Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR092W (SUL2)8.271ON89389347270.0
Smik_12.1518.271ON89389344300.0
Skud_12.1608.271ON89389343670.0
Suva_10.1768.271ON89389442020.0
NDAI0B020208.271ON90589930830.0
NCAS0B050508.271ON92382030540.0
KNAG0G020708.271ON89990629710.0
TDEL0F039808.271ON86787929130.0
Skud_2.424na 1ON86390429070.0
YBR294W (SUL1)na 1ON85987329010.0
Kpol_543.438.271ON86688028800.0
Smik_2.435na 1ON86382328630.0
Suva_4.554na 1ON85086928610.0
KAFR0B027508.271ON83489428420.0
CAGL0L12342g8.271ON89189928260.0
TPHA0J008008.271ON91789828090.0
SAKL0H16830g8.271ON86289127050.0
ZYRO0C01452g8.271ON90690426660.0
KLTH0G13486g8.271ON90288426030.0
KLLA0F19338g8.271ON89181726010.0
TPHA0A017608.271ON89384325880.0
Kwal_56.237598.271ON86182125250.0
AGR077C8.271ON84880623940.0
Ecym_42998.271ON87486922850.0
TBLA0F030508.271ON89750713351e-170
KNAG0D023908.99ON7166893343e-31
NDAI0B022108.99ON7064813343e-31
TBLA0C052708.99ON7765843076e-28
NCAS0B048008.99ON7244862897e-26
ZYRO0F04796g8.99ON7354812897e-26
YPR003C8.99ON7544782872e-25
Suva_16.3228.99ON7424772827e-25
TPHA0H007208.99ON7875272818e-25
TDEL0C012808.99ON7274742791e-24
CAGL0L09207g8.99ON7255052754e-24
Ecym_7084na 2ON6895572737e-24
Kpol_467.118.99ON7445732711e-23
KLTH0G16764g8.99ON7104822665e-23
Skud_16.2868.99ON7454772575e-22
SAKL0B03124g8.99ON7444682577e-22
KLLA0E14059g8.99ON7065212504e-21
SAKL0H08800gna 2ON6204461977e-15
Kwal_27.110398.99ON7261751746e-12
Smik_16.2418.99ON7441851728e-12
AGR213Cna 2ON6891551602e-10
KLLA0E04731g3.485ON1060385960.010
KAFR0C019103.485ON1020203900.049
KLTH0G15752g3.119ON964169890.060
YGR125W3.485ON1036217840.25
TBLA0C044403.485ON1150214791.0
KAFR0L01945singletonON14967741.3
KLTH0F14674g3.485ON1010219752.8
Smik_9.232na 3ON63659717.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR092W
         (893 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1825   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1711   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1686   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1623   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1192   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1181   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1149   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1126   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1124   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1122   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1113   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1107   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1106   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1099   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1093   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1086   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1046   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1031   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...  1007   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1006   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...  1001   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   977   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   926   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   884   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   518   e-170
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   133   3e-31
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   133   3e-31
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   122   6e-28
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   115   7e-26
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   115   7e-26
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   115   2e-25
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   113   7e-25
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   112   8e-25
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...   112   1e-24
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   110   4e-24
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   109   7e-24
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   108   1e-23
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   107   5e-23
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   103   5e-22
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   103   7e-22
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   100   4e-21
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    80   7e-15
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    72   6e-12
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    71   8e-12
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    66   2e-10
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    42   0.010
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    39   0.049
KLTH0G15752g Chr7 (1373153..1376047) [2895 bp, 964 aa] {ON} simi...    39   0.060
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    37   0.25 
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...    35   1.0  
KAFR0L01945 Chr12 complement(367964..368413) [450 bp, 149 aa] {ON}     33   1.3  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...    33   2.8  
Smik_9.232 Chr9 (381886..383796) [1911 bp, 636 aa] {ON} YIR028W ...    32   7.7  

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1825 bits (4727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/893 (99%), Positives = 885/893 (99%)

Query: 1   MSREGYPNFEEVEIPDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKHN 60
           MSREGYPNFEEVEIPDFQETNNTVP        YDQYKNNENNDTFNDKDLESNSVAKHN
Sbjct: 1   MSREGYPNFEEVEIPDFQETNNTVPDLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHN 60

Query: 61  AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120
           AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK
Sbjct: 61  AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120

Query: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY
Sbjct: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360

Query: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420
           IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL
Sbjct: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600
           FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600

Query: 601 SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT 660
           SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT
Sbjct: 601 SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT 660

Query: 661 KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL 720
           KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL
Sbjct: 661 KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840
           CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840

Query: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1711 bits (4430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 819/893 (91%), Positives = 853/893 (95%)

Query: 1   MSREGYPNFEEVEIPDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKHN 60
           MSRE YPN EEVEIPDFQ+T+NTVP        YDQYKNNENND F D DLESNSVAK N
Sbjct: 1   MSRETYPNLEEVEIPDFQDTSNTVPDLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPN 60

Query: 61  AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120
           AV + KG KGSKI+YFNPSDVSLYDNSVSQFEE+TVSLKEYYDHSIRSHLT+KGA  YLK
Sbjct: 61  AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK 120

Query: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           SVFPIINWLPHYNF+WFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY
Sbjct: 121 SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGD AITGPVIATTLALLCGIISAA+G
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGP LNDRYNSKNPRLHKI+KWTYFYAQASRNG+I
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI 360

Query: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420
           I+VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP GLMSKLGPNLPASIIVLL
Sbjct: 361 IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL 420

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600
           FIVTVLITVFASIEDGIYFAMCWSCAML+LK+AFPAGKFLGRVE+AEVTDAY++ +SD V
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV 600

Query: 601 SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT 660
           SY SENNNGI T E+G E +K+SSTKY+TNSSKKIETNVQTK FDSPSS I+QPR+KYHT
Sbjct: 601 SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT 660

Query: 661 KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL 720
           KW+PFDHKYTRELNPD+QILPPP+GVLVYRLSESYTYLNCSRHYNIITE+VK+VTRRGQL
Sbjct: 661 KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRE+D E +ENAP  S+  ERDDRPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840
           CLDFSQVAQTDATALQSLVDLRK INQYADRQVEFHFVGIISPWVKRGL+SRGFGTLNEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE 840

Query: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVPQ +EN +KYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1686 bits (4367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/893 (90%), Positives = 846/893 (94%)

Query: 1   MSREGYPNFEEVEIPDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKHN 60
           MS+E  PN EEVEIPDFQ+  ++VP        YDQYKNNENN  F+D DLESNSVA  N
Sbjct: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60

Query: 61  AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120
           AVN +KGVKGSKI+YF+PSDVSLYDNSVSQFEE+ VSLKEYY+HSIRSHLT+KGA  YLK
Sbjct: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120

Query: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           SVFPIINWLPHYNF+WF ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAY+Y
Sbjct: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSLQTAKVIA+V AKYPDGD+ ITGPVIATTLALLCGIISAAVG
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN LVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKN RLHKI+KWTYFYAQASRNGII
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360

Query: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420
           IIVFTCIGWAITRGKS SERPISILGSVPSGLKEVGVFHVP GLMSKLGP+LP+SIIVLL
Sbjct: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLL 420

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600
           FIVTVLITVFASIEDGIYFAMCWSCAML+LKVAFPAGKFLGRVE+AEVTDAYV+ DSD V
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600

Query: 601 SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT 660
           SYVSENNN ISTLE+ GED+KE S KY+TNSSKKIETNVQTKGF SPSSSI QPRIKYHT
Sbjct: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660

Query: 661 KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL 720
           KW+PFDHKYTRELNPDV ILPPP+ VLVYRLSESYTYLNCSRHYNII +EVK+ TRRGQ+
Sbjct: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKK+E+D E  +NAP+ S+D ERD+RPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840
           CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGT+NEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840

Query: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVP+ +ENP+KYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1623 bits (4202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/894 (86%), Positives = 824/894 (92%), Gaps = 2/894 (0%)

Query: 1   MSREGYPNFEEV-EIPDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKH 59
           MSRE + N EEV EIPDFQ++  TVP        YDQYKNNENN  FND DLESNS+  H
Sbjct: 1   MSRETHSNIEEVVEIPDFQDST-TVPDLDDLELEYDQYKNNENNGAFNDNDLESNSLTNH 59

Query: 60  NAVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYL 119
           N  + +KGVKGSK++YFN SD+SLYDNSVSQF+E TVS KEYYDHSIRSHLT+K A +YL
Sbjct: 60  NTASEAKGVKGSKVEYFNTSDISLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYL 119

Query: 120 KSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYS 179
           KSVFPII WLPHYN +WF ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAY+
Sbjct: 120 KSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYA 179

Query: 180 YSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAV 239
           YSFFATSKDVCIGPVAVMSLQTAKVIADVTA+YPDGD+ ITGP+IATTLALLCGIISAAV
Sbjct: 180 YSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAV 239

Query: 240 GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHL 299
           GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN LVNTR ATYK+VI++LKHL
Sbjct: 240 GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHL 299

Query: 300 PDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGI 359
           PDT LDA FGLIPLF+LY WKWWCGTYGPRLNDR+NSK PRLHKI+KWT FYAQASRNGI
Sbjct: 300 PDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGI 359

Query: 360 IIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVL 419
           IIIVFTCI WAITRGKS ++RPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVL
Sbjct: 360 IIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVL 419

Query: 420 LLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT 479
           LLEHIAISKSFGR+NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT
Sbjct: 420 LLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT 479

Query: 480 PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI 539
           PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI
Sbjct: 480 PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI 539

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDV 599
           CFIVTVLITVF+SIE+GIYFAMCWSCA+ ILKVAFPAGKFLGRVE+AEVTDAYVR DSD 
Sbjct: 540 CFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDS 599

Query: 600 VSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYH 659
           VS+ SENNN ISTLE+ G  +KE  T Y+ NS KK+ET VQTKGF+SPS+SI QPRIKYH
Sbjct: 600 VSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYH 659

Query: 660 TKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQ 719
           TKW+PFDHKYT+ELNPDV ILPPP+GVLVYRLSESYTY+NCSRHYN+IT+E+KKVTRRGQ
Sbjct: 660 TKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQ 719

Query: 720 LIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKI 779
           LIRHRKKSDRPWNDPGPWE P F KNLKFWKK+E D ES ENA +   D  RDDRPLLKI
Sbjct: 720 LIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKI 779

Query: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839
           LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE
Sbjct: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839

Query: 840 EYSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           EYSDESIVAGHTSYHVARVPQ EE P+KYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 840 EYSDESIVAGHTSYHVARVPQNEETPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1192 bits (3083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/899 (65%), Positives = 703/899 (78%), Gaps = 29/899 (3%)

Query: 11  EVEIPDFQETNNTVPXXXXXXXXYDQYKNNE-NNDTFNDKDLESNSV-----AKHNAVNS 64
           + E+P F  ++ +          YDQYK +E NN + +  DLE+N++       +N  + 
Sbjct: 20  QYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDK 79

Query: 65  SKGVKGSKI--DYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSV 122
              +K  +I  + FN   V      +  FEE  +S K+YY HS++ + ++K    Y  S+
Sbjct: 80  KNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSF 182
           FPII WLPHYN +WF++DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA++YS 
Sbjct: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194

Query: 183 FATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFL 242
           FATSKDVCIGPVAVMSL+T KVI  V AKYP+ D  IT PVIAT LA LCG+I+A +GFL
Sbjct: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254

Query: 243 RLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDT 302
           RLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY S VNTR +TYKV+IE+LKHLPDT
Sbjct: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314

Query: 303 KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIII 362
           KLDAVFGLIPLF+LY+WKWWCG  GPR+ D++ + N + +  +K  YFYAQA++N +III
Sbjct: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374

Query: 363 VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLE 422
           VFT I W+IT+GK+K ERPISILGSVP GLKEVGV  +P GL SK+ P LPAS+IVLLLE
Sbjct: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434

Query: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482
           HIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLS
Sbjct: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494

Query: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542
           GLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD   FI
Sbjct: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFI 554

Query: 543 VTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSY 602
           VTV ITVF+SIE+GIYFAMCWSCA+L+LKVAFPAGKFLGRVE+AEV +  V    +V  Y
Sbjct: 555 VTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614

Query: 603 VSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKW 662
            S +N  +S   D    +K+    ++      +   ++ + F   SS   + +I+Y+TKW
Sbjct: 615 SSNSN--LSLSADTINHNKKLKILHI-----PLLKTLKDQLFSDISSIQGKSKIRYYTKW 667

Query: 663 IPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIR 722
           +PFDH YT+ELNP+V ILPPP GV+VYRL++S+TY+NCS+HY++I EE+KK T+RGQLIR
Sbjct: 668 LPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIR 727

Query: 723 HRKKSDRPWNDPGPWEAPAF---LKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKI 779
           HRKKSDRPWNDPG WEAP F    K L F + + N+     + P   V  +RDDRPLLK+
Sbjct: 728 HRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVS-KRDDRPLLKV 786

Query: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839
           LCLDFSQVAQ DATALQSLVDLRKAIN+YADRQVEFHF GI+SPW+K+GLI+ GFGT+NE
Sbjct: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846

Query: 840 EYSDESIVAGHTSYHVARVPQGE-ENPE----KYSVYTASGTNLPFFHIDIPDFAKWDI 893
           EYSDESI+AGHTSYH+AR+P  + E P      Y VYTA+GTNLPFFHIDIPDF +WD+
Sbjct: 847 EYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/820 (69%), Positives = 673/820 (82%), Gaps = 22/820 (2%)

Query: 88  VSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITI 147
           +  ++E TVS+K+YYDHSIR ++T+ G   Y  S+FPI  WLPHYN +WFT+DLIAGIT+
Sbjct: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171

Query: 148 GCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIAD 207
           GCVLVPQSMSYAQ+ATLPAQYGLYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+  
Sbjct: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231

Query: 208 VTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNI 267
           V AKYPD D  IT P++AT L+LLCGI++A VG LRLGFLVELISLNAV GFMTGSA NI
Sbjct: 232 VLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNI 291

Query: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYG 327
           LWGQVP LMGYNS VNTR A YKV+IETLKHLPDTKLDAVFGLIPLFLLY+WKWWC   G
Sbjct: 292 LWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMG 351

Query: 328 PRLNDRY--NSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISIL 385
           P+L D++   +KN R +   K  YFYAQA++N IIIIVFT I W+ITRGK+K++RPISIL
Sbjct: 352 PKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISIL 411

Query: 386 GSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 445
           G+VP GLKEVGV  +P GL+SKL P LPAS+IVLLLEHIAI+KSFGRINDYKVVPDQELI
Sbjct: 412 GTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELI 471

Query: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505
           AIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIP
Sbjct: 472 AIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIP 531

Query: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSC 565
           KATLSAVII AVSDL+ASY+ TWNFWKMNPLD +CF+VTV ITVF+SIE+GIYFA+CWSC
Sbjct: 532 KATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSC 591

Query: 566 AMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESST 625
           A+L+LKV FPAGKFLGR+EVAEV D YV  D+ + S  +   +  S+       D E+ T
Sbjct: 592 AILLLKVCFPAGKFLGRIEVAEVIDGYV--DNSIESATTAEYSSASSP----SSDNETDT 645

Query: 626 KYVTNSSKKIETNVQTKGFDSPSSSIS-QPRIKYHTKWIPFDHKYTRELNPDVQILPPPD 684
           K +  +S  I      K     +S +   P+++Y+TKW+PFDH YTRELNP V ILPPP 
Sbjct: 646 KKIQKTS-SISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPP 704

Query: 685 GVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLK 744
           GV+VYRL++S+TY+NCSRHY++I +EVK+ TRRGQL+RHRKK+DRPWNDPG WEAP FLK
Sbjct: 705 GVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLK 764

Query: 745 NLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKA 804
           NL F +K++N  +       +     RD+RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK+
Sbjct: 765 NL-FHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKS 823

Query: 805 INQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR-VPQGEE 863
           IN+YADRQVEFHF GI+SPWVKRGLI+RGFGT+N+E+SD SI+AGH+SYH+ R +P  + 
Sbjct: 824 INRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDF 883

Query: 864 NPE----------KYSVYTASGTNLPFFHIDIPDFAKWDI 893
           + E          +Y V+ A+GTNLPFFHIDIPDF+KWD+
Sbjct: 884 DLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/906 (63%), Positives = 696/906 (76%), Gaps = 33/906 (3%)

Query: 2   SREGYPNFEEVEIPDFQETNNTVPXXXXXXXXYDQYKNNE--------NNDTFNDKDLES 53
           S   +PN    E  +  E ++T P        YDQYK +E        +N    D++  +
Sbjct: 13  SDNSFPNEYGAEYNNANEVSST-PDLDNLELEYDQYKADELHPQRTILSNQADTDREKIA 71

Query: 54  NSVAKHNAVNSSKGVKGS--KIDYF-NPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHL 110
           N   +  +V  S     S  ++ YF + SD +     +  + E  V+  E+++HS+RS  
Sbjct: 72  NVFVEEQSVRDSNIPSASIEELQYFAHESDGA---KVIPSYVEGNVTELEFFNHSLRSKF 128

Query: 111 TVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGL 170
           T+  A +Y+ S+FPII+WLPHYN  WF  DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGL
Sbjct: 129 TLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGL 188

Query: 171 YSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLAL 230
           YSSFIGA+ YS FATSKDVCIGPVAVMSL+TAK+IA V  ++P+ D  + GP+IATT AL
Sbjct: 189 YSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTAL 247

Query: 231 LCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYK 290
           LCG I+A VGFLRLGFLVELISLNAVAGFMTGSA NI+ GQVPALMGY  LVNTR ATYK
Sbjct: 248 LCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYK 307

Query: 291 VVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYF 350
           V++ TLKHLPDTKLDAVFGLIPLF+LY W+WWC  YGP+L DRY  K  R + + K  YF
Sbjct: 308 VIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYF 367

Query: 351 YAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGP 410
           YAQASR+GIIIIVFT I W+ITR     ER ISILG+VP GLK+VG   VPP L +K+ P
Sbjct: 368 YAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAP 427

Query: 411 NLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
            LPA++IVLLLEHIAISKSFGRINDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSA
Sbjct: 428 ELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF 530
           LKAKCNV+TPLSGLF+GSCVLLALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF
Sbjct: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNF 547

Query: 531 WKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTD 590
           +KMNPLDF+CF+ T++ITVF+SIE+GIYFA+CWSCA+L+ KVAFPAGKFLGRVE+AEV D
Sbjct: 548 YKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVD 607

Query: 591 AYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDS--PS 648
             +  D+ VV    +        E GG  +KE S   +   S  I   V+ K  DS   S
Sbjct: 608 GEIINDNSVVMTTDD-----CVSEFGG--NKEFSKDKLNGKSDFI---VKDK-LDSTASS 656

Query: 649 SSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIIT 708
           SSI++ ++KY+TKW+PFDH YTRELNPDV I PPP GV+VYR+S+SYTY+N S HY+II 
Sbjct: 657 SSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIII 716

Query: 709 EEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVD 768
           +E+K+VTRRGQL++HRKKSDRPWNDPG W+ P FL N+  W+K +   ++ +   S    
Sbjct: 717 DEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTAD-VESLETG 775

Query: 769 VERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRG 828
           + RD+RP+LK+LCLDFSQVAQ D+T+LQSLVDLRKA+N YADRQVEFHF GIISPW+KRG
Sbjct: 776 IVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRG 835

Query: 829 LISRGFGTLNEEYSDESIVAGHTSYHVARVPQGE-ENPEKYSVYTASGTNLPFFHIDIPD 887
           L+  GFGT+NEE+SDESI+AGH+SYH+ +   G+ EN   Y V TA+GTNLPFFHIDIPD
Sbjct: 836 LVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIEN--GYQVKTATGTNLPFFHIDIPD 893

Query: 888 FAKWDI 893
           F KWDI
Sbjct: 894 FKKWDI 899

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1126 bits (2913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/879 (63%), Positives = 671/879 (76%), Gaps = 54/879 (6%)

Query: 34  YDQYKNNENNDTFNDKDLESNSV---AKHNAVNSSKG---VKGSKIDYFNPSDVSLYDNS 87
           YD YK NE         LE N V      +   + KG   VK +++ Y+          +
Sbjct: 24  YDLYKANEQ--------LEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGN 75

Query: 88  VSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITI 147
           +  FEE+TVS+K+YY+  IR  LT+  A SY+ S+FPI+ W PHYN +W  ADL+AGIT+
Sbjct: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135

Query: 148 GCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIAD 207
           GCVLVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQTAKVIA 
Sbjct: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195

Query: 208 VTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNI 267
           V+AKYP+ D  +T PVIAT L+LLCGI++  VG LRLGFLVELISLNAVAGFMTGSAFNI
Sbjct: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255

Query: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYG 327
           LWGQVPALMGY+S VNTRA+TYKVVI++LKHLPDTKLDAVFGL+PL LLY+WKWWCGTYG
Sbjct: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315

Query: 328 PRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGS 387
           P+L DR  + +P+  +I+K  YFY+ A RN +IIIVFT I W IT+ K K  RPI +LG+
Sbjct: 316 PKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGT 375

Query: 388 VPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           VPSGL++VGV  +P GL++K+ P++PASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI
Sbjct: 376 VPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 435

Query: 448 GVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKA 507
           G +NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT AFF+IP A
Sbjct: 436 GATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSA 495

Query: 508 TLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAM 567
           TLSAVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVF+SIE+GIYFAMCWSCAM
Sbjct: 496 TLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAM 555

Query: 568 LILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKY 627
           L+LK AFPAG+FLGRVEVAEV +  V  D + +S                 D  E S   
Sbjct: 556 LLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISI---------------NDQIEGS--- 597

Query: 628 VTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVL 687
               SK ++ +   KG  S SS       K+H+KW+   + Y RELNPDV+ILPPP GV+
Sbjct: 598 -VGKSKSLKAD---KGAISASSG---SNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVV 650

Query: 688 VYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWE-APAFLKNL 746
           VYR+S+S+TY+NCSRHY+ I + +KK TRRGQL+  RKKSDRPWNDPG WE +P+  K  
Sbjct: 651 VYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFF 710

Query: 747 KFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAIN 806
           K  KK +ND ES +     ++D  RD+RPLLKI+CLDFSQV Q D+TA+QSLVDLRKA++
Sbjct: 711 KLGKKNQNDIESQDE--DVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVH 768

Query: 807 QYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARV--PQGEE- 863
           +YADRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+   P  ++ 
Sbjct: 769 KYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDF 828

Query: 864 ---------NPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
                      +   +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 829 TTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/904 (62%), Positives = 677/904 (74%), Gaps = 63/904 (6%)

Query: 2   SREGYPNFEEVEIPDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKHNA 61
           S E   N E+ +I  F+    T          Y + +  EN D F + D +S  +     
Sbjct: 11  STEVLDNQEDTDIEVFESEYRT----------YRESEAAENRDNFQNGDDQSWKI----- 55

Query: 62  VNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKS 121
                G +  ++     SDV+ YD S+  +EE+TV+LKEYYDHSI+S LTVK A  YL S
Sbjct: 56  ----NGKQKYEVTKSEVSDVA-YD-SIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYS 109

Query: 122 VFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYS 181
           +FPII WLPHYNF+W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS
Sbjct: 110 LFPIIKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYS 169

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            FATSKDVCIGPVAVMSLQTAKVIA+V  KYP+G + +TGP+IAT L  LCG++S A+G 
Sbjct: 170 LFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGV 229

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           LRLGFLVELISLNAVAGFMTGSAF+I+WGQ+PALMGYNSLVNTR ATYKVVI TLKHLP+
Sbjct: 230 LRLGFLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPN 289

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIII 361
           TKLDAVFGLIPL +LYVWKWWCGT+G  L DRY    P++   +K  YFYAQA RN ++I
Sbjct: 290 TKLDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVI 349

Query: 362 IVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLL 421
           IVFT I W ITR KS  ERPISILG+VPSGL EVGV  +P GL+S +   LPASIIVL+L
Sbjct: 350 IVFTAISWRITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVL 409

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           EHIAISKSFGRINDYKV+PDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP 
Sbjct: 410 EHIAISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPF 469

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICF 541
           SG+F+G+CVLLALYCLT AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD I F
Sbjct: 470 SGIFTGACVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISF 529

Query: 542 IVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVS 601
           I TV ITVF+SIE+GIYFAMCWSCAML+LK AFPAGKFLGRVEVAEV +  V+   + V+
Sbjct: 530 IATVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVT 589

Query: 602 YVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTK 661
             +E  N +                     SK++++ V           +  P  K+  K
Sbjct: 590 SSNELPNEL---------------------SKQVKSTVDV---------LPAPEYKFSVK 619

Query: 662 WIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLI 721
           WIPFDH Y+RELN   ++ PPP GV+VYRL++S+TY+NCSRHY+II + +K+ TRRGQLI
Sbjct: 620 WIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLI 679

Query: 722 RHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILC 781
             RKKSDRPWNDPG W+ P   K L  +K++    ++     S   + E  ++PLLK++C
Sbjct: 680 SLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPVSSGRNNQESYEKPLLKVVC 739

Query: 782 LDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEY 841
           LDFSQVAQ D+TA+QSLVDLRKA+N+YADRQVEFHF GIISPW+KR L+S  FGT NEEY
Sbjct: 740 LDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEY 799

Query: 842 SDESIVAGHTSYHVARVPQG-----EENPE---KYSVY----TASGTNLPFFHIDIPDFA 889
           SD+SI+AGH+S+HVA+V +      EE+      YS Y     A+GTNLPFFHIDIPDF+
Sbjct: 800 SDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFS 859

Query: 890 KWDI 893
           KWD+
Sbjct: 860 KWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1122 bits (2901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/873 (63%), Positives = 672/873 (76%), Gaps = 52/873 (5%)

Query: 36  QYKNNENNDTFNDKDLESNSVAKHNAVNSSK---GVKGSKIDYFNPSDVSLYDNSVSQFE 92
           +Y+    ++   ++D   N   ++  VNSSK   GV  +++     SDV LYD S+  +E
Sbjct: 24  EYRTYRESEAAENRDGLHNGDEENWKVNSSKQKFGVTKNEL-----SDV-LYD-SIPAYE 76

Query: 93  ETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLV 152
           E+TV+LKEYYDHSI+++LT K A SYL S+FPII W PHYNF+W  ADL+AGIT+GCVLV
Sbjct: 77  ESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGITVGCVLV 136

Query: 153 PQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKY 212
           PQSMSYAQ+A+L  +YGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQTAKVIA+V  KY
Sbjct: 137 PQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKKY 196

Query: 213 PDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQV 272
           P+  + +T P+IATTL LLCGI++  +G LRLGFLVELISLNAVAGFMTGSAFNI+WGQ+
Sbjct: 197 PEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIWGQI 256

Query: 273 PALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLND 332
           PALMGYNSLVNTR ATYKVVI TLKHLP+TKLDAVFGLIPL +LYVWKWWCGT+G  L D
Sbjct: 257 PALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGITLAD 316

Query: 333 RYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGL 392
           RY    P++   +K  YFYAQA RN ++I+VFT I W+ITR KS  +RPISILG+VPSGL
Sbjct: 317 RYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISILGTVPSGL 376

Query: 393 KEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNL 452
            EVGV  +P GL+S +   +PASIIVL+LEHIAISKSFGRINDYKVVPDQELIAIGV+NL
Sbjct: 377 NEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIGVTNL 436

Query: 453 LGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAV 512
           +GTFF++YPATGSFSRSALKAKCNVRTP SG+F+G CVLLALYCLT AFF+IPKATLSAV
Sbjct: 437 IGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKATLSAV 496

Query: 513 IIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKV 572
           IIHAVSDLL SY+TTW FWK NPLD I FIVTV ITVF+SIE+GIYFAMCWSCAML+LK 
Sbjct: 497 IIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAMLLLKQ 556

Query: 573 AFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSS 632
           AFPAGKFLGRVEVAEV +  V+ D D V   +E  N +                     +
Sbjct: 557 AFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNEL---------------------N 595

Query: 633 KKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLS 692
           K++++ V+          +  P  K+  KW+PFDH Y+RELN +  + PPP GV+VYRL 
Sbjct: 596 KQVKSTVEV---------LPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIVYRLG 646

Query: 693 ESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKR 752
           +S+TY+NCSRHY+II + +K+ TRRGQLI  RKKSDRPWNDPG W+ P  LK+L  +K+ 
Sbjct: 647 DSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLFKFKRH 706

Query: 753 ENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQ 812
                S     + S + E  ++PLLK++CLDFSQVAQ D+TA+QSLVDLRKA+N+YADRQ
Sbjct: 707 SATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNRYADRQ 766

Query: 813 VEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQGEEN-------- 864
           VEFHF GIISPW+KR L+S  FGT NEEYSD+SI+AGH+S+HVA+V + + +        
Sbjct: 767 VEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTDEDSRI 826

Query: 865 PEKYSVY----TASGTNLPFFHIDIPDFAKWDI 893
              YS Y     A+GTNLPFFHIDIPDF+KWD+
Sbjct: 827 STSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/880 (63%), Positives = 674/880 (76%), Gaps = 48/880 (5%)

Query: 34  YDQYKNNE---NNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDV----SLYDN 86
           Y+QYK  E   N+D  +    +    A       SK V    + Y + S+     S  ++
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYTDDSNELTRESFLNS 74

Query: 87  S--VSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAG 144
           S  V ++ E TV+LKEYY+HSIR +LT K   +YL S+FPII WLP YN+ W  +DLIAG
Sbjct: 75  SENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAG 134

Query: 145 ITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKV 204
           ITIGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY+YS FATSKDVCIGPVAVMSLQTAKV
Sbjct: 135 ITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKV 194

Query: 205 IADVTAKYPDGDSA-ITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGS 263
           I  V +   +     IT P+IATTLALLCGIISA VG LRLGFLVELISLNAV GFMTGS
Sbjct: 195 IQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGS 254

Query: 264 AFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWC 323
           A NI+ GQVPALMGY S VNTR ATYKV+I TLKHLPDTK+DA+FGLIPL +LY WKWW 
Sbjct: 255 ALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWF 314

Query: 324 GTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPIS 383
            + GP+L DRY   N +  K IK  YFY  A R+GIIIIV T I W++TRGKSKSERPIS
Sbjct: 315 SSMGPKLVDRY-YPNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERPIS 373

Query: 384 ILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQE 443
           ILG+VPSGL+EVGVF  P GL++K+ P LP+SIIVLLLEHIAI+KSFGR+NDYKVVPDQE
Sbjct: 374 ILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQE 433

Query: 444 LIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFY 503
           LIAIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLTGAFFY
Sbjct: 434 LIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFY 493

Query: 504 IPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCW 563
           IPKATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVFASIEDGIYF MCW
Sbjct: 494 IPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCW 553

Query: 564 SCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKES 623
           S A+L+ KVAFPAGKFLG V++AE+ +  +  DSD   Y+ E                E+
Sbjct: 554 SAAILLFKVAFPAGKFLGYVKIAEIVNPEIV-DSD---YLVEK--------------AET 595

Query: 624 STKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPP 683
           S +Y T     +  N +       SS  S+ ++KYH KWIP+DH YT+E+NP+V++ PPP
Sbjct: 596 SVQYST-----VLMNPEKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPP 650

Query: 684 DGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFL 743
           DGV+VYRL+ES+TY+NCSR+Y  + ++VK++TR GQL+ H KKSDRPWNDPG W+ P FL
Sbjct: 651 DGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFL 710

Query: 744 KNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRK 803
           KN+  W+K +N     ++ P+T  +   D RP+LKI+CLDFSQVAQTD+TALQSL+DLR+
Sbjct: 711 KNIINWRKNKNK----DDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRR 766

Query: 804 AINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQGEE 863
           AIN+YADRQVEFHF GI+SPWVK+GL++ GFGT+N+EYSDESI+ GHTSYHV +    E 
Sbjct: 767 AINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLEN 826

Query: 864 NP----------EKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           NP            Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 827 NPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/823 (65%), Positives = 655/823 (79%), Gaps = 42/823 (5%)

Query: 83  LYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLI 142
           ++ +S+  +EE TV+LK+YYDH+I+ +LT+K A SYL S+FPII WLPHYNF+W  ADL+
Sbjct: 71  VFYDSIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLV 130

Query: 143 AGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTA 202
           AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQTA
Sbjct: 131 AGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTA 190

Query: 203 KVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTG 262
           KVIA+V  KYP+    +TGP+IATTL LLCG+++  +G LRLGFLVELISLNAVAGFMTG
Sbjct: 191 KVIAEVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTG 250

Query: 263 SAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWW 322
           SAF+I+WGQ+PALMGYN LVNTR ATYKVVI TLKHLP+TKLDAVFGLIPL +LY+WKWW
Sbjct: 251 SAFSIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWW 310

Query: 323 CGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPI 382
           CG++G +L DR+ S  P+    IK  YFYAQA RN ++IIVFT I + ITR KSK +RPI
Sbjct: 311 CGSFGIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPI 370

Query: 383 SILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQ 442
           SILG+VPSGL EVGV  +P GL+S +   LPASIIVL+LEHIAISKSFGRINDYKV+PDQ
Sbjct: 371 SILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQ 430

Query: 443 ELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFF 502
           ELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP SG+F+G+CVLLALYCLT AFF
Sbjct: 431 ELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFF 490

Query: 503 YIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMC 562
           YIPKATLSAVIIHAVSDLLASY+TTWNFWKMNPLD I FIVTVLITVF+SIE+GIYFAMC
Sbjct: 491 YIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMC 550

Query: 563 WSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKE 622
           WSCAML+LK AFPAGKFLGRVEVAEV +  ++   D  S VS N               E
Sbjct: 551 WSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHID--SIVSPN---------------E 593

Query: 623 SSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPP 682
           S  ++    SK+++++V       PSS       K+  KW+PFDH YTRELN   ++ PP
Sbjct: 594 SPNEF----SKQVKSSVDAL----PSS-----EYKFSVKWVPFDHAYTRELNSYTRVRPP 640

Query: 683 PDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAF 742
           P GV+VYR S+S+TY+NCSRHY++I + +K+ TRRGQL+  RKKSDRPWNDPG W+ P  
Sbjct: 641 PPGVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNS 700

Query: 743 LKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLR 802
            KN+   K+      S   A + + + E  ++PLLK++CLDFSQVAQ D+TA+QSLVDLR
Sbjct: 701 FKNIFRVKRGLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLR 760

Query: 803 KAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQ-- 860
           KA+N+YADRQVEFHF GIISPW+KR L+S  FGT+NEE+SD SI+ GH+S+H+A+V +  
Sbjct: 761 KAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDE 820

Query: 861 ----GEENPEKY------SVYTASGTNLPFFHIDIPDFAKWDI 893
                E++P         ++  A+GTNLPFFHIDIPDF+KWD+
Sbjct: 821 VDYTDEDSPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1106 bits (2861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/869 (62%), Positives = 665/869 (76%), Gaps = 62/869 (7%)

Query: 45  TFNDKDLESNSVAKHN----AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKE 100
           ++ + +  +N    HN     VN ++  + +K +    SDVS YD S+ ++EE+TV+LKE
Sbjct: 24  SYRESEAAANRDDSHNEQSWKVNGNRKFEHTKTE---SSDVS-YD-SIPRYEESTVTLKE 78

Query: 101 YYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQ 160
           YY HSI++ LT K A +Y+ S+FPI+ WLPHYNF+W  ADL+AGIT+GCVLVPQSMSYAQ
Sbjct: 79  YYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGITVGCVLVPQSMSYAQ 138

Query: 161 VATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAIT 220
           +A+L  +YGLYSSF+GA+ YS FATSKDVCIGPVAVMSLQTAKVIA+V  KYP   + +T
Sbjct: 139 IASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPQDQTEVT 198

Query: 221 GPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNS 280
           GP+IAT L LLCGI++ A+G LRLGFLVELISLNAVAGFMTGSAF+I+WGQVPALMGYN 
Sbjct: 199 GPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFSIIWGQVPALMGYNK 258

Query: 281 LVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPR 340
           LVNTR +TYKVVI TLKHLP+TKLDAVFGLIPL +LYVWKWWCGTYG  L +R+   +P+
Sbjct: 259 LVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTYGITLANRHYQNHPK 318

Query: 341 LHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHV 400
           +   +K  YFYAQA RN ++I+VFT I W+ITR K+  +RPISILG+VPSGL EVGV  +
Sbjct: 319 IANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISILGTVPSGLNEVGVMKI 378

Query: 401 PPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAY 460
           P GL+S +   LPASIIVL+LEHIAISKSFGRINDYKVVPDQELIAIGV+NL+GTFF++Y
Sbjct: 379 PEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIGVTNLVGTFFHSY 438

Query: 461 PATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDL 520
           PATGSFSRSALKAKCNVRTP SGLF+G CVLLALYCLT AFF+IPKATLSAVIIHAVSDL
Sbjct: 439 PATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDL 498

Query: 521 LASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFL 580
           L SY+TTW FWK NPLD + FIVTV ITVF+SIE+GIYFAMCWSCA+L+LK AFPAG+FL
Sbjct: 499 LTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSCAILLLKQAFPAGRFL 558

Query: 581 GRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQ 640
           GRVEVAE+ +  ++ +   V  ++E+N  + T  D            V  SS+       
Sbjct: 559 GRVEVAEILNPTLQNNVSAVVSLNESNKQVKTTVD------------VLRSSE------- 599

Query: 641 TKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNC 700
                           ++ TKW+PFDH+Y+RELN   +I PPP GV+VYRLS+S+TY+NC
Sbjct: 600 ---------------YRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNC 644

Query: 701 SRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKR---ENDPE 757
           SRHY+II + VK+ TRRGQL+  RKKSDRPWNDPG W+ P  LK L  +K++   EN+  
Sbjct: 645 SRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTENEEP 704

Query: 758 SMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHF 817
           S+ N  +     E   +PLLK++CLDFSQVAQ D+TA+QSLVDLRKA+N+YADRQVEFHF
Sbjct: 705 SVSNGSTNRGSYE---KPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHF 761

Query: 818 VGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQGEEN---------PEKY 868
            GIISPW+KR L S  FGT+NEEYSDES++AGH+S HV +    ++             Y
Sbjct: 762 AGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEESHISAPY 821

Query: 869 SVY----TASGTNLPFFHIDIPDFAKWDI 893
           S Y     A+GTNLPFFHIDIPDF+KWDI
Sbjct: 822 SNYGTLCAATGTNLPFFHIDIPDFSKWDI 850

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/894 (61%), Positives = 670/894 (74%), Gaps = 70/894 (7%)

Query: 8   NFEEVEIPDFQETNNTVPXXXXXXXXYDQYKNNE--NNDTFNDKDLESNSVAKHNAVNSS 65
           N  + E+ DF   ++           ++QYK  E   + T  +++++S    K     S 
Sbjct: 3   NQHDTELTDFSNLDD-------LEQEFNQYKKIELTISSTRQNEEVDSKRQGK-----SD 50

Query: 66  KGVKGSKIDYFNPSDVSL-YDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFP 124
           K VK S  D    S  SL     V  +EE ++++ +YY +S+R + T K    Y+KS+FP
Sbjct: 51  KNVKSSSFD----SIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFP 106

Query: 125 IINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFA 184
           I +WLPHYN +WF +DLIAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA+SYS FA
Sbjct: 107 IFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFA 166

Query: 185 TSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRL 244
           TSKDVCIGPVAVMSLQTAKVIA V  K P  D+ IT   IATTLALLCGII+  VG LRL
Sbjct: 167 TSKDVCIGPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRL 225

Query: 245 GFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKL 304
           GFLVELISLNAVAGFMTGSA NI+ GQVP LMGYNS VNTR +TYKV+I+TLKHLPDTKL
Sbjct: 226 GFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKL 285

Query: 305 DAVFGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNPRLHKIIKWTYFYAQASRNGIIII 362
           DAVFGLIPLFLL+ WKW C   GPRLN+R+  N KNPR H+I+K  YFYAQ ++N IIII
Sbjct: 286 DAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIII 345

Query: 363 VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLE 422
           VFTCI WAITRGK+   RPIS+LGSVP GLK+V  F VP GLM+KL P LPASIIVLLLE
Sbjct: 346 VFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLE 405

Query: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482
           HIAI+KSFGRINDYK+VPDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLS
Sbjct: 406 HIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLS 465

Query: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542
           GLFSG+CVLLALYCLTGAFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+
Sbjct: 466 GLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFL 525

Query: 543 VTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSY 602
           VTV+ITVFASIEDGIYFAMCWS A+L+ KVAFP GKFLG++E+ EV D  +  DS V++ 
Sbjct: 526 VTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTS 585

Query: 603 VSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKW 662
             EN+  + T + G       S + V+N ++   TN                   Y+TKW
Sbjct: 586 SDENSEILPTTKAG------YSVEVVSNHNE--NTN-------------------YYTKW 618

Query: 663 IPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIR 722
           +PFD  YT+ELNPD  I PPP GV+VYR+++S+TY+NCSRH++I+ +E+K+ T+RG+L +
Sbjct: 619 VPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQ 678

Query: 723 HRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVER---DDRPLLKI 779
             +KSDRPWNDPG WE   F+K    + +REN  E        +VD+E    DDRP LKI
Sbjct: 679 IMRKSDRPWNDPGKWEPRVFIKK---YLRRENYDED-------NVDIEDRVIDDRPFLKI 728

Query: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839
           +CLDFSQV+Q DATA+Q L DLRK++N+YADRQVEFHFVGIISPW+K+ L + GFGT+N 
Sbjct: 729 ICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINN 788

Query: 840 EYSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           EYSDESI+ GH+SYH+ +   G        +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 789 EYSDESIIMGHSSYHLTKDVDG--------IKAATGTNLPFFHIDIPNFNKWDI 834

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/899 (60%), Positives = 674/899 (74%), Gaps = 57/899 (6%)

Query: 34  YDQYKNNEN-NDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVSLYDN---SVS 89
           Y+Q+KNNE  ++T    D+E             KG+   K    + +D S Y     S+ 
Sbjct: 11  YNQFKNNERPSNTNAGADIE-------------KGLDTKKYFERSITDNSTYGKKSYSIP 57

Query: 90  QFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGC 149
            +EE T++LK+YYD ++R + T      Y++S+FP++NWLP YN  WF +DLIAGIT+G 
Sbjct: 58  SYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGT 117

Query: 150 VLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVT 209
           VLVPQSMSYAQ+ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSLQTAKVIA V 
Sbjct: 118 VLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVK 177

Query: 210 AKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILW 269
            K+PD D +ITGP+IAT LA +CGII+  VG LRLGFLVELISLNAVAGFMTGSAFNI+W
Sbjct: 178 EKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIW 237

Query: 270 GQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPR 329
           GQ+P LMGY+  VNTR +TY VVI++LKHLPDTKLDA FGLIPLF L+ WKWWC + GP+
Sbjct: 238 GQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPK 297

Query: 330 LNDRYNSKN--PRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGS 387
           L DRY   N  PR +K  K  YFY QASRNGIIII+FT + + IT+G +K +R IS+LG+
Sbjct: 298 LTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGT 357

Query: 388 VPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           VP GL+  GV  +P G+++ +   +P+SIIVLLLEHIAISKSFGR+NDYK+ P+QE+IAI
Sbjct: 358 VPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAI 417

Query: 448 GVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKA 507
           GVSNLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCLTGAFFYIPKA
Sbjct: 418 GVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKA 477

Query: 508 TLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAM 567
           TLSAVIIHAV DL+ASY TTW+ WKMN  DFI FI TV ITVF+SIE+GIYFA+CWSCA+
Sbjct: 478 TLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAI 537

Query: 568 LILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGG--EDDKESST 625
           L+   AFPAGKFLGR+E+AEV +  +  D D   +  EN+N   + +D G   D+  +  
Sbjct: 538 LLYNNAFPAGKFLGRIEIAEVVNPKIVDDDD---FSFENSN--ESFDDEGIYFDNSVAED 592

Query: 626 KYVTNSS--KKIETNVQTKGFDSP-SSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPP 682
           K  T+S+  KK    V+T+  +    +  +   I+Y+TKW+PFDH Y++ELNP V+I PP
Sbjct: 593 KLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPP 652

Query: 683 PDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAF 742
           P GV+VYRLS+SYTY+NCSRHY++I +E+K+VTRRGQLI+HR K DRPWNDPG WEAP  
Sbjct: 653 PPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDL 712

Query: 743 LK--NLK----FWKKRENDPESMENAPSTS--------VDVERDDRPLLKILCLDFSQVA 788
            K  N+K     +K++  D ++ EN                ++D+RPLL+++CLDFSQVA
Sbjct: 713 KKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVA 772

Query: 789 QTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVA 848
            TDATALQSL DLRKA+N+YADRQVEFHFVGI SPW+KRGL + GFGT NEEYSDESI+A
Sbjct: 773 NTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIA 832

Query: 849 GHTSYHVARVPQGEEN--------------PEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           GH+SYH++R  + E++                K  V  ASGTNLPFFH+DIPDF+KWDI
Sbjct: 833 GHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/898 (60%), Positives = 667/898 (74%), Gaps = 57/898 (6%)

Query: 34  YDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPS------DVSLYDNS 87
           YDQYK  E  +  +   L S+     N  ++ K  +  K+ + + S      +    D  
Sbjct: 39  YDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKYEEYKKLKHLDQSYNYVSTEYLDTDYL 98

Query: 88  VSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITI 147
           +    E  ++ KEYY+HS++ + T   A +Y  S+FPII+WLP YNF+WF +DLIAGITI
Sbjct: 99  IPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGITI 158

Query: 148 GCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIAD 207
           GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ Y+ FATSKDVCIGPVAVMSL+TAKVIAD
Sbjct: 159 GCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKDVCIGPVAVMSLETAKVIAD 218

Query: 208 VTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNI 267
           V++ + + D  +TGP+IATTLALLCG I+AAVGFLRLGFLVELISLNAV GFMTGSAFNI
Sbjct: 219 VSSHFQN-DPDVTGPIIATTLALLCGGIAAAVGFLRLGFLVELISLNAVTGFMTGSAFNI 277

Query: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYG 327
           LWGQVP LMGY+ LVNTR ATYKVVI+TLKHLPDTKLDAVFGLIPLF+LYV KWWC  YG
Sbjct: 278 LWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFGLIPLFILYVVKWWCTNYG 337

Query: 328 PRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGS 387
            +L ++  S N R    +K  YFY  A RN ++II+FT I W+ITR KS SERPI++LG+
Sbjct: 338 LQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVIIIFTAISWSITRNKSSSERPITVLGT 397

Query: 388 VPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           VPSGLK++GVF     ++ K+GP LPASIIVLLLEHIAI+KSFGRINDYK+VPDQELIAI
Sbjct: 398 VPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAIAKSFGRINDYKIVPDQELIAI 457

Query: 448 GVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKA 507
           G+SNL+GTFF+AYPATGSFSRSAL AKCNV+TPLSG+F+G CVLLALYCLTGAFFYIPKA
Sbjct: 458 GISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLSGIFTGGCVLLALYCLTGAFFYIPKA 517

Query: 508 TLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAM 567
           TLSAVIIHAVSDL+ASYQTT +FW MNPLD +CF+VTVLITVF+SIE+GIYFAMC+SCA+
Sbjct: 518 TLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVLITVFSSIENGIYFAMCYSCAL 577

Query: 568 LILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKY 627
            I + AFPAGKFLGR+E+AEV +A  + D     +  +N NG  T E       +S  K+
Sbjct: 578 FIFRSAFPAGKFLGRIEIAEVINATPKDD-----FQMDNFNGFETSEYNNFPADQSYGKF 632

Query: 628 VTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVL 687
                     N  T  ++SP  S +     ++TKW+PFDH YT+ELN DV+IL PP GV+
Sbjct: 633 DI-------ANKNTHKYNSPHCSKN-----FYTKWVPFDHTYTKELNKDVEILEPPPGVI 680

Query: 688 VYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFL---- 743
           VYRLS+S+ YLNCSRH++ I +EVK+ T+RG+ I + KKS RPWNDPG WEAP ++    
Sbjct: 681 VYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPGEWEAPTWMTKKF 740

Query: 744 --KNLKFWKKRE------NDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATAL 795
             +NL F +K+E      N+  S +   S + D++ D RP+L+++CLDFSQV+QTD TAL
Sbjct: 741 SIRNL-FKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTAL 799

Query: 796 QSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHV 855
           QSL DLRK++N YADRQVEFHF GIISPWVKRGLI  GFGT+NE YSD S + GH SYH+
Sbjct: 800 QSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHI 859

Query: 856 ARVPQ---------------GEENPE-----KYSVYTASGTNLPFFHIDIPDFAKWDI 893
            + P                 + N E      YS+  ASGTN PFFHIDIP+F+KWD+
Sbjct: 860 VKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHIDIPNFSKWDV 917

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/891 (60%), Positives = 658/891 (73%), Gaps = 62/891 (6%)

Query: 16  DFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDY 75
           DF E     P        YD YKN E N       +E+     H   N +KG+K      
Sbjct: 21  DFAE-----PNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ--NDAKGLKND---- 69

Query: 76  FNPSDVSLYDNSVSQ-----FEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLP 130
              + V LY  + S      + E TV+ K+YYD S+ S+++      YL S+FP+I W+P
Sbjct: 70  -GQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIP 128

Query: 131 HYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVC 190
           HYNF+W   D++AG+T+GCVLVPQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVC
Sbjct: 129 HYNFAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVC 188

Query: 191 IGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVEL 250
           IGPVAVMSL+TAKVIA VT   PD D+ ITGP+IAT L+LLCG I+  +G LRLGFLVEL
Sbjct: 189 IGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVEL 247

Query: 251 ISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGL 310
           ISLNAVAGFMTGSAF+I+ GQ+PALMGYN  VNTR  TYKVVI TLKHLPDTKLDAVFGL
Sbjct: 248 ISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGL 307

Query: 311 IPLFLLYVWKWWCGTYGPRLNDR-YNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGW 369
           IPL +LY+WK+ C T GP   DR  N  +PR  K  K  +FYAQA RN  +I++FT I W
Sbjct: 308 IPLLILYLWKYGCNTIGPNWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAW 366

Query: 370 AITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKS 429
            ITR K K   PIS+L +VPSGLK VGV   P  L + L P LPA+ I+LLLEHIAI+K+
Sbjct: 367 GITRHKKK--HPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKA 424

Query: 430 FGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSC 489
           FGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+C
Sbjct: 425 FGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGAC 484

Query: 490 VLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITV 549
           VLLALYCLT AF+YIPKATLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+
Sbjct: 485 VLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITI 544

Query: 550 FASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNG 609
           F+SIE+GIYFA+CWSCA+L+ K+AFP+GKFLGRVEV+EV +  VR D  VV         
Sbjct: 545 FSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVV--------- 595

Query: 610 ISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQ--PRIKYHTKWIPFDH 667
                    +D +S    V +S+K         G  + +SSIS    R+++HTKWIP ++
Sbjct: 596 ---------EDFDSENINVASSTKP------KLGLSADNSSISTGPSRVRFHTKWIPLEN 640

Query: 668 KYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKS 727
            Y RE N  + + PPP GV+VYR SES+TY+NCSR Y+II +EVK++TRRG ++ H KKS
Sbjct: 641 NYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKS 700

Query: 728 DRPWNDPGPWEAPAFLKNL-KFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQ 786
           DRPWNDPG WE P FLK L K  K+ E +          S ++ RD+RP+LKIL +D+SQ
Sbjct: 701 DRPWNDPGQWEPPLFLKKLFKRGKRLEQE---------LSPELGRDERPVLKILAMDWSQ 751

Query: 787 VAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESI 846
           V Q DAT +Q+LVDLRKAIN+YADRQVEFHF GIISPW+KR L++ GFGT+N+E++DES+
Sbjct: 752 VTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESL 811

Query: 847 VAGHTSYHVARV-PQGEEN---PEKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           + GH+SYH+ +  PQ EEN     +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 812 ILGHSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/904 (58%), Positives = 664/904 (73%), Gaps = 36/904 (3%)

Query: 7   PNFE-EVEIPDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDK-DLESNSVAKHNAVNS 64
           P FE EVE+ +    ++           YDQYK  E+ +    + D E +   +   V+ 
Sbjct: 22  PRFESEVELSEVSNLDD-------LEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVD- 73

Query: 65  SKGVKGSKIDYFNPSDVSLY----DNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120
               K ++++Y+N ++ +        +V  +EE  V   + + H ++  +T+     Y +
Sbjct: 74  ---YKETELEYWNSTNGTTNLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFE 130

Query: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           S FPII WLP YN+ W  ADL+AGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSF+GA+ Y
Sbjct: 131 SAFPIIKWLPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIY 190

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSL+TAKVI +   K+P  D  +TGP+IAT LALLCGI++   G
Sbjct: 191 SFFATSKDVCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAG 250

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
            LRLGFLVELISLNAVAGFMTGS+ NI+ GQVPALMG+   V+TR +TYK++I +LK+L 
Sbjct: 251 VLRLGFLVELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLK 310

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360
            T+LDAVFGLIPL LLY WKWWC +YGP+L DR+   NP+   I+K  YFYAQA R+ +I
Sbjct: 311 HTQLDAVFGLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVI 370

Query: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420
           IIVFT I + IT+G+ K+ R IS+LG VP GLK+V V  +P GL+SK+G ++P++II+LL
Sbjct: 371 IIVFTAISYGITKGR-KTPR-ISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILL 428

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHI+I+KSFGR+N+YKVVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 429 LEHISIAKSFGRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTP 488

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSG+FSG+CVLLALYCLT  F+YIP ATLSAVIIHAVSDL ASY+T+WNF+KMNP DFI 
Sbjct: 489 LSGVFSGACVLLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIA 548

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600
           FIVTV ITVF+SI+ GIYFAMCWS AM +LK  F  G+FLGRVEVAEV +A V P+ + V
Sbjct: 549 FIVTVFITVFSSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESV 608

Query: 601 SYVSENNNGISTLEDG--GEDDKESSTKYVTNSSKK-IETNVQTKGFDSPSSSISQ---P 654
           S          +  DG   +   ESS+K +    K  + +N    G D   ++I+     
Sbjct: 609 S------ESAGSHLDGFQAQSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQ 662

Query: 655 RIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKV 714
           ++ YHTKWI +D  Y+RE NP+V I PPP GV+VYR  +SYTYLNCSRHY+II +EV++ 
Sbjct: 663 KLVYHTKWISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRT 722

Query: 715 TRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVE-RDD 773
           TRRGQ+I   KK DRPWNDPG WEAP + K L   KK   +    E   S + + + +D+
Sbjct: 723 TRRGQMISAVKKVDRPWNDPGEWEAPRWFKKLTSKKKTAEEWAETEAQESKAAEQKLQDN 782

Query: 774 RPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRG 833
           RPLLKI+CLDFSQ +QTDATA+Q+L DLRK +N+YADRQVEFH  G+ +PWVKR L++ G
Sbjct: 783 RPLLKIICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFG 842

Query: 834 FGTLNEEYSDESIVAGHTSYHVARVPQGEEN----PEKYSVYTASGTNLPFFHIDIPDFA 889
           FGT+NEEYSDES++AGH SYHVAR P   E+    P +YSVY ASGTNLPFFH++IPDF+
Sbjct: 843 FGTVNEEYSDESLLAGHRSYHVARAPTSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFS 902

Query: 890 KWDI 893
           KWD+
Sbjct: 903 KWDL 906

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/884 (57%), Positives = 644/884 (72%), Gaps = 46/884 (5%)

Query: 34  YDQYKNNENNDTFNDKDLESNSVAKHNA-------VNSSKGVKGSKIDYFNPSDVSLYDN 86
           Y Q+KN E++D    +DL S   A+  A         S  G    +     P+      +
Sbjct: 37  YGQFKNAEHSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVAPAAPGNVPS 96

Query: 87  SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGIT 146
           ++ +F E  V++ E+Y  ++RS  T+    +YL+S+ PI+ WLPHYN  W   DL+AGIT
Sbjct: 97  ALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGIT 156

Query: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206
           +GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSLQTAK I+
Sbjct: 157 VGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAIS 216

Query: 207 DVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFN 266
            V +  P+ D+ IT P+IAT LALLCGIIS  +G LRLGFLVELIS  AVAGFMTGSA N
Sbjct: 217 HVVSSLPE-DTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSALN 275

Query: 267 ILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           I+ GQVPALMGYN LVNTR +TYKV+I +L+HLPDTKLDAVFGL+PL +LYVWKW C T 
Sbjct: 276 IIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTG 335

Query: 327 GPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRG--KSKSERPISI 384
           GPRL  RY S+  R+   +   + Y QA RN ++I+VFT I W ++    K      IS+
Sbjct: 336 GPRLVQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISL 392

Query: 385 LGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQEL 444
           LG+VPSGLK+VGV  VP GL+SK+ P LPAS+IVL+LEHIAISK+FGR+NDY+VVPDQEL
Sbjct: 393 LGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQEL 452

Query: 445 IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYI 504
           IAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLFSG+CVLLA+YCLT AF +I
Sbjct: 453 IAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFI 512

Query: 505 PKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWS 564
           PKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV+ITVF+SIE+GIYFAMCWS
Sbjct: 513 PKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWS 572

Query: 565 CAMLILKVAFPAGKFLGRVEVAE--VTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKE 622
            A+L+ + AFPAGKFLGRV++AE  VT++        V   S N+ G +      E ++E
Sbjct: 573 VAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAG---VGMSSGNSAGTAV---NREKERE 626

Query: 623 SSTKYVTNSSKKIETNVQTKGFDSPSSSISQ-------------PRI-KYHTKWIPFDHK 668
           ++   V+ SS+ +      K   + S+   +             PR  ++HTKW+PFD +
Sbjct: 627 TTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFD-R 685

Query: 669 YTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSD 728
           YTRELNP+V + PPP GV+V+R SES+TY+NCSR Y+ I +EV ++TRRG+     K S 
Sbjct: 686 YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSS 745

Query: 729 RPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVA 788
           RPWNDPG W  P FL+ L      ++  E +EN       V RD+RP+L+++ +D+SQVA
Sbjct: 746 RPWNDPGEWHPPKFLRKL-----FKSSSEDLENRA-----VARDERPVLRVIAMDWSQVA 795

Query: 789 QTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVA 848
           Q D+T LQ+L DLRKA+N+YADRQVEFHF GII PWVKRGLI+ GFGT+N+E++DES++ 
Sbjct: 796 QVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLV 855

Query: 849 GHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWD 892
           GH S H+AR  +  E+ E    + A+GTNLPFFH+++PDF++WD
Sbjct: 856 GHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/817 (59%), Positives = 622/817 (76%), Gaps = 36/817 (4%)

Query: 84  YDN-SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLI 142
           YD+  V  +EET V  K+ YD  +R +LT      YL S+FP++ W+ HYNF+W   DL+
Sbjct: 104 YDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLV 163

Query: 143 AGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTA 202
           AGIT+GCVLVPQSMSYAQ+ATLPAQYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TA
Sbjct: 164 AGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETA 223

Query: 203 KVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTG 262
           KVIA V  K  + +  IT P+IATTL+L+CG ++  VG LRLGFLVE ISLNAVAGFMTG
Sbjct: 224 KVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTG 283

Query: 263 SAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWW 322
           SA NI+ GQVP LMGY+  VNTR +TYKV+I TLKHLPDTKLDAVFGLIPLF+LY WK++
Sbjct: 284 SAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYF 343

Query: 323 CGTYGPRLNDRYNSK-NPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERP 381
           CGT GP+L DRY ++ + +     K+  FY QA RN  +II+FT I W ITR K+K + P
Sbjct: 344 CGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFTLISWGITRHKAKEDLP 403

Query: 382 ISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441
           IS+LG+VPSGLK VGV  +P GL+S L   LP++II+L+LEHIAISK+FGR+N YKVVPD
Sbjct: 404 ISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGRVNGYKVVPD 463

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           QELIAIGV+NL+ TFFNAYPATGSFSRSALKAKCNV+TPLSG+F+G+CVLL+LYCLT AF
Sbjct: 464 QELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVLLSLYCLTDAF 523

Query: 502 FYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAM 561
           ++IPKA LSA+IIHAVSDL+ASY+TTWNFW MNPLDF+CFIVTV+IT+F+SIE+GIYFA+
Sbjct: 524 YFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFSSIENGIYFAV 583

Query: 562 CWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDK 621
           CWSCA+L+LKV FP G+FLG VE+ +V++A V  D ++   V   ++   T+ED      
Sbjct: 584 CWSCALLLLKVVFPTGQFLGYVEICQVSNAEV--DENIDRIVLSEDSQPKTIEDN----- 636

Query: 622 ESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILP 681
                 VT ++  ++  V        + S    +++YHTKW+P ++ Y RELNPDV +  
Sbjct: 637 ------VTKNNTAVKVGVVA------NESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQA 684

Query: 682 PPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPA 741
           PP GV+VYR SES+TY+NCSR Y+ I + VK++TR G+L++H  K D+ WNDPG WE P 
Sbjct: 685 PPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPF 744

Query: 742 FLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDL 801
            +K L F    ++D E  E           D+RP+LKIL +D+SQV Q D+T +Q+LVDL
Sbjct: 745 LVKKL-FKLGNKHDLEGGEVI---------DERPVLKILAMDWSQVTQIDSTGVQNLVDL 794

Query: 802 RKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQG 861
           RKAIN+YA+RQVEFHF GIISPW+KR LI+ GFGT+NEE+SDESI+ GHTSY + +    
Sbjct: 795 RKAINKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPD 854

Query: 862 EENPEK-----YSVYTASGTNLPFFHIDIPDFAKWDI 893
            ++PE       +++TA G NLPFFH+++P+F KW +
Sbjct: 855 LQDPEAALPEPIALHTALGVNLPFFHLEMPEFHKWHL 891

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/843 (60%), Positives = 618/843 (73%), Gaps = 48/843 (5%)

Query: 87  SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGIT 146
           S+  + E  V++K++Y   I  + ++     YL S+FP++ WLPHYN  W   DLIAGIT
Sbjct: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122

Query: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206
           +GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182

Query: 207 DVTAKYPDGDSAI-TGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265
            VT+     +  I T P+IAT LALLCGIIS  +GFLRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 183 RVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242

Query: 266 NILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325
           NI+ GQVPALMGYN  VNTRA+TY+VVI TLKHLPDTKLDAVFGLIPL +LY+ KW+  +
Sbjct: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302

Query: 326 YGPR-LNDRYNSKN--PRLHKIIKWT---YFYAQASRNGIIIIVFTCIGWAITRGKSKSE 379
            GP+ LN   N +N   R  KIIK+    +FY+ A RNG++IIVFT I WAITRGKS + 
Sbjct: 303 LGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTS 362

Query: 380 RPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVV 439
            PISILG+VP GLKEV VF VP GL  KL P+LP+SII+LLLEHIAISKSFGR+NDYK+V
Sbjct: 363 VPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIV 422

Query: 440 PDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTG 499
           PDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVLLALYCLTG
Sbjct: 423 PDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTG 482

Query: 500 AFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYF 559
           AF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVF+SIE GIYF
Sbjct: 483 AFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYF 542

Query: 560 AMCWSCAMLILKVAFPAGKFLGRVEVAEV------TDAYVRPDSDVVSYVSENN---NGI 610
           A+C+SCA LI K  FP G FLG +++AEV      T+ Y     D  S + E N   + +
Sbjct: 543 AICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSV 602

Query: 611 STLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYT 670
               D  E+ K S  +Y    S ++ +N +T              + Y+ +W+P  + Y 
Sbjct: 603 KNRLDQNENPKSSEKEYSEFKSYEMSSNSKTT------------NLSYYVRWVPMKNDYH 650

Query: 671 RELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRP 730
           RE+NP ++I PPP G++VYR  +S+TYLNCSRHY+II +EVKK TR+G    +++K DRP
Sbjct: 651 REVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRP 710

Query: 731 WNDPGPWEAPAFLKNLKFWKKR------ENDPESMENAPSTSVDVERDDRPLLKILCLDF 784
           WND G WE P  LKNL    K+      + D +  E   S S     D++P LKI+C DF
Sbjct: 711 WNDVGEWECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDF 770

Query: 785 SQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDE 844
           SQV QTDATA+QSL DLRKA+N+Y+++Q+E+HF GIIS WVK+ LI  GFGT+N+ YSD+
Sbjct: 771 SQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDK 830

Query: 845 SIVAGHTSYHVARVPQGEENPEK--------------YSVYTASGTNLPFFHIDIPDFAK 890
           SI+ GH SYHV+++   E+  E               Y + T +GTN PFFHIDIPDF+ 
Sbjct: 831 SIIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSN 890

Query: 891 WDI 893
           W++
Sbjct: 891 WEL 893

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/821 (59%), Positives = 612/821 (74%), Gaps = 43/821 (5%)

Query: 81  VSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTAD 140
           ++LYD+  + +E+  V+ +EYYD +IR  LT      YL+ + P+INWLPHYN  WF  D
Sbjct: 72  LALYDSPEAYYEDK-VTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQD 130

Query: 141 LIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQ 200
           ++AGIT+GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGPVAVMSLQ
Sbjct: 131 MVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQ 190

Query: 201 TAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFM 260
           TAK ++ V A+ P  D+ IT PV+AT LA LCG+IS  +G LRLGFLVELIS  AVAGFM
Sbjct: 191 TAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVAGFM 249

Query: 261 TGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWK 320
           TGSA NI+ GQ+PALMGYN LVNTR +TYKV+IETLKHLPDTKLDAVFGLIPL +LY WK
Sbjct: 250 TGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWK 309

Query: 321 WWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSER 380
           W C + GPRL +RY  +  R  +I   T FY QA RN +IIIVFT I W+I+  K K+  
Sbjct: 310 WLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA-- 367

Query: 381 PISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVP 440
           PIS+LG VPSGLK+VGV  +P GL +K+ P LPAS+IVLLLEHIAI+K+FGR+NDY+VVP
Sbjct: 368 PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVP 427

Query: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500
           DQELIAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA+YCLT A
Sbjct: 428 DQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSA 487

Query: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560
           F YIPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VF+SIE+GIYFA
Sbjct: 488 FQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFA 547

Query: 561 MCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLED----G 616
           MCWS A+L+ KVAFP  +FLGRVE+AE+                  N G+S   +     
Sbjct: 548 MCWSVAVLLFKVAFPRAQFLGRVEIAELA----------------TNEGVSAGSEFAPLS 591

Query: 617 GEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSI----SQPRIKYHTKWIPFDHKYTRE 672
            + +K     Y + S      N + +G +  S  +    +     +HTKW+PF+  YTRE
Sbjct: 592 KDFEKGKGVSYASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRE 650

Query: 673 LNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWN 732
           LNP V +  PP GV+V+R SES+TY+NC+R YN I +EV + TRRG+ ++   KS RPWN
Sbjct: 651 LNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWN 709

Query: 733 DPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDA 792
           DPG W  P FL+  K++ K+ +  ES+E        V  DDRP+L+++ +D+SQVAQ D+
Sbjct: 710 DPGEWHPPKFLR--KWFGKKYS--ESLEQG------VVSDDRPVLRVIAMDWSQVAQVDS 759

Query: 793 TALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTS 852
           T LQ+L DLRKA+++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ GH +
Sbjct: 760 TGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKT 819

Query: 853 YHVAR-VPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWD 892
           Y VAR    G+E  E      A+G N+PFFH ++PDF+KWD
Sbjct: 820 YQVARGGATGDE--EALLPQPATGVNMPFFHAEMPDFSKWD 858

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/806 (56%), Positives = 579/806 (71%), Gaps = 44/806 (5%)

Query: 87  SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGIT 146
           +V ++EET VS+K+YY++ +R  +++  A  Y  SVFP+  W+ HYN +W  AD++AGIT
Sbjct: 82  AVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGIT 141

Query: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206
           +GCVLVPQSMSYAQ+A+L  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TAKVIA
Sbjct: 142 VGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIA 201

Query: 207 DVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFN 266
            VT   P+ D+ ITGP+IAT L LLCG I+  +G LRLGFLVE IS+ AV GFMTGSA +
Sbjct: 202 RVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALS 260

Query: 267 ILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           I+ GQVP+LMGY+  VNTRA TYKV+IE+LKHL DT ++A FGL+PL LL++WKW CG+ 
Sbjct: 261 IISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSL 320

Query: 327 GPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILG 386
           GPRL DRY    P         +FY QA RN +II+VFT I W I+R K + + PIS+LG
Sbjct: 321 GPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLE-KPPISLLG 379

Query: 387 SVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIA 446
            VPSGLK VG   +P GL+ KL P LPA+ I+LLLEHIAI+KSFGRIN+YKVVPDQELIA
Sbjct: 380 KVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIA 439

Query: 447 IGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506
           IGV+NL  TFFNAYPATGSFSRSALKAKCNV+TPLSGLF+G+CVLLALYCLT AF++IPK
Sbjct: 440 IGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPK 499

Query: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566
           ATLSAVIIHAV+DL+ASY+ TW FW+ NPLDF  FIVTV+ITVF+SIE GIYF++ WSCA
Sbjct: 500 ATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCA 559

Query: 567 MLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTK 626
           +L+ KVAFP GKFLG ++VAEV +    P              I++  D    D  ++ +
Sbjct: 560 VLLCKVAFPDGKFLGYIDVAEVIEPAGPPS-------------INSEADLASIDNSATFQ 606

Query: 627 YVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGV 686
            +     K+ T           S +  P  ++H +WIP DH Y+RELNP+  + PPP GV
Sbjct: 607 QIDKDGGKLNTV---------ESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGV 657

Query: 687 LVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNL 746
           +VYR ++S+TYLNCSRH++II + VK+ TR GQL+ H    +R W DPGPW  P   +  
Sbjct: 658 IVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRF 717

Query: 747 KFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAIN 806
               KR     +             D RP+L++L +D+SQV+Q D+T +Q+LVDLR A+N
Sbjct: 718 -IADKRTGSAVA-------------DARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALN 763

Query: 807 QYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQGEEN-P 865
           +YADR VEFHF GI+SPW+KR L++ GFG      +D  +++   SYH+ R+P    +  
Sbjct: 764 KYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLPADPPHIV 818

Query: 866 EKYSVYTASGTNLPFFHIDIPDFAKW 891
             +SV  A GTN PFFH+D+PDF  W
Sbjct: 819 HGHSVVFALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/869 (51%), Positives = 607/869 (69%), Gaps = 50/869 (5%)

Query: 34  YDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEE 93
           Y ++K NE++  ++  + E + + K ++V       GS + +      +L D     + E
Sbjct: 47  YTRFKTNEDSAGYSGAENERSRIDKFDSV-------GSSLQFAKYDGNALPDFKAPPYYE 99

Query: 94  TTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVP 153
           TTV+  EYYD +IRS +      SY  S+FPII W+ HYNF+W  +D IAGIT+GCVLVP
Sbjct: 100 TTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVP 159

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP 213
           QSMSYAQ+A L  +YGLYSSFIGA+ YSFFATSKDVCIGPVAVMS+Q +KVI+ V  + P
Sbjct: 160 QSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLP 219

Query: 214 DGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
           +G + IT P++A+ LAL   I+   +G LRLGF++ELIS+ AVAGFMTGSA +IL  Q+P
Sbjct: 220 EG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLP 278

Query: 274 ALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDR 333
           +L+G    +NTR  TY+V+I TLKHL  + ++A FGLI L LL+ WKW CG  GP+L  +
Sbjct: 279 SLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISK 337

Query: 334 YNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLK 393
           Y   N +  +I +  +FYAQA RN  ++ + T + W +  G+ K +  IS+LG+VPSGLK
Sbjct: 338 YLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLK 396

Query: 394 EVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLL 453
            VGV  +P GL+ KL P LP ++I+LLLEHI I+KSFGRIN+YK+VPDQELIAIGV+NL+
Sbjct: 397 HVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLI 456

Query: 454 GTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVI 513
           G+FFNAYPATGSFSRSALKAKCNV+TPLSGLFSG+CVLLALY LT AF+YIPKA LSAVI
Sbjct: 457 GSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVI 516

Query: 514 IHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVA 573
           IHAV DL+ASY+ ++  W  NP D I F+ T+L+T+F+SIE+GIYFA+ +S A L++K A
Sbjct: 517 IHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNA 576

Query: 574 FPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSK 633
           FP+GKFLG V++ EV++  V  D D +                G +D E   +   +S  
Sbjct: 577 FPSGKFLGYVKITEVSNLNVFEDLDSI----------------GNNDPELPQEISKDSKL 620

Query: 634 KIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSE 693
             + +V      S +   S+  +++HTKW+P D+ Y+RELNP++ +  PP GV+VYR +E
Sbjct: 621 AKDPDVHA----SANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTE 676

Query: 694 SYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKK-- 751
           S+ YLNCSR ++II + VK +TR G+L+ H +KS++ W +PG W  P FL+  KF+KK  
Sbjct: 677 SWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLR--KFFKKYR 734

Query: 752 -RENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYAD 810
            +   PE +E         + D+RP+LKIL +D++QV   D+T++QSL+DLRK IN+YAD
Sbjct: 735 HKAAKPEVVE---------QVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYAD 785

Query: 811 RQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR--VPQGEENPEK- 867
           RQV FHF GI+SPW+KR L+  GFGT+NE YS++ ++  +++YHV +  +   EEN +  
Sbjct: 786 RQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNS 845

Query: 868 ---YSVYTASGTNLPFFHIDIPDFAKWDI 893
               S+  ASGTN PFFHID+PDF KWDI
Sbjct: 846 EISASLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  518 bits (1335), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 265/507 (52%), Positives = 356/507 (70%), Gaps = 23/507 (4%)

Query: 91  FEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCV 150
           + E  V+L E ++H +    T +   +YL S+ PI  W+ HYN  WF +D+IAGIT+GCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 151 LVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTA 210
           LVPQSMSYAQ+ATL  QYGLYSS +G + Y+ FATSKD+CIGPVA+MSLQTAK IA V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 211 KYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWG 270
           K+PD    I   +IA+T+A++CG I+  +G LRLGF ++LI + AV GF +GSAFNILWG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 271 QVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRL 330
           Q+P LMGY+  VNTR  TYKVV++TLK LP T ++AV GLIPLF L+VWK+ C  Y  R 
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD-YALR- 236

Query: 331 NDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPS 390
             R N K P   +I+    FY  + R  I+II+ +   +     K+ S   + +LG +P 
Sbjct: 237 --RGNLK-PWPKRIV----FYLLSLRVTIVIIICSAAAYG---AKNPS---LKVLGKIPK 283

Query: 391 GLKEVG---VFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           G        +  +P  L+S +   +PAS+IVL+LEH++I+KSF R+N+Y+V  DQEL AI
Sbjct: 284 GFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAI 343

Query: 448 GVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506
           GVSN++G     AYP TGSFSR+ALKA+C VRTPL  +FSG CV++A+  LT A  +IPK
Sbjct: 344 GVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPK 403

Query: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566
           ATLSAVIIHAVS L++SY+ T   +KM PLD + F+VT+ ITVF+ IE G+YFA+CW+C 
Sbjct: 404 ATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACF 463

Query: 567 MLILKVAFPAGKFLGRVEVAEVTDAYV 593
           +L++++AFP G FLG V V E++ + +
Sbjct: 464 LLMIRIAFPYGAFLGYVRVREISRSSI 490

 Score =  196 bits (498), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 137/221 (61%), Gaps = 22/221 (9%)

Query: 662 WIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL- 720
           WIP+ H++TRELNP V+I PPP GV+VYR S+S TY+NCSR+Y+ I + +K  T+ G++ 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780
           +       +PWN+PGPWE P     LKFW+    DPE              D RP L+IL
Sbjct: 748 VLSDALYVKPWNNPGPWEKP----KLKFWE--HADPEIARKKRMA------DKRPTLRIL 795

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840
           CLDFSQVAQ D+TALQ+L+DLR  +N Y    VE+HF GIISPWV+R LI  GFG +N+E
Sbjct: 796 CLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKE 855

Query: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFF 881
           +  +     + S  V  +   E N E      A G N+PFF
Sbjct: 856 FFPKV----NDSSTVEVISDLEYNGE-----LALGENVPFF 887

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 163/689 (23%), Positives = 285/689 (41%), Gaps = 99/689 (14%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P + W+P+YN+  F  D IAG+++    +P  +S+A  +A +    GLYS  +  + Y+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + +  +T+     D ++    IAT ++ + G+     G 
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTSH----DLSLETVDIATMISFMSGLTLLFGGI 187

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK---- 297
            RLGFL  ++S   + GF++   F ++   +   +  N L+ T    Y    E +     
Sbjct: 188 FRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVR 247

Query: 298 ------HLPDTKLD-AVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYF 350
                 HLP + L  AVF    L  + ++K                   ++ + IKW  F
Sbjct: 248 YGPSNYHLPTSFLSLAVF--TTLMTIRIFK------------------KKMMRRIKWIVF 287

Query: 351 YAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPS-GLKEVGVFHVP-----PGL 404
             +     + +++F+ +   +   K K +  IS++G   + G  +   F  P      GL
Sbjct: 288 IPEI----LSVVIFSIVLSYMCDLKKKYD--ISVIGDFNTDGFDD---FRNPLSKCNRGL 338

Query: 405 MSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATG 464
           +  L      S ++  LE I  SKS G   +     ++EL+A+G+ N +G+ F   PA G
Sbjct: 339 IPALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFG 398

Query: 465 SFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--A 522
            + RS + A    +T ++G+F GS  L  +  L     YIP   LS +       LL  A
Sbjct: 399 GYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEA 458

Query: 523 SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGR 582
            +   ++       + I F++T L T F SIE GI     +S   ++   A    + L R
Sbjct: 459 PHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILAR 518

Query: 583 VEVAEVTDAYVRPDSDVVSYVSENNNGISTLED----------------GGEDDKESSTK 626
           V   E TD ++  +  +   +  +N     +E                   ED KE   +
Sbjct: 519 V---EGTDHFINANEYLQLDLDSDNCSAPDIEHFEGCLVVKIPEPLTFTNTEDLKERLDR 575

Query: 627 YVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFD-HKYTRELNPDVQILPPPDG 685
                S K    ++++G     SSI         ++I FD H  T   +   QIL   D 
Sbjct: 576 LERFGSTKAHPGMKSEG----GSSI---------EYIIFDLHGMTFMDSSATQIL--KDI 620

Query: 686 VLVYRLSESYTYL-----NCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWND---PGPW 737
           V+ YR  +   +L     N      +    +  + ++ ++ +H   S +       P   
Sbjct: 621 VVEYRKRDVVVFLARVPPNLEVRERLKESGINDLVQKQEVKQHSNHSLQSAQTPYFPNIA 680

Query: 738 EAPAFLKNLKFWKKRENDPESMENAPSTS 766
           EA + + NL   K R    + +  +PS S
Sbjct: 681 EALSMVDNL---KARTRSQQILRTSPSIS 706

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 125/481 (25%), Positives = 205/481 (42%), Gaps = 49/481 (10%)

Query: 107 RSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLP 165
           RS LT      YL   FP  +W+P+Y  + F  DL AG+++    +P ++SYA  +A + 
Sbjct: 44  RSILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVE 103

Query: 166 AQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIA 225
              GLYS  I  + Y+ F +   + +GP + +SL    V+        + D  I+   I+
Sbjct: 104 PLSGLYSLAITPFIYAIFGSVPQMIVGPESAISL----VVGQAVEPMVNHDERISTISIS 159

Query: 226 TTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTR 285
             +  + G     +G  RLGFL  ++S   + GF+    F ++   + + +  + ++ T 
Sbjct: 160 IVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATS 219

Query: 286 AATYKVVIETLK----------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYN 335
              Y    E +           H P T + +++  I L L+ V K               
Sbjct: 220 PEHYHTPFEKILFLIKYGQHNYHAP-TAILSLYSFIILMLMKVMK--------------- 263

Query: 336 SKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEV 395
               RL K  KW  F  +     I+I++   I ++      K +  ISI+G     +   
Sbjct: 264 ---KRLMKRFKWVIFVPE-----ILIVIVGTIMFSF-HFDIKHKFDISIIGDFK--VNGF 312

Query: 396 GVFHVPPGLMSKL--GPNLPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVS 450
              H P    ++L   P L A I+  +L   E    SK+ G   D  V  ++EL+A+G  
Sbjct: 313 DSLHNPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSM 372

Query: 451 NLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLS 510
           N++G+ F A PA G + RS + A    +T +SG+  GS  L  +          P   LS
Sbjct: 373 NIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLS 432

Query: 511 AVIIHAVSDLLASYQTTWNFWKMNPL--DFICFIVTVLITVFASIEDGIYFAMCWSCAML 568
            V       LL    T   F+  +    + I   +T + T+F S+E GI    C+S   +
Sbjct: 433 VVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSIISI 492

Query: 569 I 569
           I
Sbjct: 493 I 493

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  122 bits (307), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 143/584 (24%), Positives = 240/584 (41%), Gaps = 72/584 (12%)

Query: 15  PDFQETNNTVPXXXXXXXXYDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKID 74
           PD    +NT P           Y N   +DT    + +          NS+   +G+  D
Sbjct: 3   PDHDLGSNTKP-----------YSNTPPDDTIRFCNCDQKQSMGSLKNNSTSIFRGASSD 51

Query: 75  YFNPSDVS-LYDNSVSQF------EETTVSLKEYYDHSIRSHLTVKGACSYLKSV---FP 124
             N S +S ++  S S          T  ++     HSI  +    G  ++++ +    P
Sbjct: 52  TLNQSTISNMFIRSDSNAFHHNNGNNTNSAMHMVDHHSIIGNSIQLGPPTWIELIRYYLP 111

Query: 125 IINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYSFF 183
            + WLP+Y  +    DL+AGITI    +P ++SYA  +A +    GLY+  +  + Y+ F
Sbjct: 112 CLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYAIF 171

Query: 184 ATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLR 243
            ++  + +GP   +SL   + +       PD D  +   VIA T  L+ G I    G  R
Sbjct: 172 GSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPILI--VIAVT--LISGTILLISGIFR 227

Query: 244 LGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTK 303
           LG+L  +++   + GF+         G V  +M  +SL+N       ++ +T +H     
Sbjct: 228 LGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDILADTPEHYNTPF 277

Query: 304 LDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNS-----------KNPRLHKIIKWTYFYA 352
           L  VF         +WK+    +                     K   +H+  +W  F  
Sbjct: 278 LKIVF---------LWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHR-HRWLIFIP 327

Query: 353 QASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP-----PGLMSK 407
           +      I+IV T +     +        I ILG   S   E  +FH P      GL+  
Sbjct: 328 E------ILIVLTTVLILSYKLDFADTYDIDILGDFKS--NENSIFHNPLSNKNRGLIHV 379

Query: 408 LGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFS 467
           +      + I    E    SK+ G  ++  V  ++EL+A+G+SN++ +   A P+ G + 
Sbjct: 380 VFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYG 439

Query: 468 RSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTT 527
           RS + A    +T LSG+F G   +LA+  L     YIP   LS +       LL      
Sbjct: 440 RSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKE 499

Query: 528 WNF-WKMNPLDFICFIV-TVLITVFASIEDGIYFAMCWSCAMLI 569
            +F W+    + +  IV T + ++F S+E  +Y    +S   +I
Sbjct: 500 VSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNII 543

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  115 bits (289), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 122/486 (25%), Positives = 196/486 (40%), Gaps = 55/486 (11%)

Query: 119 LKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGA 177
           LK   P  +WLP Y    F  D+IAGIT+    +P ++SYA  +A +    GLYS  I  
Sbjct: 77  LKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITP 136

Query: 178 YSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISA 237
           + Y  F +   + +GP + +SL    V+     K    +  +    I+  +  L G I  
Sbjct: 137 FVYCVFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAILL 192

Query: 238 AVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK 297
             G  RLGFL  ++S   + GF++     ++   +   +    L+ T    Y    E ++
Sbjct: 193 IFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQ 252

Query: 298 HL----PDT--KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFY 351
            L    P+   K  A+  L    +L   ++       +L  RY           K   F+
Sbjct: 253 FLFKYGPENLHKPTAILSLCSFIILMTLRFL----KKKLMKRY-----------KSVIFF 297

Query: 352 AQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSV----------PSGLKEVGVFH-- 399
            +     I++IV + +  ++     K +  IS+LG            P G     + H  
Sbjct: 298 PE-----ILLIVISSLIISVNFNL-KKDFDISMLGDFSTSGFDKLNNPLGKDNRSLCHEL 351

Query: 400 VPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNA 459
           +  GLM           I+   E    SKS G I D  +  ++EL+A+G  NL+G+ F A
Sbjct: 352 LSVGLMCA---------ILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGA 402

Query: 460 YPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSD 519
            P+ G + RS + A    +T +SG   G   L  +  L     Y P   LS +       
Sbjct: 403 LPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLS 462

Query: 520 LL--ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAG 577
           LL  A     ++       + I F +  + T+  S+E GI     +S   +I   A    
Sbjct: 463 LLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRI 522

Query: 578 KFLGRV 583
           + L RV
Sbjct: 523 QILTRV 528

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  115 bits (289), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 126/481 (26%), Positives = 198/481 (41%), Gaps = 51/481 (10%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP+YN S    DLIAG+++    +P ++S+A  VA +    GLYS     + Y+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
              +   + +GP + +SL   + +  + +  PD  +     VI      + G      G 
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISHNPDLHTLQLSAVIT----FISGGFLFFFGL 205

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK---- 297
            RLGFL  ++S   + GF++     ++   + +    + ++      Y    E +     
Sbjct: 206 CRLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVT 265

Query: 298 ------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFY 351
                 H P T L     L   F+L + K       PR   R+    P +  +I  T F 
Sbjct: 266 YAPNNYHGPTTALS----LSCFFILIMTKIIKKKLMPRC--RWIVFVPDILLLIIGTIFL 319

Query: 352 AQASR---NGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKL 408
           +   R   N  I    + +G   T+G  K   P+S                   GL+ +L
Sbjct: 320 SIKYRFKHNYSI----STVGDFNTKGLDKLLNPLSAENR---------------GLIPQL 360

Query: 409 GPNLPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGS 465
              L A  I  +L   E    SKS G   D  +  ++EL+A+G  NL  +   + PA G 
Sbjct: 361 ---LSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGG 417

Query: 466 FSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--AS 523
           + RS + A    +T +SG F G  VLL +  L     YIP   LS V       LL  A 
Sbjct: 418 YGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAP 477

Query: 524 YQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRV 583
               ++F      + + F +TVL T+F S+E GI     +S   +I   A    + L RV
Sbjct: 478 ADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKSRIQILARV 537

Query: 584 E 584
           +
Sbjct: 538 Q 538

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 124/478 (25%), Positives = 201/478 (42%), Gaps = 47/478 (9%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y F+    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
              +   + +GP + +SL   + +  +T  + +  S I    I+T +  + G I    G 
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITL-HKENVSLID---ISTVITFVSGTILLFSGI 220

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 221 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 280

Query: 302 ---------TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYA 352
                    T + +   LI LFL  + K                   +L K  K   F+ 
Sbjct: 281 YAPAQYHIPTAIFSGCCLIVLFLTRLLKR------------------KLMKYHKSAIFFP 322

Query: 353 QASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVP-SGLKEVGVFHVPPGLMSKLGPN 411
                 I+++V   I  ++ +   K    ISI+G        E+      P    KL P+
Sbjct: 323 D-----ILLVVIVTILISM-KFNLKHRYGISIIGDFSMDNFDELKNPLTRP--RRKLIPD 374

Query: 412 L-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFS 467
           L  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A PA G + 
Sbjct: 375 LFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYG 434

Query: 468 RSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTT 527
           RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL      
Sbjct: 435 RSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGD 494

Query: 528 WNF-WKMNPL-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRV 583
             F  +     +   F VT   T+F SIE GI     +S   +I   A    + L RV
Sbjct: 495 IKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARV 552

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 120/477 (25%), Positives = 197/477 (41%), Gaps = 47/477 (9%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y F+    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
              +   + +GP + +SL   + +  +T  + D  S I    I+  +  + G I    G 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISIVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 302 ------TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQAS 355
                  K  A+F      +L V +                   +L K  K   F+    
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVMRLL---------------KKKLMKRHKSAVFFPDIL 315

Query: 356 RNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP-PGLMSKLGPNL-P 413
              +++IV   I   ++    K    ISI+G     +        P      KL P+L  
Sbjct: 316 ---LVVIVTILISMKLSL---KQRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFS 367

Query: 414 ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
           AS+IV +L   E    SKS G   +  V  ++EL+A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF 530
           + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL        F
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 531 WKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEV 585
                   +   F VT  +T+F SIE GI    C  C   IL +   + K   R+++
Sbjct: 488 HLQCGGYSELFVFAVTFGVTIFYSIESGI----CIGCVYSILNIIKHSAK--SRIQI 538

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  112 bits (281), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 130/527 (24%), Positives = 218/527 (41%), Gaps = 46/527 (8%)

Query: 76  FNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFS 135
           F+P+  ++ D+ ++Q    T  +++ YD    + LT      Y     P + WLP YN S
Sbjct: 73  FDPN--TMDDHDMNQNITITHRIRKTYDDG-ENELTFYQLIQYY---LPCLRWLPIYNCS 126

Query: 136 WFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPV 194
            F +D I+GI++    +P ++SYA  +A +    GLYS  I    Y    +   + +GP 
Sbjct: 127 DFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYGILGSVPPMIVGPE 186

Query: 195 AVMSLQTAKVIADVTAKY---PDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELI 251
             +SL   + +  +   Y      D  I+   I+ T+  L G++    G LRLGFL  ++
Sbjct: 187 GAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFICGLLRLGFLGSVL 246

Query: 252 SLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIE----TLKHLPDT--KLD 305
           S   +  F++     ++   +   M  N ++      Y    E     +K+ P+   K  
Sbjct: 247 SKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHTAFEKIMFIIKYAPNNFHKPT 306

Query: 306 AVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFT 365
            V  ++   +LY  ++           +Y  K+  L        F  +      I+IV  
Sbjct: 307 TVLSVVCFSILYFVRYC--------KKKYIIKHKSL-------IFLPE------ILIVVI 345

Query: 366 CIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMS---KLGP---NLPASIIVL 419
             G        K    ISI+G V S    +   ++   L S   +L P   N   +I  L
Sbjct: 346 STGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELFPILMNTGFAIAAL 405

Query: 420 -LLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVR 478
              E    SKS G   +  +  ++EL+A+GV NL  +     P+ G + RS + A    +
Sbjct: 406 GFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAK 465

Query: 479 TPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL- 536
           T +SG+  G   +L +  L     +IP   LS +       L+        F W+     
Sbjct: 466 TVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEAPGEVKFHWRCKGYN 525

Query: 537 DFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRV 583
           + I F +T   T+F S+E GI     +S   +I   A    + LGR+
Sbjct: 526 ELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQILGRI 572

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 124/474 (26%), Positives = 201/474 (42%), Gaps = 37/474 (7%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +W+P Y +S F  DL+AGIT+    +P ++SYA  +A +    GLYS     + Y+
Sbjct: 82  LPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYA 141

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL    V+     K    +  I+   I+  +  + G+     G 
Sbjct: 142 IFGSVPQMIVGPESAISL----VVGQAVEKLRAHNHEISTMSISVLVTFISGMFLFVFGI 197

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK-HLP 300
            R GFL  ++S   + GF++          V  +M  NSL++       ++      H P
Sbjct: 198 CRFGFLGNVLSRALLRGFIS---------SVGVVMIVNSLISELKLHKLLLETKGHFHTP 248

Query: 301 DTKLDAVFGLIPL---FLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRN 357
             K+  +    P        V    C  +   +  R   K  +L +  +W  F  +    
Sbjct: 249 FQKIRFIIKYAPANYHIPTAVLSLTC--FIILVTARVIKK--KLMRRRRWPVFVPEILIL 304

Query: 358 GIIIIVFTCIGWAITRGKSKSERPISILGSVPS-GLKEVGVFHVPPGLMSKLGPNLP-AS 415
            I  I+ +       + K K    ISI+G   + GL  V  ++       +L PNL  A 
Sbjct: 305 IITTIILS------HKFKFKKHYEISIVGDFDTDGL--VNFYNPISKSNRELAPNLMNAG 356

Query: 416 IIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALK 472
            IV +L   E    +KS G   ++ +  ++EL+A+G  NL  +   A PA G + RS + 
Sbjct: 357 FIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKIN 416

Query: 473 AKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNF 530
           +    +T +SG+  G  VLL +        YIP   LS +       LL  A     ++F
Sbjct: 417 SFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHF 476

Query: 531 WKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVE 584
                 + + F VTVL T F S+E G+     +S   +I   A    + L RVE
Sbjct: 477 NSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQILARVE 530

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 120/505 (23%), Positives = 213/505 (42%), Gaps = 41/505 (8%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P ++W+PHY++  F  DL+AGI++    +P ++SYA  +A +    GLYS  I    Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL    V+   T K+   DS I+   I   +  + G++   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           +RLGFL  ++S   + GF++     ++   +   +  N  +   A  Y   +  +  L  
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFR 249

Query: 302 ------TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQAS 355
                  K  A+  LI   +L   +        +L +RY           ++  F  +  
Sbjct: 250 YASEYYHKPTAILSLICFLVLISTRIA----KKKLMNRY-----------RFLIFVPE-- 292

Query: 356 RNGIIIIVFTCIGWAITRGKSKSERPISILGSVPS-GLKEVG--VFHVPPGLMSKLGPNL 412
              I+++V   I  ++ +   K    IS +G   + G   +G  + +    L S L    
Sbjct: 293 ---ILLVVSVTILLSL-KYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSSLWNEG 348

Query: 413 PASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALK 472
            A  ++   E    SKS G   +     ++ELIA+G  N++G+ F A P+ G + RS + 
Sbjct: 349 LAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVN 408

Query: 473 AKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWK 532
                +T +SG   G   LL    L     Y P   LS +       LL    +   F  
Sbjct: 409 VFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHI 468

Query: 533 MNP--LDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTD 590
                 +   F +T + T+  S+E G+     +S  +++   A    + L ++E +   D
Sbjct: 469 HCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLEGS---D 525

Query: 591 AYVRPDSDVVSYVSENNNGISTLED 615
            +V  D  + +Y   +   I TLE 
Sbjct: 526 EFVNVDDYIKNYNGRDFENI-TLEQ 549

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  109 bits (273), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 128/557 (22%), Positives = 225/557 (40%), Gaps = 76/557 (13%)

Query: 105 SIRSHLTVK-------GACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMS 157
           S+RS+  +K          SY+    PI+ W P Y+      DL+AGI++    +P ++S
Sbjct: 23  SLRSYRAIKVDQPLKLNTKSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAIS 82

Query: 158 YAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDS 217
            + +A +    GL+S  I    Y+ F +   + +GP  V+SL   +     + K    DS
Sbjct: 83  LSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSHK--SVDS 140

Query: 218 AITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMG 277
            +T  VIA T     G I  ++G  R+GF+   IS   + GF+   A  +L  ++   + 
Sbjct: 141 LVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQ 196

Query: 278 YNSLVNTRAATYKVVIET-------LKHLPD------TKLDAVFGLIPLFLLYVWKWWCG 324
              L     A       T       LK+ P+       KL  +   I +   YV K++  
Sbjct: 197 LEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKKYFTE 256

Query: 325 TYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISI 384
             G +L   +      +   I  +Y+                  W+ T G         I
Sbjct: 257 KRGSKLCRFFPDLLLVVAGFIYLSYYN----------------DWSSTMGTR-------I 293

Query: 385 LGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLL---EHIAISKSFGRINDYKVVPD 441
           +G++P        F VP     +       S +V +L   +     K+ G   D  +  +
Sbjct: 294 IGNLPPNKNH---FKVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSN 350

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           +EL+++G+ N++ + F+A PA G + RS L   C+ +TP++G+      +  +  + GAF
Sbjct: 351 RELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAF 410

Query: 502 FYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIYF 559
            Y+P   L+ +I +   +LL    +   F W +    + + F+  V+ T+  S + G+  
Sbjct: 411 HYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVSI 470

Query: 560 AMCWSCAMLILKVAFPAGKFLGR-------------------VEVAEVTDAYVRPDSDVV 600
            +  +   L+        + LGR                   +E  E T     P+  + 
Sbjct: 471 GVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEIEKTMVIKIPEPLIF 530

Query: 601 SYVSENNNGISTLEDGG 617
           S VS+    +S LE  G
Sbjct: 531 SNVSDLKKRLSRLEKYG 547

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 145/573 (25%), Positives = 241/573 (42%), Gaps = 69/573 (12%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +W+P Y +    +D +AGI++    +P ++SYA  +A +    GLYS  I  + Y+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL    V+          DSA+    I+  L  + G     +G 
Sbjct: 149 VFGSVPQMIVGPESAISL----VVGQSVELLKSHDSALEIINISVVLTFISGAALLILGI 204

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK---- 297
           LRLGFL  ++S + + GF++     ++   +   +  N L+           E ++    
Sbjct: 205 LRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFLIK 264

Query: 298 ------HLPDTKLDAVFGLIPLFLLYVWK-WWCGTYGPRLNDRYNSKNPRLHKIIKWTYF 350
                 H P   L A+   + LF + + K  W   +      R+ +  P +  ++  + +
Sbjct: 265 YAPTNYHKPTALLSAI-AFVTLFSIRLLKKRWMAKH------RWLAFIPEILMVVIISIY 317

Query: 351 YAQA----SRNGIIIIVFTCIGWAITRGKSKSERPISILG-SVPSGLKEVGVFHVPPGLM 405
            +       + GI+I+     G   T    K + PIS     +   L   GV      L+
Sbjct: 318 LSATWEFKKQYGILIV-----GDFNTHAIDKLKNPISKENRKIMPQLLNTGV------LI 366

Query: 406 SKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGS 465
           S LG            E +  SKS G   D  +  ++EL+A+G  N++ + F A P+ G 
Sbjct: 367 SLLG----------FFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGG 416

Query: 466 FSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--AS 523
           + RS + A    +T +SG+F GS  L+ +  L     YIP   LS +       LL  A 
Sbjct: 417 YGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAP 476

Query: 524 YQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGK----F 579
            +  ++F      +   F +TVL T+  S+E GI    C  C   I+ +   + K     
Sbjct: 477 SELKFHFRCKGYDELFVFAITVLATLLYSVEMGI----CIGCGYSIISIVKHSAKSRIQI 532

Query: 580 LGRV----EVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKI 635
           LGRV    E A + D Y+  DSD +  +  N   +  +E G    K       TN+    
Sbjct: 533 LGRVQGTREFANI-DEYL--DSDPIGDIETNKFVLEEIE-GCLIVKIPEPLTFTNTDDLK 588

Query: 636 ETNVQTKGFDSPSSSISQP--RIKYHTKWIPFD 666
           E   + + F S  +    P  R K +TK + FD
Sbjct: 589 ERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFD 621

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 119/482 (24%), Positives = 190/482 (39%), Gaps = 32/482 (6%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y+ S    D IAG ++    +P +MSY+  VA +P   GL +     + Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL    V+     K    D ++    +   L  + G I    G 
Sbjct: 130 VFGSVPHMIVGPESAISL----VVGQAIEKQMKHDKSLDVVNLCLILTFISGAILFCFGI 185

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           +R G+L  ++S   + GF++     ++   +   +    + N     Y        H P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPF 237

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIII 361
            KL  +F   P    +V           +         RL ++ K   F  +      I+
Sbjct: 238 QKLIFLFHYAP-GNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVPE------IL 290

Query: 362 IVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGL--MSKLGPNLPASIIVL 419
           IV   +         K    I I+G +  G  +   F  P     +S       A  +V 
Sbjct: 291 IVVALVTLGSYHFSFKLRYNIDIVGDIEVG--DTSKFRNPLSKKNLSLFSELFHAGFMVA 348

Query: 420 LL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 476
           LL   E    SKS G   +  V  ++EL+A+G  NL+G+ F A P+ G + RS + A   
Sbjct: 349 LLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSG 408

Query: 477 VRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNFWKMN 534
             T +SG+F G    +    L  A  +IP   LS +       L   A     ++F    
Sbjct: 409 AATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRG 468

Query: 535 PLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVR 594
             + + F +TVL T F S+E GI     +S   +I        + L RV     TD +V 
Sbjct: 469 YNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRRV---SGTDQFVN 525

Query: 595 PD 596
            D
Sbjct: 526 AD 527

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 115/477 (24%), Positives = 192/477 (40%), Gaps = 47/477 (9%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y F+    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
              +   + +GP + +SL   + +  +T  + D  S I    I+  +  + G I    G 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISVVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLID 270

Query: 302 ------TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIK--WTYFYAQ 353
                  K  A+F    L +L+  +                 +  L  I+    +  ++ 
Sbjct: 271 YAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPDILLVVIVAIFISMKFSL 330

Query: 354 ASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLP 413
             R GI     T IG        K + P +               H    L+  L     
Sbjct: 331 KHRYGI-----TIIGDFSMDNFDKLKNPFT---------------HSRRKLIPDL---FS 367

Query: 414 ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
           AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSK 427

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF 530
           + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL        F
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 531 WKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEV 585
                   +   F VT  +T+  SIE GI    C  C   IL +   + K   R+++
Sbjct: 488 HLRCGGYSELFVFAVTFGVTILCSIEAGI----CIGCVYSILNIIKHSAK--SRIQI 538

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 111/468 (23%), Positives = 191/468 (40%), Gaps = 55/468 (11%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y+   F  D IAG+++    +P +MSYA  +A +    GLY+     + Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + I  +       D +++   +   +  + G++    G 
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMIRH----DPSLSSLDLCVIITFISGVVLFTFGV 212

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK---- 297
            R GFL  ++S   + GF++     ++   +   +    + +   + Y    E +     
Sbjct: 213 FRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLIK 272

Query: 298 ------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFY 351
                 HLP + L     LI + L  + K     +                   +   F+
Sbjct: 273 YAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRF-------------------RSLVFF 313

Query: 352 AQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSK---- 407
            +     I+++V T I ++      K    I ++G +     E  VF      +SK    
Sbjct: 314 PE-----ILLVVVTVIFFSYN-FDLKHRYNIEVVGDI-----EASVFDKLRNPLSKNKRP 362

Query: 408 -LGPNLPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPAT 463
             G    A  +V +L   E    SKS G   D  V  ++EL+A+G  NL+G+ F A P+ 
Sbjct: 363 FYGDLFSAGFMVAMLGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSF 422

Query: 464 GSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL-- 521
           G + RS + A    +T +SG   G+  +  +  L     YIP   LS +       LL  
Sbjct: 423 GGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEE 482

Query: 522 ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLI 569
           A     ++       + I FI+TVL T F S+E GI     +S   +I
Sbjct: 483 APADLRFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVI 530

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 129/521 (24%), Positives = 210/521 (40%), Gaps = 46/521 (8%)

Query: 79  SDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFT 138
           +DV     S    + +TVS  E         +T+K    Y     P  +W+P Y+     
Sbjct: 39  NDVQSTSTSTVGLKFSTVSFPE------NERVTLKDTIPYY---LPCFSWIPTYSVKKCM 89

Query: 139 ADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVM 197
            D IAG+++    +P +MSYA  VA +P   GLYS       Y+   +   + +GP + +
Sbjct: 90  GDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYTVLGSVPQMIVGPESAI 149

Query: 198 SLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVA 257
           SL   + I    ++    D  +    I   +  + G++    G LRLGFL  ++S   + 
Sbjct: 150 SLILGQAIEARLSE----DPKLKAINICLVITFISGLVLLTGGLLRLGFLENVLSRALLR 205

Query: 258 GFMTGSAFNILWGQVPALMGYNSLVNTRAATY----KVVIETLKHLPDT--KLDAVFGLI 311
           GF++G    ++   +   +  N +  TR   Y    + V+  +K+ P+   K  A+  L+
Sbjct: 206 GFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKPTAILSLV 265

Query: 312 PLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAI 371
              +L   + +   YG +                KW            I++V     +  
Sbjct: 266 AFVILMSLRIFKKRYGKKF---------------KWLVLLPD------ILVVVALSIFVS 304

Query: 372 TRGKSKSERPISILGSVPS-GLKEVG--VFHVPPGLMSKLGPNLPASIIVLLLEHIAISK 428
            +   KS   I I+  +P   +K +     +V       L        ++   E    SK
Sbjct: 305 YKMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFMVAMLGFFESATASK 364

Query: 429 SFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGS 488
           S G   +  +  ++ELIA+G  N++G+ F   PA G + RS + A    +T +SG F G 
Sbjct: 365 SLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGL 424

Query: 489 CVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVL 546
             L  +  L     YIP   LS +       LL        F W+     +   F VT+L
Sbjct: 425 VTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLL 484

Query: 547 ITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAE 587
            T+F S+E GIY     S   +I   A    + LGRV   E
Sbjct: 485 ATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTE 525

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 101/446 (22%), Positives = 176/446 (39%), Gaps = 48/446 (10%)

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA--DVTAK 211
            S+S + +A LP   GLYS  I    Y    T     +GP  V+SL   +        + 
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 212 YPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQ 271
            P    A+ G V         G I  A+G  R+GF+   +S   + GF++  A  +L  +
Sbjct: 61  EPLSTVAVIGCV--------SGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITE 112

Query: 272 VPAL----------MGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKW 321
           +             +    +  T    ++ ++E      DT              + W  
Sbjct: 113 LLPELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNL 158

Query: 322 WCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERP 381
              T+   +  RY  ++       K   F+ +     I+I+V   I  + T+ K    + 
Sbjct: 159 SLFTFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQ-KWSELKG 212

Query: 382 ISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLL---EHIAISKSFGRINDYKV 438
           I I+G +P     +    VP    S+       S ++ +L   E   + KS    ++   
Sbjct: 213 IKIIGDIPPNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDA 269

Query: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498
             ++EL+++GV NL+ + F+A PA G + RS +   C  +T  SG+F     ++ +  L 
Sbjct: 270 SSNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLM 329

Query: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDG 556
            AF ++P   L+ +I      LL        F W +    +   FI+ V+ T+  S + G
Sbjct: 330 NAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFG 389

Query: 557 IYFAMCWSCAMLILKVAFPAGKFLGR 582
           +   MC +   L+        + LGR
Sbjct: 390 VTMGMCLTMIRLLKHSTRSRVQILGR 415

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 79/175 (45%), Gaps = 5/175 (2%)

Query: 414 ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
           A  +V LL   E    SKS G   D  +  ++EL+A+G  NL+G+ F A P+ G + RS 
Sbjct: 358 AGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSK 417

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTW 528
           + A     T +SG+F G   L+    L  A  +IP   LS +       L   A     +
Sbjct: 418 INAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKF 477

Query: 529 NFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRV 583
           +F      + + F +TVL T F S+E GI     +S    I        + LGR+
Sbjct: 478 HFRCRGYNELLTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRI 532

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 78/162 (48%), Gaps = 14/162 (8%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y+ + F  DLIAG ++    +P +MSY+  VA +P   GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + I  +T      D+++    +   L  + G I  + G 
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKH----DASLNVTNLCVVLTFISGSILFSFGL 200

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVN 283
           +R GFL  ++S   + GF++          V  +M  NSL++
Sbjct: 201 MRFGFLDSVLSRALLRGFISA---------VGLIMVINSLIS 233

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 87/185 (47%), Gaps = 12/185 (6%)

Query: 407 KLGPNL-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPA 462
           KL P+L  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 463 TGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLA 522
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL 
Sbjct: 420 FGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLE 479

Query: 523 SYQTTWNFWKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFL 580
              +   F        +   F VT  +T+F SIE GI    C  C   IL +   + K  
Sbjct: 480 EVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGI----CIGCVYSILNIIKHSAK-- 533

Query: 581 GRVEV 585
            R+++
Sbjct: 534 SRIQI 538

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 82/180 (45%), Gaps = 5/180 (2%)

Query: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYSYS 181
            P   WLP Y FS    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + +  +T  + D  S I    I+  +  + G I    G 
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISIVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 270

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 75/155 (48%), Gaps = 2/155 (1%)

Query: 417 IVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 476
           I+ L E     KS     D  V  ++EL+++G+ N++G+ F++ PA G + RS L   C 
Sbjct: 326 ILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCG 385

Query: 477 VRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNP 535
            +TP++G+F     +  +  L G F Y+P   L+ +I     +LL        F W ++ 
Sbjct: 386 AQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSG 445

Query: 536 L-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLI 569
             + I F   VL T+  S + G+   +  +   L+
Sbjct: 446 YQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLL 480

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 83/175 (47%), Gaps = 7/175 (4%)

Query: 94  TTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVP 153
           +T+SL+ Y    +   L      SY+    PI+ WLP Y++     D++AG+T+    +P
Sbjct: 20  STMSLRSYRAIKVDKPLR-HDTKSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIP 78

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP 213
            ++S   +A +    GLY+  I    Y+ F +   + +GP  V SL   +   D  A + 
Sbjct: 79  LAISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASLVVGQS-CDAWA-HK 136

Query: 214 DGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNIL 268
             +  +T  VI      + G++  A+G  RLGF+   IS   + GF +  A  +L
Sbjct: 137 SLEPLMTVAVIGC----ISGVLVFAMGIFRLGFIDNAISKAFLKGFTSALAVVML 187

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 73/385 (18%), Positives = 149/385 (38%), Gaps = 68/385 (17%)

Query: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP         N+PA         +A+S +   ++ Y V  D+ELIA G SNL+  
Sbjct: 538 GILHVPI--------NVPA---------LAMSLN---VDKYDV--DKELIAHGYSNLISG 575

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
           F  +      ++ S L  +    +P++G+       + +        +IP   + ++I  
Sbjct: 576 FLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFL 635

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLIL---K 571
              +L+  +   TW   K+ P +++   + V+         GI   +  +C   ++   +
Sbjct: 636 LGYELIQEAVIDTWG--KLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNSTQ 693

Query: 572 VAFPAGKFLGRVEVAEVTDAYVRPD--------------SDVVSY---VSENNNGISTLE 614
           +    G++ G+V  + V   Y++                 +++ +   +S      S LE
Sbjct: 694 LQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLLE 753

Query: 615 DGGEDDKESSTKYVTNSSKKIETN----VQTKGFDSPSSSISQPRIKYHTKWIPFDHKYT 670
               D  +   KY+    K I          +GF+     + + RI          H   
Sbjct: 754 ICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKERI----------HLII 803

Query: 671 RELNPDVQILPPPDGVLVYRLSESYTYLN-----CSRHYNIITEEVKKVTRRGQLIRHRK 725
             ++ + QI    D V ++   E ++ LN     C   + +  + ++  TR  +L + +K
Sbjct: 804 SSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRARKLAQLKK 863

Query: 726 KSDR----PWNDPGPWEAPAFLKNL 746
             +R    P N P   +  + ++N+
Sbjct: 864 SQNRMSKLPVNTPRNHQFVSEVRNI 888

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 86/203 (42%), Gaps = 28/203 (13%)

Query: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G+SNL+  
Sbjct: 484 GILHVPI--------NVPA---------LAMSV---QMDKYDV--DKELIAHGLSNLVSG 521

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
            F +      ++ S L  +    +P +G       ++ +        +IP   + ++I  
Sbjct: 522 MFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFL 581

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLIL---K 571
              +LL  +   TW+  K+   +++  +V VL         GI   +  +C   ++   K
Sbjct: 582 LGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSK 639

Query: 572 VAFPAGKFLGRVEVAEVTDAYVR 594
           +    G+F G+V  + V    ++
Sbjct: 640 LQTINGEFSGKVAKSTVNRDLIQ 662

>KLTH0G15752g Chr7 (1373153..1376047) [2895 bp, 964 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 964

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 6/169 (3%)

Query: 267 ILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           I W    A++G+ S +N    T K  +E +K LP   L  + GL+P   L +       +
Sbjct: 400 IFWAIPVAVVGFISNINFLIETLKF-LEFIKKLPKVLLGLITGLLPTVALAILMSLVPIF 458

Query: 327 GPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILG 386
             +L       + +  ++    ++YA       + IVFTC   A++  KS  + P S + 
Sbjct: 459 IKKLGSISGCMSIQEQELYCQAWYYAFNVVQ--VFIVFTCASSAVSTIKSIMDDPSSAMT 516

Query: 387 SVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRIND 435
            + + L +   F++   ++  L     +S  +  L ++ +S+  GRI D
Sbjct: 517 LLAANLPKSSNFYINYYILQGLS---FSSGTLAQLVNLILSRFLGRILD 562

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 86/217 (39%), Gaps = 30/217 (13%)

Query: 384 ILGSVPS--GLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441
           +L  +P+   L   G+ HVP         N+PA  + L            +++ Y V  D
Sbjct: 467 VLQQIPTMMALTFFGILHVPI--------NVPALAMSL------------QMDKYDV--D 504

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           +ELIA G SN       +      ++ S L  +    +P +G    +  +  +       
Sbjct: 505 RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGPVII 564

Query: 502 FYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560
            +IP   + ++I     +LL  +   TWN  K+N  +++  ++ V          GI   
Sbjct: 565 SFIPICIVGSLIFLLGYELLVEALVDTWN--KLNRFEYLTVVIIVFTMGIFDFVLGIIVG 622

Query: 561 MCWSCAMLIL---KVAFPAGKFLGRVEVAEVTDAYVR 594
           +  +C   ++   K+    G++ G V  + V   YV+
Sbjct: 623 ILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQ 659

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1150

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 89/214 (41%), Gaps = 30/214 (14%)

Query: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G SNL+  
Sbjct: 606 GILHVPI--------NVPA---------LAMSV---QMDKYDV--DKELIAHGYSNLISG 643

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
            F +      ++ S L  +    T  +GL       + L+       +IP   + ++I  
Sbjct: 644 LFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFL 703

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLIL---K 571
              +L+  +   TW   K+   ++I  ++ V          GI   +  +C   ++   K
Sbjct: 704 LGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTK 761

Query: 572 VAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSE 605
           +    G+F G V  + V   YV+  S  +S ++E
Sbjct: 762 LQTVNGEFNGTVAKSTVYRDYVQ--SQFLSGIAE 793

>KAFR0L01945 Chr12 complement(367964..368413) [450 bp, 149 aa] {ON}
          Length = 149

 Score = 33.1 bits (74), Expect = 1.3,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 35  DQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEET 94
           D+  +  ++D FND+ +E+   AK +  N SK    S  DYFN +    +++S   F+  
Sbjct: 17  DKRTSISSDDYFNDEKIENEDEAKSHLKNYSKAPSISSADYFNDN----WNHSNDSFQNH 72

Query: 95  TVSLKEY 101
           T++  ++
Sbjct: 73  TLNNNDF 79

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON}
           similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1010

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 34/219 (15%)

Query: 384 ILGSVPS--GLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441
           +L  VP+   L   G+ HVP         N+PA  + + L+ + +              D
Sbjct: 472 VLKQVPTMLALTFFGILHVPI--------NVPALAMSIGLDKLDV--------------D 509

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           +ELIA G SN L     +      ++ S L  K      L+GL   +     +       
Sbjct: 510 KELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIV 569

Query: 502 FYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFA-----SIED 555
            YIP   + ++I     +LL  +   TW   K+N  ++   +V ++ T+ A      I  
Sbjct: 570 AYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYAT-VVAIVFTMGAFDFVLGIIV 626

Query: 556 GIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVR 594
           GI  A C+S  +   K+    G+F G+V  + V   Y++
Sbjct: 627 GILIA-CFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQ 664

>Smik_9.232 Chr9 (381886..383796) [1911 bp, 636 aa] {ON} YIR028W
           (REAL)
          Length = 636

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 593 VRPDSDVVSYVSENNNGISTLEDG--GEDDKESSTKYVTNSS---KKIETNVQTKGFDS 646
           V+P + +VSY + N N +  +EDG   ++   S+  YV NSS    +I    +TK F S
Sbjct: 18  VQPSTSIVSYTNNNENDVIDVEDGRFNKNKNISTNVYVDNSSIEESEITPLPETKSFWS 76

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,676,421
Number of extensions: 4521155
Number of successful extensions: 17354
Number of sequences better than 10.0: 73
Number of HSP's gapped: 17721
Number of HSP's successfully gapped: 90
Length of query: 893
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 774
Effective length of database: 39,836,145
Effective search space: 30833176230
Effective search space used: 30833176230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)