+  G+I+FGA+D SK+ G L T
Sbjct: 181 VKGYEGAPDKYYPNFPQLLKSEQIIDVVAYSLFLNSPDSGMGSIVFGAIDESKFYGDLLT 240

Query: 325 IPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXK-TLTTTKIPALLDSGTTLTYLPQTV 383
            P+VN    +   +P    +T             + T  TTK P LLDSGT+L   P+T+
Sbjct: 241 FPMVNEY-PTIVDAPATLAMTIQGLGAQNKSGCERETFMTTKYPVLLDSGTSLLNAPKTI 299

Query: 384 VSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILS---TGTTCL 439
              +A+ + A YS+  G Y+L+CP S D +E  FDFG   IN PL+S ILS    G  C 
Sbjct: 300 ADKMASFVNASYSADEGIYILNCPDSADDIEYTFDFGDLQINVPLTSLILSPEVEGGYCG 359

Query: 440 LGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKA 499
             + PT+D    +LGD FL++AYVV+DL+N +IS+AQA +N + ++ ++I  ++P+    
Sbjct: 360 FAVQPTND--SMVLGDVFLSSAYVVFDLDNYKISLAQANWNASEDSKQVI--NIPTDGSI 415

Query: 500 PG----YTNTWSTSASIVTGGNIFT 520
           PG        WST+       +I++
Sbjct: 416 PGGKSATAEPWSTNEPFTVTSDIYS 440

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%)

Query: 79  QQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121
           +Q +Y+  L++GTP Q +TVL DTGS+D W+M S NP+CS  S
Sbjct: 41  EQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKS 83

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/325 (36%), Positives = 175/325 (53%), Gaps = 21/325 (6%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTMGVLGIGLPELEVTYSGS 265
           F I Y DGTFA GT+GT+ + +  + +  + F +A   T    GVLGIG P  E     S
Sbjct: 126 FYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLAKYATTPVSGVLGIGFPRRE-----S 180

Query: 266 TASHSGKAYKY-DNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYT 324
              + G   KY  NFP +LK+   I    YSL+LN  ++  G+I+FGA+D SK++G L+T
Sbjct: 181 VKGYEGAPNKYYPNFPQILKSEQIIDVVAYSLFLNSPESGTGSIIFGAIDESKFSGDLFT 240

Query: 325 IPIVNTLSASGFSSPIQFDVTXX-XXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTV 383
            P+VN    +   +P    +T              +T  TTK P LLDSGT+L   P+ +
Sbjct: 241 FPMVNEY-PNIVDTPATLAMTIQGLGAQNKNSCEYETFMTTKYPVLLDSGTSLLNAPKVI 299

Query: 384 VSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFILS---TGTTCL 439
              +A+ + A YS+  G Y+LDCP+  D +E  FDFG   I+ PL+S ILS    G  C 
Sbjct: 300 ADKMASFVNATYSAEEGIYILDCPAFADEIEYTFDFGDLKISVPLTSLILSPEAEGGYCG 359

Query: 440 LGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIIT----SSVPS 495
             + PT+D    +LGD FL++AYVV+DL+N +IS+AQA ++ +    +++      S+P 
Sbjct: 360 FAVQPTND--SMVLGDVFLSSAYVVFDLDNYKISLAQANWDVSEITTKLVNVRADGSIPG 417

Query: 496 AVKAPGYTNTWSTSASIVTGGNIFT 520
              A      W+ +       NIF+
Sbjct: 418 GKTATA--EPWTANEPFTVTSNIFS 440

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 29/39 (74%)

Query: 79  QQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117
           +  +Y+  L++GTP Q +TVL DTGS+D WIM S NP+C
Sbjct: 41  EDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFC 79

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 171/332 (51%), Gaps = 19/332 (5%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTMGVLGIGLPELEVTYSGS 265
           F I Y D +FA G +  + L L+ ++++ L F VA+  T    GVLGIG P  E      
Sbjct: 146 FYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVADYATVPVGGVLGIGFPRRESVKGYD 205

Query: 266 TASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTI 325
            A +      Y NFP VLKN G I    YS++LN+  +  G+ILFGAVD +KYTG+LYT 
Sbjct: 206 DAPNEF----YPNFPQVLKNEGVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYTGSLYTF 261

Query: 326 PIVNTLSASGFSSPIQFDVTXXXX-XXXXXXXXXKTLTTTKIPALLDSGTTL-TYLPQTV 383
           P+VN    +    P    +T              KT TTTK   LLDSGTTL T  P+  
Sbjct: 262 PMVNEY-PNVVDKPATLAMTLQALGAKSDSSCKYKTFTTTKQAVLLDSGTTLMTAPPEIA 320

Query: 384 VSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFILSTG--TTCLL 440
             M     G  Y+   G +  DCPS DD  E +FDFG   I  PL+S ++S+     C  
Sbjct: 321 EEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDFGDLKITLPLASLVISSSGDGHCGF 380

Query: 441 GIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN---TTSENIEIITS-SVPSA 496
           G+ P S      LG  FL++AYVVYDL+N +IS+AQA+++   +    + I    ++  A
Sbjct: 381 GLTPAS--YSMTLGAIFLSSAYVVYDLDNYQISIAQAKWDGNPSQKSRVRIPKDGTIYGA 438

Query: 497 VKAPGYTNTWSTSASIVTGGNIFTVNSSQTAS 528
            KA      W+T   +    ++F  +SS  AS
Sbjct: 439 TKATA--TPWTTDEPVKVDYDMFEDHSSCIAS 468

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 63  RLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117
           R L+R    E  +      +YS  LE+GT  Q + VL D+GSSD+W+  S NPYC
Sbjct: 48  RKLQRRKSTEIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYC 102

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 158/291 (54%), Gaps = 18/291 (6%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGS 265
           F I Y D T+ SG +  D++ L + ++  L F +A  TN+T  GVLGIG P +E      
Sbjct: 124 FKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAMESVNGYE 183

Query: 266 TASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTI 325
            A   GK Y   NFP+ LKN+G      YS+  ND ++  G+ILFG++D S++ G LYT 
Sbjct: 184 FAP--GKFYP--NFPLALKNAGFTNIAAYSIEYND-ESKKGSILFGSIDTSRFIGPLYTF 238

Query: 326 PIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVS 385
           P++N         P    +T               ++ TK+PALLD+G+TL  LP  +  
Sbjct: 239 PMINEFPGIA-DEPSTLSLTLDGIGIDGSCEQW-VISNTKLPALLDTGSTLIELPHPITQ 296

Query: 386 MIATELGAQYSSRIGYYVLDCPSDDSM---EIVFDFGGFHINAPLSSFIL----STGTTC 438
            IA+ L A +S   G +VL CPSDD +   ++ F FG  H+  PL SFIL     +   C
Sbjct: 297 SIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLC 356

Query: 439 LLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMA-QARYNTTSENIEI 488
            LGI  TS     ILGDSFLT+ Y V+DL+N  IS+A  A+ +   + IEI
Sbjct: 357 GLGI--TSSKGRVILGDSFLTHVYTVFDLDNYMISLAPMAKSSLPGKVIEI 405

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 82  FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVID 131
           +Y   LE GTPPQ++ +++DTGSSDLW+    NP C +   G   + +ID
Sbjct: 52  YYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLID 101

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  167 bits (422), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 171/318 (53%), Gaps = 22/318 (6%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGS 265
           F I Y + TF+ G +  D L + + +V+GL F V+N +N+T+ G+LG+G   LE     S
Sbjct: 131 FFIDYVN-TFSRGIWAKDRLVIGNADVSGLQFGVSNISNTTINGILGVGYERLE-----S 184

Query: 266 TASHSGKAYK-YDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYT 324
              +SG   + Y N P++LK SG I    YS++LN  ++   T+ FG VD  KYTG LY 
Sbjct: 185 VKGYSGAPNRTYPNLPMLLKESGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGDLYK 244

Query: 325 IPIVNTLSASGFSSPIQFDVTXXXXXXX-XXXXXXKTLTTTKIPALLDSGTTLTYLPQTV 383
            P+VN   +     P +F +T              KT++ T +PAL D+GT    +P  V
Sbjct: 245 FPLVNIYKS--IPRPSKFHITLQALEVHGNYSSLNKTVSNTPLPALFDTGTNGMVVPPNV 302

Query: 384 VSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFILSTG----TTC 438
              IA+ + A +  +   Y+  CP+ +D  ++VFDFG   I APL++FI+         C
Sbjct: 303 AENIASTIHATFDEKFSLYLFACPAEEDDTKLVFDFGDIQIEAPLANFIVPAAELGTEQC 362

Query: 439 LLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSE-NIEIITSSVPSAV 497
            + IIP  +D    LG  FL + YVVY+LE+ E+++AQA +    +  I  I S++P A 
Sbjct: 363 GVAIIP--EDGTFTLGIPFLRSTYVVYNLEDYEVALAQANWKWDGKSKITPIISNIPGAT 420

Query: 498 KA---PGYTNTWSTSASI 512
           +A   P  TN   ++ SI
Sbjct: 421 QATATPWNTNMEQSTDSI 438

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%)

Query: 76  ITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
           + N    Y  ++EVGTPPQ + VL DTGS+DLW   SDN YC++
Sbjct: 45  LINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAA 88

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  152 bits (383), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 122/208 (58%), Gaps = 6/208 (2%)

Query: 274 YKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIV---NT 330
           Y YDNFP+ LK  G I+   YSL+LN+ +A  G+ILFGAVD SKY+G LYT+P++   NT
Sbjct: 21  YVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYSGQLYTLPMLKAYNT 80

Query: 331 LSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATE 390
           L +S         V              KT++  + P L DSGT+ + LP  +   I   
Sbjct: 81  LDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLFDSGTSTSALPTEIADAIGRS 140

Query: 391 LGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILS-TGTTCLLGIIPTSDDT 449
              +YSS    Y+ DC   ++  +  DFGGF+I+A +S+ +   T   CLL I   +DD+
Sbjct: 141 FDGKYSSDNQGYIFDCSKVNNTLLSIDFGGFNISANISNSVTPITKDHCLLNI--EADDS 198

Query: 450 GTILGDSFLTNAYVVYDLENLEISMAQA 477
           G +LGD+FL + YVV+DLE+ E+S+AQA
Sbjct: 199 GYVLGDAFLIDTYVVFDLESHEVSVAQA 226

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  144 bits (364), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 157/307 (51%), Gaps = 26/307 (8%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGS 265
           F I Y D TF  G++ TD L +   +V+G+ F V   +N+ + GVLG+G   LE     +
Sbjct: 122 FYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGRTSNTELSGVLGVGHANLESVRGYA 180

Query: 266 TASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTI 325
            A ++     Y N P  LK  G+++   YS+ L  +    G ILFGA+D SKY G L+T 
Sbjct: 181 GAPNA----TYPNLPRQLKLDGSVQKLAYSVSLQKTSERDGEILFGAIDTSKYVGKLHTF 236

Query: 326 PIVNTLSASGFSSPIQFDVTXX-XXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVV 384
           PI+N       +SP  F +               + L  +   ALLD+GT        VV
Sbjct: 237 PILNI--DPHLNSPSNFYIALQGIDIQGGRSSTGRPLINSSFHALLDTGTG-----GMVV 289

Query: 385 SMIATELGAQ----YSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFI-----LST 434
           S +A ++GA     Y +    +V+ CP+ DD+ +  F+FG   I  P+S+F+     L T
Sbjct: 290 SSLAEDIGAALNATYDTEQCVFVIQCPTEDDTRQFNFNFGELQIAVPISNFVVPASGLET 349

Query: 435 GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVP 494
           G  C L I+P + +T   LG  FL   Y V++LE+ EISMA+A  N    +I  I + VP
Sbjct: 350 G-QCALAIMPGTSET-FALGIPFLKEVYTVFNLEDNEISMARANTNPQEPDIRPIPAGVP 407

Query: 495 SAVKAPG 501
           +A++  G
Sbjct: 408 AAIRDSG 414

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 34/49 (69%)

Query: 69  DGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117
           DG+  + + +    Y +++EVGTPPQ +  ++DTGS+DLW+   +NP+C
Sbjct: 32  DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFC 80

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  136 bits (342), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 121/431 (28%), Positives = 192/431 (44%), Gaps = 63/431 (14%)

Query: 87  LEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDI 146
           + VGTP Q +  L+DT SSD+W++ S++ +C       S    ++   DS+S  +L N  
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCE------SENGTVNI--DSNSNSTLAN-- 131

Query: 147 NPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVPASEATMDCQQYXXXXXXXXXXXXXXXXY 206
                                       ++   S+A   C+                   
Sbjct: 132 ----------------------------ETASRSDA-YQCKLVNVFYPEDSSSFVLNDLD 162

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F + Y D ++A+GT+  D       +   ++ A+ +ETN T+G LG+GL   + T  G  
Sbjct: 163 FHVQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETNLTVGSLGLGLRANQATNQGD- 221

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG-TLYTI 325
                  + Y++    LK  G I+   YS+Y ++ +   G I FG + H  Y G  LYT+
Sbjct: 222 -----DPFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTGGGIFFGGLYHDLYKGNVLYTL 276

Query: 326 PIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVS 385
           P+VN         P +F +T               L + K PALL +G+  TYLP+ +  
Sbjct: 277 PLVNV--DPELDEPARFHITLQNLTTSINGTNFSVL-SEKYPALLSTGSMFTYLPEELFD 333

Query: 386 MIATELGAQYSSRIG-YYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGTT------C 438
               E+  +  ++    YV+ C  D +   ++DFGGF I  PLS +     +       C
Sbjct: 334 SFVDEMDLEKGAKHKDLYVIPC--DTNATFIYDFGGFEIETPLSGYTFKVESNRTADDMC 391

Query: 439 LLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA---RYNTTSENIEIITSSVPS 495
            + + P +    T LG+ F    YV+++LE+LEISMA A    Y   + + E I SS+PS
Sbjct: 392 AVMVKPHNKSYLT-LGNGFFAATYVLFNLEDLEISMAPASGIEY-LDAFDYEYIESSIPS 449

Query: 496 AVKAPGYTNTW 506
           A +A  Y+NTW
Sbjct: 450 ASRAASYSNTW 460

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score =  116 bits (291), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 101/169 (59%), Gaps = 12/169 (7%)

Query: 359 KTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFD 417
           +T  TTK P LLDSGT+L   P+++   +A+ + A YS+  G Y+LDCP S   +E  FD
Sbjct: 17  ETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFD 76

Query: 418 FGGFHINAPLSSFILSTGTT---CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISM 474
           FG   IN PL+S ILS  T    C   + PT+D    +LGD FL++AYVV+DL+N +IS+
Sbjct: 77  FGDLQINVPLTSLILSPETEGGYCGFAVQPTND--SMVLGDVFLSSAYVVFDLDNYKISL 134

Query: 475 AQARYNTTSENIEIIT----SSVPSAVKAPGYTNTWSTSASIVTGGNIF 519
           AQA +N ++++ +++      S+PS   A      WST+       +I+
Sbjct: 135 AQANWNASNDSKQLVNIPTDGSIPSGKSATA--QPWSTNVPFTVTSDIY 181

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 101/169 (59%), Gaps = 12/169 (7%)

Query: 359 KTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFD 417
           +T  TTK P LLDSGT+L   P+++   +A+ + A YS+  G Y+LDCP S   +E  FD
Sbjct: 227 ETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFD 286

Query: 418 FGGFHINAPLSSFILSTGTT---CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISM 474
           FG   IN PL+S ILS  T    C   + PT+D    +LGD FL++AYVV+DL+N +IS+
Sbjct: 287 FGDLQINVPLTSLILSPETEGGYCGFAVQPTND--SMVLGDVFLSSAYVVFDLDNYKISL 344

Query: 475 AQARYNTTSENIEIIT----SSVPSAVKAPGYTNTWSTSASIVTGGNIF 519
           AQA +N ++++ +++      S+PS   A      WST+       +I+
Sbjct: 345 AQANWNASNDSKQLVNIPTDGSIPSGKSATA--QPWSTNVPFTVTSDIY 391

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  109 bits (273), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 137/303 (45%), Gaps = 27/303 (8%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSD------------LNVTGLSFAVANETN-STMGVLGI 253
           F I Y D ++  G +G D + ++              N+    FA+A  +N     VLG+
Sbjct: 95  FQIGYQDASYTFGKWGVDSISINSSYSDSNEDTGLYANIPNAQFAIATNSNVPVQAVLGL 154

Query: 254 GLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAV 313
           G P  E       A++      Y N P ++K  G   + T ++YL  S+  + +I+FGA 
Sbjct: 155 GFPRREAVNGYKLATNKF----YPNLPQLIKQHGYSDNVTIAMYLG-SNETYNSIMFGAY 209

Query: 314 DHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTT---KIPALL 370
           D ++Y G L+  P+VN         P  F +T               +  +   K   +L
Sbjct: 210 DKTRYIGDLHNFPMVNQYPNVT-DKPATFAITLDSMYISMDNNQSDNIYISNDEKYSVVL 268

Query: 371 DSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD----DSMEIVFDFGGFHINAP 426
           DSGT+L   P   VS IA  L A + +    Y+L   +D      M I F F  F++   
Sbjct: 269 DSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFMDFNVPIN 328

Query: 427 LSSFILSTGTTCLLGIIPTSD-DTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSEN 485
           +  FIL    + +  I+PT + +TG +LGD FL + Y +++L+N  IS+  +  N TS  
Sbjct: 329 MLEFILPYDDSYVFAILPTKNVNTGFVLGDIFLPHVYTIFNLDNYTISLGLSNQNITSNE 388

Query: 486 IEI 488
            EI
Sbjct: 389 REI 391

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%)

Query: 81  SFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGG 140
           S+Y  ++ +G PPQN+ VLVDTGSSDLW+   +NP C + ++  +     +K +  +   
Sbjct: 29  SYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGNIDCTGFTFFNKSNSKTFSN 88

Query: 141 SLINDINPFGW 151
              N I   G+
Sbjct: 89  IYKNSIFQIGY 99

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 103/200 (51%), Gaps = 8/200 (4%)

Query: 209 ISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGSTA 267
           I YGDG+FA G + TD L +   ++  + F ++N  ++ + GVLG+G    E     S  
Sbjct: 137 IQYGDGSFADGEWITDTLTIGPYDLQSVQFGISNNASTIISGVLGLGFLRTE-----SID 191

Query: 268 SHSGKAYK-YDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIP 326
            + G   K Y N P  LK+     +N +SL+LN+S+   GT+LFG +D+SK++G L T P
Sbjct: 192 GYDGSPNKLYYNLPAYLKDQEITNTNAFSLFLNNSNDASGTVLFGGIDYSKFSGDLVTFP 251

Query: 327 IVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSM 386
           +VN +     + P  F +T               L   K+PALLDSG++L  +P  +   
Sbjct: 252 LVN-IYPKLINEPCTFTITLQQLYGKINGGKSIGLIKEKVPALLDSGSSLISMPIEITDE 310

Query: 387 IATELGAQYSSRIGYYVLDC 406
           IA  + +   +    + ++C
Sbjct: 311 IALMVNSTLDTMTSLHNINC 330

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 82  FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVID-------KRD 134
           FYS  L  G P QNVTVLVDTGSSDLW+   +N YC  +   ++    I+        RD
Sbjct: 64  FYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCYEDGKNTNINHSINCTKFGTYTRD 123

Query: 135 DSSSGGSL 142
            SS+   L
Sbjct: 124 KSSTSNKL 131

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 127/282 (45%), Gaps = 34/282 (12%)

Query: 231 LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIK 290
           L++   SF  A  +N   G LG+G   L       TA  S        F  +LKN+  IK
Sbjct: 157 LSIPEFSFFRAEHSNIVDGSLGLGARILS-----GTAEDSSGFDSSFFFLDMLKNANFIK 211

Query: 291 SNTYSLYL-NDSDAMH---------GTILFGAVDHSKYTGTLY---TIPIVNTLSASGFS 337
           S +YS++L ND+  ++         GT+L GAVD + + G  Y    +P  ++ + + F+
Sbjct: 212 STSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLPFRDSKTETTFN 271

Query: 338 SPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSS 397
           S     +T              T      P LLD   T++YLP  ++  IA +  A Y  
Sbjct: 272 SLPIVPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYTISYLPIELILQIAMQTNAVYVK 331

Query: 398 RIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILS--------------TGTTCLLGI 442
            +  +++DC  ++   +I F FG   I+ PLS F+ S              +  TC L +
Sbjct: 332 SLDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIASTQLGASNMTCQLNV 391

Query: 443 IPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSE 484
            P      +ILG +FL + Y+  DLE   ++MAQA YN   +
Sbjct: 392 YPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA-YNAVKD 432

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 142/305 (46%), Gaps = 43/305 (14%)

Query: 231 LNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAI 289
           L +   SF +ANET S + G LG+  P + V  S S +S +     Y  F   LKN+G I
Sbjct: 148 LTINSTSFILANETGSLVHGALGLSGP-ISVPASDSVSSLNFDDSYY--FLTHLKNAGVI 204

Query: 290 KSNTYSLYLNDSD----------AMHGTILFGAVDHSKYTGTLYT---IPIVNTLSASGF 336
           ++++YSL++N++           A  GT+L G+VD   Y G L +   IP  +   +SG+
Sbjct: 205 ETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKD--ESSGY 262

Query: 337 SSPIQFDVTXXXXXXXXXXXXXKTLTTTKI--PALLDSGTTLTYLPQTVVSMIATELGAQ 394
            S     V                LT +    P  + S    +YLP +++  ++ +  A 
Sbjct: 263 LSTGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTNAV 322

Query: 395 YSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILST--------------GTTCL 439
           Y   +  +++ C   D    ++F+FG  +I+ P   F+ +T                 C 
Sbjct: 323 YVESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACY 382

Query: 440 LGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENI-------EIITSS 492
           L + P    + ++LG SF+ NAY+V+D++N  I++AQA  +   E         +I +S+
Sbjct: 383 LKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASDEAVEKAANNSPAKKIESST 442

Query: 493 VPSAV 497
           +P A+
Sbjct: 443 IPYAL 447

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 117/288 (40%), Gaps = 48/288 (16%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A              G+LG+G   + 
Sbjct: 155 FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIS 213

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLK--NSGAIKSNTYSLYLN---DSDAMHGTILFGAVD 314
           V                   P V K  N G +    ++ YLN   DS+   G + FG +D
Sbjct: 214 VD---------------KVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGID 258

Query: 315 HSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGT 374
            SKY G +  +P+            ++FD               +        A +D+GT
Sbjct: 259 SSKYKGDITWLPVRRKAYWE-----VKFD---------GIGLGDEYAELQGTGAAIDTGT 304

Query: 375 TLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILS 433
           +L  LP  +  ++ +E+GA+     G Y +DC S D + ++ F F G +       + L 
Sbjct: 305 SLIALPSGLAEVLNSEIGAK-KGWTGQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLE 363

Query: 434 TGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
              +C+    P    +  G   I+GD+FL   Y +YDL N  + +AQA
Sbjct: 364 VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQA 411

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           Y  ++ +GTPPQ+  V++DTGSS+LW+
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWV 124

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 115/269 (42%), Gaps = 37/269 (13%)

Query: 219 GTFGTDVLDLSDLNVTGLSFAVANET-----NSTMGVLGIGLPELEVTYSGSTASHSGKA 273
           G   TDVL + D  +    FA A  +      S  GV G+G  EL         +  G+ 
Sbjct: 26  GYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQGVFGLGHREL---------AKGGQV 76

Query: 274 YKYDNFPIVLKNSGAIKSNTYSLYL--NDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL 331
               N    +   G +K   + ++L  N +    G I+FG  D +K+ G+L  +PI    
Sbjct: 77  PPIYN----MMERGQLKDPMFGIFLPKNLAHINEGEIIFGGYDSTKFAGSLEWLPITK-- 130

Query: 332 SASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATEL 391
              GF   ++F+                T+    + A+LD+G++LT LP  +       L
Sbjct: 131 --KGFWE-VEFN---------SISTGESTVQGEGLGAILDTGSSLTLLPTEIFDKFNGAL 178

Query: 392 GAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGT 451
            A   S+ G  V     + + EIVF+ GG       + +I+  G+ C++ I P +    +
Sbjct: 179 EAALGSKTGGRVSCSARETAPEIVFELGGKKFAITGNEYIMPAGSECMVTIRPQASGAQS 238

Query: 452 ---ILGDSFLTNAYVVYDLENLEISMAQA 477
              ILG  FL   Y VYDL +  + +A+A
Sbjct: 239 NVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 116/288 (40%), Gaps = 48/288 (16%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A              G+LG+G   + 
Sbjct: 160 FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIA 218

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLK--NSGAIKSNTYSLYLN---DSDAMHGTILFGAVD 314
           V                   P V K  N G +    ++ YLN   DS+   G + FG +D
Sbjct: 219 VD---------------KVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGID 263

Query: 315 HSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGT 374
            SKY G +  +P+            ++FD               +        A +D+GT
Sbjct: 264 SSKYKGNITWLPVRRKAYWE-----VKFD---------GIGLGDEYAELEGTGAAIDTGT 309

Query: 375 TLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILS 433
           +L  LP  +  ++  E+GA+     G Y +DC S D + ++ F F G +       + L 
Sbjct: 310 SLIALPSGLAEVLNAEIGAK-KGWSGQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLE 368

Query: 434 TGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
              +C+    P    +  G   I+GD+FL   Y VYDL N  + +AQA
Sbjct: 369 VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQA 416

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           Y  ++ +GTPPQ+  V++DTGSS+LW+
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWV 129

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 117/285 (41%), Gaps = 43/285 (15%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G+   G    D L+L DL++T   FA A              G+LG+G   + 
Sbjct: 162 FAIRYGSGSL-EGYISQDTLNLGDLSITKQDFAEATSEPGLQFAFGKFDGILGLGYDTIS 220

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL-NDSDAMHGTIL-FGAVDHSK 317
           V            A+K           G +    ++ YL  D ++  G +  FG VD SK
Sbjct: 221 VD---GVVPPFYNAWK----------QGLLDEPKFAFYLGRDGESQDGGVATFGGVDDSK 267

Query: 318 YTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLT 377
           Y G +  +PI            ++FD               +        A +D+GT+L 
Sbjct: 268 YEGEITWLPIRRKAYWE-----VKFD---------GIGLGEEYAELENHGAAIDTGTSLI 313

Query: 378 YLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILSTGT 436
            LP  +  +I  E+GA+  S  G Y ++C +  S+  + F  GG +       +IL    
Sbjct: 314 ALPSGLAEIINAEIGAK-KSWTGQYTVECEARSSLPNMTFTLGGHNFELTAYDYILEVSG 372

Query: 437 TCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
            C+  I P    +  G   I+GDSFL   Y +YDL N  + +A A
Sbjct: 373 QCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLADA 417

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 27/37 (72%), Gaps = 3/37 (8%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
           Y  ++ +GTPPQN  V++DTGSS+LW+  ++   CSS
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWVPSTE---CSS 138

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 117/282 (41%), Gaps = 49/282 (17%)

Query: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP 60
           M+L+ + +  L    +  +L     AA     +S   +VK P  KL      N+    + 
Sbjct: 17  MRLRNIINMQLFPFLSLTLLLTYFQAAFGSSSNS---YVKFPVQKLANIPNTNL----QD 69

Query: 61  EVRLLKRADGYEEIIITNQQS--FYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCS 118
              + KR++ +   II    S   Y V++++GTPPQ   + +DTGSSD+ +  +D+ +C 
Sbjct: 70  ASGISKRSEAFNSTIINMFASAGIYVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCK 129

Query: 119 SNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSXXXXXXXXXXXXXXXXXQSVP 178
           S         + D  +  +S   L          T T +                   +P
Sbjct: 130 S---------LADDNNIWTSNYEL----------TATATETLST-------------PLP 157

Query: 179 ASEATMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSF 238
           +      C  +                 F ++YG       T+GTDV+ L ++ ++  +F
Sbjct: 158 SVHHITSCSYWGTFNPNISSTFKYNETIFDLTYG-------TYGTDVVSLGNITLSNYTF 210

Query: 239 AVANETNSTMGVLGIGLPELEVTYSGSTASHSGKA-YKYDNF 279
            V+N+T  + G+LGI LP  E+T  G  A  S K  + YDNF
Sbjct: 211 GVSNDTTMSYGILGISLPSEEITDRGQDALSSNKTPFAYDNF 252

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 133/283 (46%), Gaps = 45/283 (15%)

Query: 231 LNVTGLSFAVANETN-STMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAI 289
           L+++ +SF     +N  + G+LG+     +VT  G T   S +  +Y  F  +LK++  I
Sbjct: 161 LSISNVSFFNIESSNFKSSGLLGL---SGKVTNPG-TDIDSSQYTEYSYFLSLLKDANFI 216

Query: 290 KSNTYSLYLNDSDAMH----------GTILFGAVDHSKYTGTL-------YTIPIVNTLS 332
           +S +YSL+L    + +          G +L G VD S +TGTL       Y  P+ N ++
Sbjct: 217 ESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGTLGQFDLIPYADPVTNAIT 276

Query: 333 ASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI--PALLDSGTTLTYLPQTVVSMIATE 390
             G+  PI   V                +T+     PALLDS ++++YLP + +  IA +
Sbjct: 277 I-GY--PI---VPLGPIYIVSNSGESLNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAVQ 330

Query: 391 LGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPL-------------SSFILSTGT 436
           + A Y   +  +++ C  +D  + + F      I  PL             SS + S+G 
Sbjct: 331 IAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLLSSTYDTSTNSSMLFSSGQ 390

Query: 437 -TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQAR 478
             C L +   ++    ILG++F+ N Y+  DLE+  I++AQA+
Sbjct: 391 EACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQAK 433

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 130/320 (40%), Gaps = 51/320 (15%)

Query: 177 VPASEA-TMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTG 235
           VP+SE  ++ C  +                 F+I YG G+   G    D L++ DL +  
Sbjct: 118 VPSSECNSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPK 176

Query: 236 LSFAVA-NETNSTM------GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNS-- 286
             FA A +E   T       G+LG+    + V                D       N+  
Sbjct: 177 QDFAEATSEPGLTFAFGKFDGILGLAYDTISV----------------DKVVPPFYNAIE 220

Query: 287 -GAIKSNTYSLYLNDS---DAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQF 342
            G +    ++ YL D+   +   G I  G +D SK+ G +  +P+            ++F
Sbjct: 221 QGLLDEKKFAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPVRRKAYWE-----VKF 275

Query: 343 DVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYY 402
           +               +        A +D+GT+L  LP  +  +I TE+GA+     G Y
Sbjct: 276 E---------GIALGDQYAALENHGAAIDTGTSLITLPSGLAEIINTEIGAK-KGWTGQY 325

Query: 403 VLDCPSDDSM-EIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTS--DDTG--TILGDSF 457
            LDC + D + ++ F+F G +       + L    +C+  I+P    +  G   I+GD+F
Sbjct: 326 TLDCDTRDGLPDLTFNFNGKNFTISPFDYTLEVSGSCISAIMPMDFPEPMGPMAIVGDAF 385

Query: 458 LTNAYVVYDLENLEISMAQA 477
           L   Y +YDL+N  + +A+A
Sbjct: 386 LRKYYSIYDLDNHAVGLAEA 405

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 64  LLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
                DG+   +     + Y  D+ VGTPPQN  V++DTGSS+LW+  S+   C+S
Sbjct: 73  FFAEGDGHNVPLTNYLNAQYFADISVGTPPQNFKVILDTGSSNLWVPSSE---CNS 125

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 95/200 (47%), Gaps = 23/200 (11%)

Query: 286 SGAIKSNTYSLYLNDSDAMH---GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQF 342
            G +  N ++ YL D++  +   G   FG  D SK+TG +  +P+            ++F
Sbjct: 234 QGILDENKFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDITWLPVRRKAYWE-----VKF 288

Query: 343 DVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYY 402
           D               +  +     A +D+GT+L  LP  +  +I T++GA+  S  G Y
Sbjct: 289 D---------SIALGDEVASLDGYGAAIDTGTSLITLPSGLAEVINTQIGAK-KSWSGQY 338

Query: 403 VLDCPSDDSM-EIVFDFGGFHINAPLSSFILSTGTTCLLGIIPTS--DDTG--TILGDSF 457
            +DC + D++ ++ F+F G++       + L    +C+  I P    +  G   I+GD+F
Sbjct: 339 TIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMSGSCISAITPMDFPEPVGPLAIIGDAF 398

Query: 458 LTNAYVVYDLENLEISMAQA 477
           L   Y +YDL+N  + +A++
Sbjct: 399 LRKYYSIYDLDNNAVGLAKS 418

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 3/37 (8%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSS 119
           Y  D+ +GTP QN  V++DTGSS+LW+   D   C+S
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWVPSKD---CTS 137

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 87/311 (27%), Positives = 144/311 (46%), Gaps = 50/311 (16%)

Query: 231 LNVTGLSFAVANETN-STMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAI 289
           L+++ +SF     +N  T G+LG+     +VT  G+ A  S +  +   F  +LK++  I
Sbjct: 171 LSISNVSFFDIQSSNFKTSGLLGL---SGKVTNPGN-AIDSSQYTEQSYFLSLLKDADII 226

Query: 290 KSNTYSLYL----------NDSDAMHGTILFGAVDHSKYTGTL-------YTIPIVNTLS 332
           +S++YSL+L           D  +  G +L G VD S +TGTL       Y  P+ N +S
Sbjct: 227 ESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPYVDPVSNAVS 286

Query: 333 ASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI--PALLDSGTTLTYLPQTVVSMIATE 390
             G+  PI   V                +T+     PALLDS ++++YLP + +  IA +
Sbjct: 287 V-GY--PI---VPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAVQ 340

Query: 391 LGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPL-------------SSFILSTGT 436
           + A Y   +  +++ C  +D  + + F      I  PL             SS   S+G 
Sbjct: 341 IAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSMFFSSGQ 400

Query: 437 -TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARY----NTTSENIEIITS 491
             C L +   ++    ILG++F+ N Y+  DLE+  I++AQA+       T E  E   S
Sbjct: 401 EACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDDAVTEETNETTAS 460

Query: 492 SVPSAVKAPGY 502
           ++   +K+ GY
Sbjct: 461 TIIKKIKS-GY 470

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 123/291 (42%), Gaps = 54/291 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G   + 
Sbjct: 148 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTIS 206

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSN-----TYSLYLNDS--DAMHG-TILFG 311
           V                    +V     AI+ +      ++ YL D+  D+ +G    FG
Sbjct: 207 VD------------------KVVPPFYNAIQQDLLDEKKFAFYLGDTSKDSENGGEATFG 248

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLD 371
            +D SK+ G +  +P+            ++F+                        A +D
Sbjct: 249 GIDESKFKGDITWLPVRRKAYWE-----VKFEGIGLGDEYAELESHG---------AAID 294

Query: 372 SGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSF 430
           +GT+L  LP  +  MI  ELGA+     G Y LDC + DS+ +++F+F G++       +
Sbjct: 295 TGTSLITLPSGLAEMINAELGAK-KGWTGQYTLDCNTRDSLPDLIFNFNGYNYTIGPYDY 353

Query: 431 ILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
            L    +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 354 TLEVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAKA 404

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 49/103 (47%), Gaps = 14/103 (13%)

Query: 60  PEVRLLKR----ADGYEEIIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDN 114
           PEV   +      +G  ++ +TN   + Y  D+ +GTPPQN  V++DTGSS+LW+     
Sbjct: 63  PEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV----- 117

Query: 115 PYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS 157
               SN  GS    +  K D  +S     N    F    GTGS
Sbjct: 118 ---PSNECGSLACFLHSKYDHEASSSYKANGTE-FAIQYGTGS 156

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 123/291 (42%), Gaps = 54/291 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G   + 
Sbjct: 148 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTIS 206

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSN-----TYSLYLNDS--DAMHG-TILFG 311
           V                    +V     AI+ +      ++ YL D+  D+ +G    FG
Sbjct: 207 VD------------------KVVPPFYNAIQQDLLDEKKFAFYLGDTSKDSENGGEATFG 248

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLD 371
            +D SK+ G +  +P+            ++F+                        A +D
Sbjct: 249 GIDESKFKGDITWLPVRRKAYWE-----VKFEGIGLGDEYAELEGHG---------AAID 294

Query: 372 SGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSF 430
           +GT+L  LP  +  MI  ELGA+     G Y LDC + DS+ +++F+F G++       +
Sbjct: 295 TGTSLITLPSGLAEMINAELGAK-KGWTGQYTLDCNTRDSLPDLIFNFNGYNFTIGPYDY 353

Query: 431 ILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
            L    +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 354 TLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAKA 404

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 49/103 (47%), Gaps = 14/103 (13%)

Query: 60  PEVRLLKR----ADGYEEIIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDN 114
           PEV   +      +G  ++ +TN   + Y  D+ +GTPPQN  V++DTGSS+LW+     
Sbjct: 63  PEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV----- 117

Query: 115 PYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS 157
               SN  GS    +  K D  +S     N    F    GTGS
Sbjct: 118 ---PSNECGSLACFLHSKYDHEASSSYKANGTE-FAIQYGTGS 156

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 133/299 (44%), Gaps = 65/299 (21%)

Query: 231 LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDN-FPIV--LKNSG 287
           L ++  SF   N+T S+ GVLG+G    ++   G+    S    ++D+ F ++  L+++G
Sbjct: 289 LTLSNSSFFEINDTTSSKGVLGLGG---KINDKGTDIDSS----QFDSSFFLLESLRDNG 341

Query: 288 AIKSNTYSLYL------------NDSDAMH-GTILFGAVDHSKYTGTLYTIPIVNTLSAS 334
            I+S +YSL+L            N  D ++ G ++ G VD   Y+G L            
Sbjct: 342 IIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPL-----------K 390

Query: 335 GFSSPIQFDVTXXXXXXXXXXXXXKTLTTTK--------------IPALLDSGTTLTYLP 380
            F++ I  D               +T+                   P LLDS  + ++LP
Sbjct: 391 KFNNLIFLDSRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLP 450

Query: 381 QTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILSTGT--- 436
              +  IA ++ A Y   +  +V+ C  +D  + I F+FG   I+ P   F++ST     
Sbjct: 451 AETIVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPET 510

Query: 437 -----------TCLLGIIPTSDDTG-TILGDSFLTNAYVVYDLENLEISMAQARYNTTS 483
                       C + ++ +S++TG  ILG SFL N Y+  D ++  I++AQAR   T+
Sbjct: 511 NSTMKFSGGDEACFMTMV-SSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQARRKYTT 568

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 114/248 (45%), Gaps = 35/248 (14%)

Query: 289 IKSNTYSLYLNDSDAMH--GTILFGAVDHSKYTGTLY---TIPIVNT---LSASGFSSPI 340
           I+S  YS  L DS A+   G ++FG VD S YTG L    T+P  N    +++ G+  PI
Sbjct: 223 IESYAYSSAL-DSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGY--PI 279

Query: 341 QFDVTXXXXXXXXXXXXXKTLTTTKI--PALLDSGTTLTYLPQTVVSMIATELGAQYSSR 398
              V              K LT+     P LLD+     YLP  ++  IAT+  A Y   
Sbjct: 280 ---VPLVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVES 336

Query: 399 IGYYVLDCPSDD-SMEIVFDFGGFHINAPLSSFILST------GT--------TCLLGII 443
           +  ++L C        I+FDFG   I+ PLS  +  T      GT         C L  +
Sbjct: 337 LNRWLLACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFL 396

Query: 444 PTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYT 503
           P SD   +ILG  F+ N Y+  +L++ ++++AQA    T    E ++S++  ++    Y 
Sbjct: 397 PNSDLGFSILGGPFIKNVYLAAELQSNQVALAQAYKWPT----ETVSSNLGGSISVSTYA 452

Query: 504 NTWSTSAS 511
           N+   S S
Sbjct: 453 NSERQSRS 460

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 91/196 (46%), Gaps = 28/196 (14%)

Query: 306 GTILFGAVDHSKYTGTLY---TIPIVNTLS---ASGFSSPIQFDVTXXXXXXXXXXXXXK 359
           G ++FGAVD S YTG      TIP  N  +   + G+  PI   +              K
Sbjct: 241 GKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGY--PI---IPLTKVNVQSKSGETK 295

Query: 360 TLTTTKI--PALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDD-SMEIVF 416
            +T+     P L+DS     YLP  ++  IA +  A Y   +  ++L C        I+F
Sbjct: 296 NMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLACDVGRLGASIIF 355

Query: 417 DFGGFHINAPLSSFILST------GT--------TCLLGIIPTSDDTGTILGDSFLTNAY 462
           +FG   IN PL++ +  T      GT         C L ++P++     +LG +F+ N Y
Sbjct: 356 EFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKNVY 415

Query: 463 VVYDLENLEISMAQAR 478
           +  +LE+ ++++AQA+
Sbjct: 416 MAAELESNQVALAQAQ 431

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 135/301 (44%), Gaps = 44/301 (14%)

Query: 214 GTFASGTFGTDVLDLSDLNVTGLSFAVANETN-STMGVLGIGLPELEVTYSGSTASHSGK 272
           GT++  +  T ++    ++++ +SF   N  +  T G LG+G         GS A  S K
Sbjct: 133 GTYSIDSSSTAIIGSDYMSISNISFFETNYASFYTAGSLGLG----GRISDGSAAIDSEK 188

Query: 273 AYKYDNFPIVLKNSGAIKSNTYSLYL-------------NDSDAMHGTILFGAVDHSKYT 319
                 F   L N G IK+ +YSL+              + + A  G ++ GAVD S YT
Sbjct: 189 FDSSFFFLDRLMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYT 248

Query: 320 GTLYT---IPIVNTLS-ASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI--PALLDSG 373
           G L +   IP ++ +S A   + PI   +                +T+ +   P LLDS 
Sbjct: 249 GILRSFKMIPFIDPVSQAQSNNYPI---LPLGTIYINSANGKSLNMTSEEFVEPVLLDSR 305

Query: 374 TTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFIL 432
            + TYLP   +  IA ++GA +   +  +++ C  +   + + F FG   I  PL  F++
Sbjct: 306 YSTTYLPIDAIVQIAVQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLV 365

Query: 433 ST--------------GTTCLLGIIPTSDDTG-TILGDSFLTNAYVVYDLENLEISMAQA 477
           +T                 C L ++ + D TG  +LG  FL N Y+  D+E+  I++AQA
Sbjct: 366 TTYDPKSNTSLHFSTGEEACFLAMV-SKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQA 424

Query: 478 R 478
           +
Sbjct: 425 K 425

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 120/291 (41%), Gaps = 54/291 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G   + 
Sbjct: 148 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTIS 206

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSN-----TYSLYLNDSDA---MHGTILFG 311
           V                    +V     AI+ +      ++ YL D+       G   FG
Sbjct: 207 VD------------------KVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFG 248

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLD 371
            +D SK+ G +  +P+            ++F+                        A +D
Sbjct: 249 GIDESKFKGDITWLPVRRKAYWE-----VKFEGIGLGDEYAELESHG---------AAID 294

Query: 372 SGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSF 430
           +GT+L  LP  +  MI  E+GA+     G Y LDC + D++ +++F+F G++       +
Sbjct: 295 TGTSLITLPSGLAEMINAEIGAK-KGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDY 353

Query: 431 ILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
            L    +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 354 TLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKA 404

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 49/103 (47%), Gaps = 14/103 (13%)

Query: 60  PEVRLLKR----ADGYEEIIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDN 114
           PEV   +      +G  ++ +TN   + Y  D+ +GTPPQN  V++DTGSS+LW+     
Sbjct: 63  PEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV----- 117

Query: 115 PYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGS 157
               SN  GS    +  K D  +S     N    F    GTGS
Sbjct: 118 ---PSNECGSLACFLHSKYDHEASSSYKANGTE-FAIQYGTGS 156

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 121/291 (41%), Gaps = 54/291 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           FSI YG G+   G    D L + DL +    FA A              G+LG+    + 
Sbjct: 158 FSIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDTIS 216

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSN-----TYSLYLNDS--DAMHG-TILFG 311
           V                    +V     A++ +      ++ YL D+  DA  G   +FG
Sbjct: 217 VD------------------KVVPPFYNALEQDLLDEAKFAFYLGDTNKDAEDGGEAIFG 258

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLD 371
            VD SKYTG +  +P+              ++V              ++       A +D
Sbjct: 259 GVDKSKYTGDVTWLPVRRK---------AYWEVKLEGLGLGDEYAELESHG-----AAID 304

Query: 372 SGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSF 430
           +GT+L  LP  +  +I +E+GA+     G Y L+C + D + ++ F+F G++       +
Sbjct: 305 TGTSLITLPSGLAEIINSEIGAK-KGWTGQYTLECNTRDQLPDLTFNFNGYNFTIGPYDY 363

Query: 431 ILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
            L    +C+  I P    +  G   I+GD+FL   Y +YDLE+  + +A+A
Sbjct: 364 TLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAVGLAKA 414

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 8/71 (11%)

Query: 68  ADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRR 127
           A G+E  +     + Y  D+ +GTPPQ   V++DTGSS+LW+         S+  GS   
Sbjct: 86  AKGHEVPLSNYLNAQYYTDITLGTPPQQFKVILDTGSSNLWV--------PSSECGSLAC 137

Query: 128 RVIDKRDDSSS 138
            + +K D S+S
Sbjct: 138 FLHEKYDHSAS 148

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 109/234 (46%), Gaps = 40/234 (17%)

Query: 279 FPIVLKNSGAIKSNTYSLYLNDSDAMH----------GTILFGAVDHSKYTGTL------ 322
           F  +L ++  I+  +YSL+L    + +          G +L G VD S +TGTL      
Sbjct: 217 FLSLLTDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLI 276

Query: 323 -YTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI--PALLDSGTTLTYL 379
            Y  P+ N +S +G+  PI   V                +T+     PALLDS ++++YL
Sbjct: 277 PYVDPVSNVVS-TGY--PI---VPLGPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYL 330

Query: 380 PQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILSTGTT- 437
           P + +  IA ++ A Y   +  ++++C  +D  + + F F    I  PLS  + ST  T 
Sbjct: 331 PTSTIIQIAVQIAATYVESLDRWLVECSMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTT 390

Query: 438 -------------CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQAR 478
                        C L +   ++    ILG++F+ N Y+  DLE+  I++AQA+
Sbjct: 391 TNSSMFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQAK 444

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 121/291 (41%), Gaps = 54/291 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G   + 
Sbjct: 149 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTIS 207

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSN-----TYSLYLNDS--DAMHG-TILFG 311
           V                    +V     AI+ +      ++ YL D+  D+ +G    FG
Sbjct: 208 VD------------------KVVPPFYNAIQQDLLDEKKFAFYLGDTSKDSENGGEATFG 249

Query: 312 AVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLD 371
            +D SK+ G +  +P+            ++F+                        A +D
Sbjct: 250 GIDKSKFKGDVTWLPVRRKAYWE-----VKFEGIGLGHEFAELEGHG---------AAID 295

Query: 372 SGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSF 430
           +GT+L  LP  +  MI  E+GA+     G Y LDC + D + ++ F+F G++       +
Sbjct: 296 TGTSLITLPSGLAEMINAEIGAK-KGWSGQYALDCNTRDGLPDLTFNFNGYNFTIGPYDY 354

Query: 431 ILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
            L    +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 355 TLEVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLAEA 405

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 5/55 (9%)

Query: 60  PEVRLLKR----ADGYEEIIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           PE+   +      +G  ++ +TN   + Y  D+ +G PPQN  V++DTGSS+LW+
Sbjct: 64  PEIAFSREHPFFTEGGHDVPLTNYLNAQYYTDISLGNPPQNFKVILDTGSSNLWV 118

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 115/288 (39%), Gaps = 48/288 (16%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G+   G    DV+++ DL +T   FA A              G+LG+    + 
Sbjct: 156 FAIQYGSGSL-EGYISQDVMEIGDLKITKQDFAEATSEPGISFAFGKFDGILGLAYDTIA 214

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLK--NSGAIKSNTYSLYLNDSDAMH---GTILFGAVD 314
           V                   P V    N G +    ++ YL D+       G  +FG +D
Sbjct: 215 VNRV---------------VPPVYNAINQGLLDEPKFAFYLGDASKSKDNGGEAVFGGID 259

Query: 315 HSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGT 374
            +K+ G +  +P+              ++V              +        A +D+GT
Sbjct: 260 ETKFEGDITWLPV---------RRKAYWEVKLEGLGLGEEYTELENHG-----AAIDTGT 305

Query: 375 TLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILS 433
           +L  LP  +  +I +E+GA+     G Y ++C    S+ ++ F F G++       + L 
Sbjct: 306 SLITLPSGLAEIINSEIGAK-KGWTGQYTIECDKRASLPDMTFTFDGYNFTISPYDYTLE 364

Query: 434 TGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
              +C+  I P    +  G   I+GD+FL   Y VYDL N  + +A A
Sbjct: 365 VSGSCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLAPA 412

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 31/47 (65%)

Query: 63  RLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWI 109
            ++ +  G+E  +     + Y  D+++GTPPQ+  V++DTGSS+LW+
Sbjct: 79  EIVSKNGGHEVPLSNYMNAQYFADIKIGTPPQSFKVVLDTGSSNLWV 125

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 117/290 (40%), Gaps = 53/290 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G+   G    D+L + DL +    FA A              G+LG+    + 
Sbjct: 153 FAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEATSEPGLAFAFGKFDGILGLAYDSIS 211

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSN-----TYSLYLNDSDAMH--GTILFGA 312
           V                    IV     AIK+       ++ YL DSD     G   FG 
Sbjct: 212 VNR------------------IVPPVYNAIKNKLLDDPVFAFYLGDSDKSEDGGEASFGG 253

Query: 313 VDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDS 372
           +D  KYTG +  +P+            ++F+               +  T     A +D+
Sbjct: 254 IDEEKYTGEITWLPVRRKAYWE-----VKFE---------GIGLGEEYATLEGHGAAIDT 299

Query: 373 GTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFI 431
           GT+L  LP  +  ++  E+GA+     G Y +DC S DS+ ++  +F G++       + 
Sbjct: 300 GTSLIALPSGLAEILNAEIGAK-KGWSGQYSVDCESRDSLPDLTLNFNGYNFTITAYDYT 358

Query: 432 LSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
           L    +C+    P    +  G   I+GD+FL   Y +YD+ +  + +A+A
Sbjct: 359 LEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLAKA 408

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 59  KPEVRLLKRADGYEEIIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           K  V +    +G   + +TN   + Y  ++ +G+PPQ+  V++DTGSS+LW+
Sbjct: 71  KDNVDVFVAPEGSHSVPLTNYLNAQYFTEITLGSPPQSFKVILDTGSSNLWV 122

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 140/304 (46%), Gaps = 51/304 (16%)

Query: 217 ASGTFGTDVLDLS--------DLNVTGLSFAVANETN-STMGVLGIGLPELEVTYSGSTA 267
           +SGT  T++L            L+++ +SF     +N  T G+LG+     ++T  GS A
Sbjct: 149 SSGTLVTELLKTRGNVQFNSGSLSISNVSFFSVESSNFKTSGLLGL---SGKITNPGS-A 204

Query: 268 SHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMH----------GTILFGAVDHSK 317
           + S    +   F  +LK+   I+S +YSL+L    + +          G +L G VD S 
Sbjct: 205 ADSSHYTEQSYFLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSL 264

Query: 318 YTGTLYT---IPIVNTLSAS---GFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI--PAL 369
           +TGTL     IP V+ +S++   G+  PI   V                +T+     PAL
Sbjct: 265 FTGTLGKFDLIPYVDPVSSAVSTGY--PI---VPLGPIYIVSNSGQSLNMTSKDFLSPAL 319

Query: 370 LDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPL- 427
           LDS ++++YLP   +  IA ++ A Y   +  +++ C  ++  + + F      I  PL 
Sbjct: 320 LDSTSSVSYLPTNTIIQIAVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLR 379

Query: 428 ------------SSFILSTGT-TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISM 474
                       SS   S+G   C L +   ++    ILG++F+ N Y+  DLE+  I++
Sbjct: 380 DLLSSTYDTSTNSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAI 439

Query: 475 AQAR 478
           AQA+
Sbjct: 440 AQAK 443

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 102/234 (43%), Gaps = 46/234 (19%)

Query: 283 LKNSGAIKSNTYSLYLNDS----DAMH----------GTILFGAVDHSKYTGTLYT---I 325
           L NSG I++ +YS++  +     D  H          G I+FG VD S   GT  +   I
Sbjct: 229 LLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDGTFQSFTMI 288

Query: 326 PIVNT---LSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI----PALLDSGTTLTY 378
           P  +T   L+ SG+  PI                  +TL  T +    P LLDS  T + 
Sbjct: 289 PYEDTSDGLTTSGY--PI-----LPMGPIYIIANSGRTLNLTTLDFLEPVLLDSRITNSR 341

Query: 379 LPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILSTGTT 437
           LP + +  +A +L A Y   +  +V+ C  +D ++   F FG   I  PL  F++ +G T
Sbjct: 342 LPASFIIQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIRVPLEDFLVPSGLT 401

Query: 438 --------------CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
                         C L + P +D    ILG  FL NA +  D  + +I++ +A
Sbjct: 402 GDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIAIGKA 455

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 115/287 (40%), Gaps = 47/287 (16%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G+   G    D L + DL +    FA A              G+LG+    + 
Sbjct: 148 FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDSIS 206

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLK--NSGAIKSNTYSLYLNDSDAM--HGTILFGAVDH 315
           V                   P V    ++G +    +S YL ++D     G   FG +D 
Sbjct: 207 VD---------------KVVPPVYNAIHNGLLDEPKFSFYLGNADKSTDGGEATFGGIDS 251

Query: 316 SKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTT 375
           SKY G +  +P+            ++FD                        A +D+GT+
Sbjct: 252 SKYEGNITWLPVRRKAYWE-----VKFDGIGLGDEYAILDGHG---------AAIDTGTS 297

Query: 376 LTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILST 434
           L  LP  +  ++  E+GA+     G Y ++C + DS+ ++  +FGG++       + L  
Sbjct: 298 LIALPSGLAEILNAEIGAK-KGWSGQYSVECDTRDSLPDLTLNFGGYNFTITPYDYTLEV 356

Query: 435 GTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
             +C+    P    +  G   I+GD+FL   Y VYDL N  + +A+A
Sbjct: 357 SGSCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAKA 403

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 60  PEVRLLKRADGYEE----IIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           PE    K    Y E    + +TN   + Y  ++ +GTPPQN  V++DTGSS+LW+
Sbjct: 63  PEAEFAKEHQFYAEAGHDVPLTNYLNAQYYTEISLGTPPQNFKVILDTGSSNLWV 117

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 121/295 (41%), Gaps = 62/295 (21%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 259
           F+I YG G+   G    D L++ DLN+    FA A +E   T       G+LG+    + 
Sbjct: 151 FAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEATSEPGLTFAFGKFDGILGLAYDSIS 209

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIK-----SNTYSLYLNDSDAMH---GTILFG 311
           V                    +V     AI+        ++ YL D++      G I  G
Sbjct: 210 VN------------------KVVPPFYNAIEQELLDEKKFAFYLGDANKKSEDGGEITIG 251

Query: 312 AVDHSKYTGTLYTIPIVNT----LSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIP 367
            +D +K+ G +  +P+       +   G     QF                         
Sbjct: 252 GIDKTKFKGDIDWLPVRRKAYWEVKFEGIGLGDQF------------------AELENHG 293

Query: 368 ALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAP 426
           A +D+GT+L  LP  +  +I TE+GA+     G Y ++C +  ++ ++ F+F G +    
Sbjct: 294 AAIDTGTSLIALPSGLAEIINTEIGAK-KGWTGQYTVECDARPNLPDLTFNFNGKNFTIG 352

Query: 427 LSSFILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
              + L    +C+  I+P    +  G   I+GD+FL   Y +YDLEN  + +A+A
Sbjct: 353 PYDYTLEVSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGLAEA 407

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           Y  D+ +GTPPQ+  V++DTGSS+LW+
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV 120

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 113/278 (40%), Gaps = 29/278 (10%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           FSI YG G+   G    DVL + DL + G  FA A          G     L + Y    
Sbjct: 146 FSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEATSEPGLAFAFGKFDGILGLAYDTIA 204

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMH--GTILFGAVDHSKYTGTLYT 324
            +     + Y+       N   +    +S YL D       G + FG  D S +TG +  
Sbjct: 205 VNRVVPPF-YNAI-----NKKLVDEPIFSFYLGDDTKSEDGGQVTFGGYDSSLFTGDITW 258

Query: 325 IPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVV 384
           +P+            ++FD               +        A +D+GT+L  LP  + 
Sbjct: 259 LPVRRKAYWE-----VKFDAI---------ALGNEVADLVNHGAAIDTGTSLITLPSGLA 304

Query: 385 SMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILSTGTTCLLGII 443
            +I +++GA+  S  G +++DC + D++ ++ F F G++       + L    +C+  I 
Sbjct: 305 EVINSQIGAK-KSWSGQWIVDCKTRDTLPDMTFTFDGYNFTITPYDYTLEVSGSCISAIT 363

Query: 444 PTSDDTG----TILGDSFLTNAYVVYDLENLEISMAQA 477
           P           I+GD+FL   Y +YD+ N  + +A A
Sbjct: 364 PMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLAAA 401

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSS 137
           Y  D+ +GTP Q+  V++DTGSS+LW+     P    NS+        D  D S+
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWV-----PSVDCNSLACYLHAKYDHSDSST 138

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 115/281 (40%), Gaps = 51/281 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F+I YG G    G    D + + DL +    FA A              G+ G+    + 
Sbjct: 156 FAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEATSEPGLAFAFGKFDGIFGLAFDTIS 214

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMH--GTILFGAVDHSK 317
           V  +     ++              N G + +  ++ YL D       G + FG  D ++
Sbjct: 215 VNRAVPPFYNA-------------VNRGLLDAPQFAFYLGDKRLRKEGGEVTFGGYDETR 261

Query: 318 YTGTLYTIPIVNT----LSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSG 373
           +TG +  +P+       +  +G S   Q+                  LT T   A +D+G
Sbjct: 262 FTGNITWLPVRREAYWEVDFNGISFGSQY----------------APLTATG--AAIDTG 303

Query: 374 TTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFIL 432
           T+L  LP  +  ++  ++GA+  +  G YVLDC    ++ +I F+ GG + +     + L
Sbjct: 304 TSLITLPSGLAEILNAQIGAR-KNWSGQYVLDCSRRSTLPDITFNLGGSNFSIGPYDYTL 362

Query: 433 STGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLEN 469
               TC+  I+P    +  G   I+GD+FL   Y VYDL N
Sbjct: 363 EASGTCISAIVPMDFPEPVGPLAIIGDAFLRRWYSVYDLGN 403

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKR 133
           Y  D+ +G+P Q   V++DTGSS+LW+     P    NS+        D R
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWV-----PSVDCNSLACFLHNKYDHR 144

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           F  +YGDGT+  GT+GTDV+ L ++ +   SF VAN T +  G+LGI LP  E T+S   
Sbjct: 51  FDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGG 110

Query: 267 ASHSGKAYKYDNFP 280
           A ++   ++Y+NFP
Sbjct: 111 A-YNTTPFEYENFP 123

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 108/280 (38%), Gaps = 32/280 (11%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 266
           FS+SYG G+   G    D L + DL +    FA A     +  V G     L + Y G  
Sbjct: 158 FSVSYGKGSM-EGFVSYDTLKIGDLTIKNQGFAEATVEPGSAFVYGQFDGILGLAYDGLA 216

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDS---DAMHGTILFGAVDHSKYTGTLY 323
            +H    + Y+       + G +    ++ YL+D    D++ G ++FG  D +K+TG + 
Sbjct: 217 VNHIVPPF-YEAV-----HQGLLDEPVFAFYLSDEKKGDSLAGEVVFGGYDETKFTGEIS 270

Query: 324 TIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTV 383
            +P++                              +          LD+GT+    P  +
Sbjct: 271 WLPVIRK--------------AYWEVELNSITLGSQKFQLQNYGGALDTGTSFITFPSEL 316

Query: 384 VSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFILS-TGTTCLLGI 442
                ++ GA      G+ +  C      ++ F+  G       S +++    TTC + I
Sbjct: 317 YQEFVSKTGATVDPDDGHIIAPCSGSGFPDLTFELAGRSFTISSSDYVVQWDDTTCAVAI 376

Query: 443 IPTSDDTG-----TILGDSFLTNAYVVYDLENLEISMAQA 477
            P   D G      I+GD FL   Y +YDL    + +A++
Sbjct: 377 TPL--DLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGLAKS 414

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 75  IITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDK 132
            + NQ   Y  ++ +GTPPQ+  V++DTGSS+LW+    N  C S +  +  R   D+
Sbjct: 96  FVNNQ---YYSEIGLGTPPQSFKVVMDTGSSNLWV---PNKNCVSEACLNHARFDHDR 147

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 112/272 (41%), Gaps = 52/272 (19%)

Query: 247 TMGVLGIGLPELEVTYSGSTASHSGKAYKY--DNFPIV--LKNSGAIKSNTYSLYLNDSD 302
           T+G LG+         S +T+  SG +  +  D+F  +  L NS  I + +YSL+L    
Sbjct: 180 TIGSLGLA--------SSTTSDLSGASLDFVDDSFSFLTYLSNSEVIDTPSYSLWLGGDT 231

Query: 303 AMH--------------GTILFGAVDHSKYTGTLYTIPIV-----NTLSASGFSSPIQFD 343
             +              G ++ GAVD   Y G L    ++     N   A  +  PI   
Sbjct: 232 LPYTNMTSINSTTIDYCGNLVLGAVDQRYYEGRLVQFDMLPALLNNVTEAVTYGLPI--- 288

Query: 344 VTXXXXXXXXXXXXXKTLTTTKI--PALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGY 401
           +                LTTT    P LLDS  T   LP   V  IAT+L A Y    G 
Sbjct: 289 IPMGPIYIENSSGTQLNLTTTNFLEPVLLDSRYTNARLPLNTVIQIATQLNAAYVEEFGS 348

Query: 402 YVLDCP-SDDSMEIVFDFGGFHINAPLSSFI---------------LSTGTTCLLGIIPT 445
           ++++C  ++ ++ + F+F G  I   L+ F+                S+   C L + P 
Sbjct: 349 WIVECSLAEMNVNLNFNFQGLTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPN 408

Query: 446 SDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
           +D    ILG  FL N Y+  D E   +++A+A
Sbjct: 409 TDIGFNILGGPFLKNIYLAIDNEGRSVAIAKA 440

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 122/276 (44%), Gaps = 39/276 (14%)

Query: 226 LDLSDLNVTGLSFAVANETNS-TMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLK 284
           LD   L++T +SF   + + S T G LG+G     +T  G   +  G    +     ++ 
Sbjct: 157 LDSDTLSMTNVSFINVDYSGSITQGALGLGG---RITAPGEDINSDGFDGSFFFLEQLVA 213

Query: 285 NSGAIKSNTYSLYL-------NDSDAMH-----GTILFGAVDHSKYTGTLY---TIPI-- 327
           N+  I S++YSL+L       +D D  +     G ++ GAVD S YTG      TIP   
Sbjct: 214 NN-VIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFDTIPFHD 272

Query: 328 VNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMI 387
           V+T  A+ F  PI   +T              T      P LLD+    ++LP  ++  I
Sbjct: 273 VDT-GATSFGYPI-VPLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLPLKLIIQI 330

Query: 388 ATELGAQYSSRIGYYVLDCPSDD-SMEIVFDFGGFHINAPLSSFI-------------LS 433
           A +  A Y   +  +++ C   D +  ++F+F G  I+ P+  F+              S
Sbjct: 331 AIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIKDFLSNSYDSVSNSTLHFS 390

Query: 434 TG-TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLE 468
            G + C L + P      ++LG +F+ NAY+  DLE
Sbjct: 391 NGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 120/279 (43%), Gaps = 35/279 (12%)

Query: 249 GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDA----- 303
           GVLG+G          ++ ++    + ++ F    K +   +SN+YSL+L + ++     
Sbjct: 208 GVLGLGGSITSSNEYENSGNYDSSYFIFNKF----KEANITQSNSYSLWLVEDESSLTTT 263

Query: 304 --------MHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXX 355
                     G +L G +D + Y G+LY   ++  +      S   + +           
Sbjct: 264 STKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIPYVDPESLVSSQGYPILPMGVIYVKSE 323

Query: 356 XXXKTLTTTK---IPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDS 411
              +   T+K    P LLDS     YLP+  +  IA ++GA Y   +  +++ C  +   
Sbjct: 324 SGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLVSCDMASYG 383

Query: 412 MEIVFDFGGFHINAPLSSFILST--------------GTTCLLGIIPTSDDTGTILGDSF 457
             ++F F G  I+ PL + + +T               T C L I   ++    +LG +F
Sbjct: 384 ASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYYSDGETACALTIYDNANMGYNLLGSAF 443

Query: 458 LTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSA 496
             N Y+  DLE   +++AQA+ +   ++  +  +++P+A
Sbjct: 444 FRNTYIAVDLEGNTVAIAQAKPSDEDDSSNLSATTLPAA 482

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 78  NQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSD--------NPYCSSNSM----GSS 125
           N Q  Y V+  VG P Q  ++++DT    LW++  +        N  C++NS+     SS
Sbjct: 69  NLQGRYYVNASVGEPQQEQSLVLDTTEPYLWVISGNVEMNCTDTNNVCNANSLYYYNESS 128

Query: 126 RRRVIDKRDD 135
               ID+  D
Sbjct: 129 SAVAIDENAD 138

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 117/265 (44%), Gaps = 36/265 (13%)

Query: 283 LKNSGAIKSNTYSLYLN-------------DSDAMHGTILFGAVDHSKYTGTLYTIPIVN 329
           + N   IKS +YSL+L              D+ ++ G ++ GAVD S Y G  +    ++
Sbjct: 208 MANLNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTIS 267

Query: 330 TLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKI---PALLDSGTTLTYLPQTVVSM 386
            +  S   S   + +              +   T++    PALLDS    ++LP   +  
Sbjct: 268 YIEPSHNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQ 327

Query: 387 IATELGAQYSSRIGYYVLDCPSDDSM--EIVFDFGGFHINAPLSSFILSTG--------- 435
           IA ++GA Y   +  +V+ C S  SM   I F F G  I  PLS  + S+          
Sbjct: 328 IAIQIGAIYIESLNRWVVPC-SVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNSTMH 386

Query: 436 -----TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIIT 490
                + C L +   +     +LG SF+ NAY+  DL+  ++++AQA+ NTT ++  I+T
Sbjct: 387 FAEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAK-NTTGDSTSIVT 445

Query: 491 SSVPSAVKAPGYTNTWSTSASIVTG 515
             V  A+   G T    T   I +G
Sbjct: 446 --VIPALTGGGSTTAVRTVRKISSG 468

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 112/285 (39%), Gaps = 43/285 (15%)

Query: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 259
           F I YG G+   G    D L + DL +    FA A              G+LG+    + 
Sbjct: 143 FVIQYGSGSL-KGYISQDTLTIGDLIIPQQDFAEATAEPGLAFAFGKFDGILGLAYDSIS 201

Query: 260 VTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMH--GTILFGAVDHSK 317
           V  +     ++              + G +    ++ YL D  +    G   FG  D S+
Sbjct: 202 VNKAVPPLYNA-------------IHRGLLDKPMFAFYLGDEKSSKNGGEATFGGYDPSR 248

Query: 318 YTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLT 377
           + G +  +P+            +QFD               K +      A +D+GT+L 
Sbjct: 249 FEGEIKWLPVRRKAYWE-----VQFD---------GIKLGDKFMKLEGHGAAIDTGTSLI 294

Query: 378 YLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAPLSSFILSTGT 436
            LP  +   +  E+GA+ S   G Y +DC   +S+ ++  +F   +       + L    
Sbjct: 295 TLPSQIADFLNNEIGAKKSWN-GQYTIDCKKRESLPKLTLNFYNHNFTIDPFDYTLEISG 353

Query: 437 TCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQA 477
           +C+  I P       G  +I+GD+FL   Y +YDLEN  + +A++
Sbjct: 354 SCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVGLAKS 398

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 28  NKRDDDSNSKFVKLP-FHKLYGDSLENVGSDKKPEVRLLKR----ADGYEEIIITNQQSF 82
            KRDD  + K ++L  +    G    N      PEV + K+     + ++  +     + 
Sbjct: 26  EKRDDSEDIKGIRLSDYISHLGRKYLNQFEKAFPEVHISKKDQFTIESHDVPLDNYLNAQ 85

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           Y  D+ +GTPPQ   V++DTGSS+LW+
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWV 112

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 94/338 (27%), Positives = 137/338 (40%), Gaps = 64/338 (18%)

Query: 207 FSISYGDGTFASGTFGTDVLDL----SDLNVTG----------------LSFAVANETNS 246
           +SI++ DG   +GT   DV+ L    S LNV+G                LSF  A+ ++ 
Sbjct: 112 YSINFIDGISLNGTRYMDVMRLMNVSSSLNVSGVDSGVSFRNHTLTVQNLSFFNADYSSG 171

Query: 247 TM-GVLGIGLP-----ELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL-- 298
            + G LG+G       ELE    G   +HS        F   LK +  I S++YSL+L  
Sbjct: 172 YLYGSLGLGGTLNSDTELE----GDFINHSFF------FLDALKEARLINSSSYSLWLGS 221

Query: 299 -------NDSDAMH-GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXX 350
                  + SDA   G ++FGAVD +   G      ++  +          + V      
Sbjct: 222 QKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYPVVPMGPI 281

Query: 351 XXXXXXXXKTLTTT---KIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP 407
                       TT     P LLD    L+YLP   +  IA ++ A Y   +  +++ C 
Sbjct: 282 YITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCD 341

Query: 408 SDDSMEIV-FDFGGFHINAPLSSFILST--------------GTTCLLGIIPTSDDTGTI 452
              S   V F FG   I  PLS  + ST                 C+L + P +     +
Sbjct: 342 VASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGYNV 401

Query: 453 LGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIIT 490
           LG +F+ NAY+  DLE   ++M QA    + E  EIIT
Sbjct: 402 LGQAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEIIT 439

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 118/278 (42%), Gaps = 35/278 (12%)

Query: 231 LNVTGLSFAVANETNS-TMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAI 289
           L V+ +SF  A++T    MG LG+     ++T +G+    S     YD F   L  +  I
Sbjct: 161 LGVSNVSFINADDTVPYAMGSLGL---SGKITGTGTDIDSSNFDNSYD-FLDRLYQTNLI 216

Query: 290 KSNTYSLYLNDSDAMHGT------------ILFGAVDHSKYTGTLYTIPIVNTLSASGFS 337
            S++YSL+L  +   +GT            ++ GAVD + +TG+     ++  L +   +
Sbjct: 217 DSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVDPTLFTGSFLQFEMLPALESDSAT 276

Query: 338 SPIQFDVTXXXXXXXXXXXXXKTLTTTK---IPALLDSGTTLTYLPQTVVSMIATELGAQ 394
             I + +                  T+K    P  LDS  T TYLP  ++  +A ++GA 
Sbjct: 277 ETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEPVFLDSTYTSTYLPLNMIIQVAIQIGAM 336

Query: 395 YSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFI-------------LSTG-TTCL 439
           Y   +  +++ C  ++    + F F    I  PL+  +              STG   C 
Sbjct: 337 YVESLERWLVPCNIANQHATLDFTFQDVSIRVPLTDLLGTTYDSSTNTSMHFSTGDEACY 396

Query: 440 LGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
           L I         ILG  FL + Y+  DL+   I++AQA
Sbjct: 397 LKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAIAQA 434

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 94/224 (41%), Gaps = 30/224 (13%)

Query: 283 LKNSGAIKSNTYSLYLNDSDAMH----------GTILFGAVDHSKYTGTLYT---IPIVN 329
           ++++G I S +YSL+  + +             GT++ GAVD   Y G  Y    +P V+
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 330 TLSASGFSS--PIQFDVTXXXXXXXXXXXXXKTLTTTKIPALLDSGTTLTYLPQTVVSMI 387
             S        PI   +T              T  T   P LL+S    ++LP+++V  I
Sbjct: 256 IASGQHTRGGYPI-VPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQI 314

Query: 388 ATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHINAPLSSFI----LSTGT------ 436
           A +  A ++      +++C    +     F FG   +  PLS FI    L  GT      
Sbjct: 315 ARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPD 374

Query: 437 ---TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477
              TC L ++P++    ++LG   L   Y+  D E+  + MA A
Sbjct: 375 TNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALA 418

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 97/243 (39%), Gaps = 35/243 (14%)

Query: 282 VLKNSGAIKSNTYSLYLN---------------DSDAMHGTILFGAVDHSKYTGTLYTIP 326
           +L  SG I S +YSL+L                D    +G +L G+VD S +    Y   
Sbjct: 215 MLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFD 274

Query: 327 IVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTK---IPALLDSGTTLTYLPQTV 383
           ++  +  +       F V               T  T++    P LL+S     YLP   
Sbjct: 275 VLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLPLNS 334

Query: 384 VSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILST-------- 434
           +  IA ++GA Y   +  ++L C  +++++   F F   +I APL  F+ ST        
Sbjct: 335 IIQIAIQVGATYVESLDRWLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDSTTNTS 394

Query: 435 ------GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA--RYNTTSENI 486
                    C L + P +      LG  FL + Y+  + E   + MAQA    N+T  N 
Sbjct: 395 MHFSDNSEACFLKLYPNTYVGFNALGRPFLKSVYLAVEQEGRIVGMAQAVQEMNSTFLNA 454

Query: 487 EII 489
           +++
Sbjct: 455 DVV 457

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 43  FHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDT 102
           F KL   S E+  S  KP   L        +I   N   +Y V++ +G+PPQ   + +DT
Sbjct: 20  FSKLKSASAESTSSIWKPFPTL--------DIGTINDGVYY-VNVTIGSPPQQEMLRIDT 70

Query: 103 GSSDLWIM-GSDNPYCS 118
               +W++ G+D+  C+
Sbjct: 71  SQPFVWVLSGADDKQCN 87

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 55.8 bits (133), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPP 93
           S+  +V+ P  KL   ++  +GS     V   KR D     +I N    Y V +E+GTPP
Sbjct: 23  SSDSYVRFPVQKL--ANVPGMGSQDVSNV--FKRDDVLNSTLI-NAVGMYVVKVEIGTPP 77

Query: 94  QNVTVLVDTGSSDLWIMGSDNPYCSSNSMGS 124
           Q   + +DTGSSD+++  +D+PYC   S GS
Sbjct: 78  QTAYLQLDTGSSDMYVNDADSPYCVLMSYGS 108

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 117/323 (36%), Gaps = 56/323 (17%)

Query: 177 VPASEA-TMDCQQYXXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTG 235
           VP  E   M C+ +                   ++YG G+   G    D   +SDL + G
Sbjct: 119 VPGKECRAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISDLEIPG 177

Query: 236 LSF-AVANETNSTM------GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGA 288
             F    +E  S        G+LG+  P L     G T                L     
Sbjct: 178 QQFTETTDEPGSVFVFAAFDGILGLAYPSLGY---GVTPPFQ-----------QLMEKKL 223

Query: 289 IKSNTYSLYLND--SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTX 346
           +K   + +YL+D  +   +G ++ G  D +K+ G +  +P+            + FD   
Sbjct: 224 VKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPVRRQAYWE-----VVFDSV- 277

Query: 347 XXXXXXXXXXXXKTLTTTKIP-----ALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGY 401
                        T+    IP     A +DSGT+L   P  + +   ++L      R G 
Sbjct: 278 -------------TVGDDNIPLENYGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGN 324

Query: 402 YVLDCPSDDSM-EIVFDFGGFHINAPLSSFILST---GTTCLLGIIPTSDDTG---TILG 454
             +DC +  +   + F FGG   +     +I+S       C+  I+    D+     I+G
Sbjct: 325 VYVDCANKQTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIG 384

Query: 455 DSFLTNAYVVYDLENLEISMAQA 477
           D FL   Y +YD  N  + +A A
Sbjct: 385 DVFLRRYYSIYDFGNNAVGLATA 407

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 66  KRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSS 125
           K  DG+   +     + Y+ D+ +GTPPQ+  V+VDTGSS LW+ G +   C + +    
Sbjct: 76  KNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKE---CRAMACRLH 132

Query: 126 RRRVIDKRDDSSSGGSL 142
           +R   D+       G+L
Sbjct: 133 KRYDHDRSSTYKENGTL 149

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 34  SNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPP 93
           S S +VK P  K + D + N+G+     V   KR +     +I N    Y V +E+GTPP
Sbjct: 23  SASSYVKFPVQK-FADII-NIGTQDVSTV--FKRNEVLNTTVI-NGIGVYVVKMEIGTPP 77

Query: 94  QNVTVLVDTGSSDLWIMGSDNPYCSSNSMGS 124
           Q V + +DTGSSD+ +  +D  YC S S GS
Sbjct: 78  QTVYLQLDTGSSDMIVNNADIAYCKSMSDGS 108

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 79/181 (43%), Gaps = 28/181 (15%)

Query: 306 GTILFGAVDHSKYTGTLYTIPIVNT----LSASGFSSPIQFDVTXXXXXXXXXXXXXKTL 361
           G   FG +D SK+ G +  +P+       +   G     +F +                 
Sbjct: 246 GVATFGGIDKSKFKGEISWLPVRRKAYWEVKFEGIGLGDEFAILDGHG------------ 293

Query: 362 TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGG 420
                 A +D+GT+L  LP  +  +I +E+GA+     G Y +DC +  S+ ++ F+F G
Sbjct: 294 ------AAIDTGTSLITLPSGLAEIINSEIGAK-KGWSGQYTVDCETRSSLPDLTFNFSG 346

Query: 421 FHINAPLSSFILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQ 476
            +       + L    +C+  I P    +  G   I+GD+FL   Y VYDL N  + +A+
Sbjct: 347 KNYTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAK 406

Query: 477 A 477
           A
Sbjct: 407 A 407

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 60  PEVRLLKR----ADGYEEIIITNQ-QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSD 113
           PE+   ++    A+   ++ +TN   + Y  D+ +GTP QN  V++DTGSS+LW+   D
Sbjct: 63  PEISFSRKHPFFAEDNHDVPLTNYLNAQYYTDISLGTPAQNFKVILDTGSSNLWVPSVD 121

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 133/321 (41%), Gaps = 49/321 (15%)

Query: 208 SISYGDGTFASGTFGTDVLDLSDLNVTGLSF-AVANETNSTMGVLGIGLPELEVTYSGST 266
           S SYG+ +      G   +D   LN++ +SF +  N    ++G LG+G           +
Sbjct: 145 SYSYGNHS------GLVEVDHGHLNISSMSFFSTYNSGGLSIGSLGLGGNVESRNSDLDS 198

Query: 267 ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLN--------------DSDAMHGTILFGA 312
             + G  +  +     LK +G I+   YSL+L                S+++ G ++ GA
Sbjct: 199 GQYDGSFFLLEE----LKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGA 254

Query: 313 VDHSKYTGTLYT---IPIVN--TLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTTKIP 367
           V+ +   G   +   +P  N  TL  S    PI   +               T      P
Sbjct: 255 VNPNLIDGKFVSFNMLPYQNPDTLEMSN-GYPI-LPMGPINIISKSGASLNMTSNNYLQP 312

Query: 368 ALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAP 426
            LLDS  T + LP   +  IA ++ A Y  ++  +V+ C    +S+ + F FG   I  P
Sbjct: 313 VLLDSRYTNSRLPIEAIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPLRIKVP 372

Query: 427 LSSFI-------------LSTG-TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEI 472
           L  F+             LS G   C+L + P  D    ILG  F+ + Y+  D E   I
Sbjct: 373 LKQFLKKAIDPDTGNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGTI 432

Query: 473 SMAQA--RYNTTSENIEIITS 491
           ++ Q+  R+ + ++NIE  TS
Sbjct: 433 ALGQSLRRFISEADNIEENTS 453

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 103/237 (43%), Gaps = 39/237 (16%)

Query: 249 GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPI-VLKNSGAIKSNTYSLYLNDSDAMH-- 305
           G++GIG P +            G   K    PI  L +SG +K   + +Y++++   +  
Sbjct: 187 GIIGIGYPSI------------GYGIKP---PINTLIDSGGLKDPMFGIYISNAQNRNSP 231

Query: 306 -GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTXXXXXXXXXXXXXKTLTTT 364
            G I+ G  +  K+ G +  +P++    A   +    F V                L   
Sbjct: 232 VGEIVLGGYNTQKFKGDIKWLPVLR--KAFWETDLSAFKVGNF------------ALDVQ 277

Query: 365 KIPALLDSGTTLTYLPQ-TVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFH 422
            + A+ D+G++   +P+ T    ++   GA +     Y  +DC + +S  ++  DFGG  
Sbjct: 278 GLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY--VDCSTVNSGPDLTLDFGGVA 335

Query: 423 INAPLSSFILSTG-TTCLLGIIPTSDDTG-TILGDSFLTNAYVVYDLENLEISMAQA 477
           +      +++  G  TC+L +   S  TG  ILGD+FL   Y +Y+  +  I +A A
Sbjct: 336 LKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVASA 392

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (2%)

Query: 76  ITNQQSF-YSVDLEVGTPPQNVTVLVDTGSSDLWI 109
           + N ++F YSVD+ +GTP QN  V +DTGSS LWI
Sbjct: 75  VYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWI 109

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 368 ALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSM-EIVFDFGGFHINAP 426
           A +D+GT+L  LP  +  +I  ++GA+     G Y L+C +   + ++ F   G      
Sbjct: 298 AAIDTGTSLITLPSDMAEIINAQIGAK-KGWTGQYTLECSTRAKLPDLTFTLDGHDFVLS 356

Query: 427 LSSFILSTGTTCLLGIIPTS--DDTG--TILGDSFLTNAYVVYDLENLEISMAQARYNT 481
              + L    +C+  I P    +  G   ILGD+FL   Y V+DL+   +S+A+A ++ 
Sbjct: 357 PFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVVSLAEAVHSA 415

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSL 142
           Y  D+ +GTPPQ   V++DTGSS+LW+   D   C S +        +  + D S   + 
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPSVD---CGSLAC------FLHNKYDHSQSSTY 141

Query: 143 INDINPFGWLTGTGS 157
           I D  P     G+GS
Sbjct: 142 IKDGRPLSISYGSGS 156

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 281 IVLKNSGAI-KSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPI 327
           +  +  G I K  +YSL+LN  +   G+ILFGAVD SKY   L T P+
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPM 48

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 368 ALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPL 427
           +++DSGTTL  LP+     I T  G   +    + ++ C S  ++ + FD   + I  P 
Sbjct: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLTLEFDNKNWTI--PS 373

Query: 428 SSFILSTGTT-------CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN 480
             ++    +        C+  I     D   ILGD FL   Y V+D+EN  +  A+   N
Sbjct: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 10/121 (8%)

Query: 362 TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGF 421
           + +K   ++DSG+T   LP+     I + L    +    Y+ + C S  ++++ F+ G  
Sbjct: 303 SRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCNS--TVDLTFELGNK 359

Query: 422 HINAPLSSFI---LSTGTT----CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISM 474
           +   P SS++      G+     C+  I   +  +  ILGD F+ N Y V+D++N ++  
Sbjct: 360 NWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGF 419

Query: 475 A 475
           A
Sbjct: 420 A 420

>YBR220C Chr2 complement(662995..664677) [1683 bp, 560 aa] {ON}
           Putative protein of unknown function; YBR220C is not an
           essential gene
          Length = 560

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 1   MKLKTVRSAV---LSSLFASQVLG-----KIIPAANKRDDDSNSKFVKLPFHKLYGDSLE 52
           +KLK+VRS     + S FA Q        K++    KR+D + +  + LPF  ++G  + 
Sbjct: 291 LKLKSVRSLAFIHMISKFAFQCNEAATNLKLLEQGFKREDLAVTVLIDLPFEIIFGYYVV 350

Query: 53  NVGSDKKPEV---RLLKRADGYEEII 75
              SDK P +   R L+ + G  ++I
Sbjct: 351 KWSSDKDPMIRDNRRLRNSTGTNKVI 376

>KAFR0E04050 Chr5 complement(800197..801783) [1587 bp, 528 aa] {ON}
           Anc_5.407 YDR351W
          Length = 528

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 113 DNPYCSSNSMGSSRRRVIDKRDDSSSGGSL 142
           DN YC+ N  G S + VID R++++  G+L
Sbjct: 71  DNKYCTQNRTGDSNKTVIDNRNNATDKGAL 100

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,381,334
Number of extensions: 2395289
Number of successful extensions: 5932
Number of sequences better than 10.0: 162
Number of HSP's gapped: 5621
Number of HSP's successfully gapped: 265
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)