Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR091W (GEP5)8.266ON29329315640.0
Smik_12.1508.266ON29229112391e-173
Skud_12.1598.266ON29429311821e-164
Suva_10.1758.266ON29929711341e-157
TDEL0F039308.266ON2802813645e-41
KAFR0B027408.266ON2562902955e-31
NDAI0B020108.266ON2812872881e-29
NCAS0B050408.266ON2732972721e-27
SAKL0H16940g8.266ON3032652696e-27
ZYRO0C01562g8.266ON2772132521e-24
Kwal_56.237778.266ON2672482451e-23
KLTH0G13596g8.266ON2672242352e-22
Kpol_392.48.266ON2812832125e-19
AGR082C8.266ON2662721818e-15
Ecym_43048.266ON2892901811e-14
KLLA0F19228g8.266ON3052261545e-11
KNAG0G020608.266ON2862911501e-10
TPHA0J007608.266ON24976940.002
CAGL0L12320g8.266ON27838770.24
KLTH0H14982gna 1ON349144760.40
CAGL0H04609g7.418ON276376760.61
TDEL0C035707.494ON1113139702.5
KAFR0B03240singletonON25333665.7
KNAG0A015105.90ON768114669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR091W
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   607   0.0  
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   481   e-173
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...   459   e-164
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   441   e-157
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   144   5e-41
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   118   5e-31
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   115   1e-29
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   109   1e-27
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   108   6e-27
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   101   1e-24
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    99   1e-23
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    95   2e-22
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    86   5e-19
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    74   8e-15
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    74   1e-14
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    64   5e-11
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    62   1e-10
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    41   0.002
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    34   0.24 
KLTH0H14982g Chr8 (1298040..1299089) [1050 bp, 349 aa] {ON} cons...    34   0.40 
CAGL0H04609g Chr8 complement(433499..441790) [8292 bp, 2763 aa] ...    34   0.61 
TDEL0C03570 Chr3 (623664..627005) [3342 bp, 1113 aa] {ON} Anc_7....    32   2.5  
KAFR0B03240 Chr2 (669954..670715) [762 bp, 253 aa] {ON}                30   5.7  
KNAG0A01510 Chr1 (64382..66688) [2307 bp, 768 aa] {ON} Anc_5.90 ...    30   9.4  

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120
           DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK
Sbjct: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120

Query: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKF 180
           LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKF
Sbjct: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKF 180

Query: 181 LIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSP 240
           LIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSP
Sbjct: 181 LIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSP 240

Query: 241 ENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRWEVD 293
           ENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRWEVD
Sbjct: 241 ENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRWEVD 293

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  481 bits (1239), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 229/291 (78%), Positives = 255/291 (87%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           MAS+VN LLLPVI+S PLHQITK AL TTLT  QSDYKFKEIAVPLTK LQ++EKAQRRQ
Sbjct: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120
           DLR +LKALESIIYQTHF+WNNP PRHA LFQKHYHFLLTHWPFENHR LVDSIA + GK
Sbjct: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120

Query: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKF 180
           LNS  S++ WLKADW TLF VKNPWVQTPP+   LS TDLD FTPER FL+NSLGN YKF
Sbjct: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKF 180

Query: 181 LIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSP 240
           LIANSHLSYNHKKYPSPGVQIP+RNALGEVSP KQI++LF+RQL++IY SLF ENPPLSP
Sbjct: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240

Query: 241 ENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRWE 291
            N++AL A+F D+T++RR +RLYMRACARAYT TNADST EPL F CT+W+
Sbjct: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWD 291

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score =  459 bits (1182), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 217/293 (74%), Positives = 249/293 (84%), Gaps = 3/293 (1%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           M S++  +LLP IES PLH+ITK ALTTTL   QSDYKFKEIAVPLT+SLQ+YEKAQRRQ
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120
           DLR SLKALESII+QTHFQWNNP PRHA LFQKH++FLL+HWPFENHR LVDSI  +NGK
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120

Query: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPP---SLMRLSGTDLDTFTPERIFLINSLGNH 177
           LNS +S+  WLKADW TLF VKN WVQTPP   S     G +LD FTPER FL+NSLGNH
Sbjct: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180

Query: 178 YKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPP 237
           YKFL+ANSHLSYNHKKYP P VQIP+RNALGE+S +KQIA+LF+RQL+ IY SLF+ENPP
Sbjct: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240

Query: 238 LSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRW 290
           LS +NELAL AVF+D++++RR +RLYMRACARAYTT N+DST EPL F CT+W
Sbjct: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQW 293

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  441 bits (1134), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 237/297 (79%), Gaps = 7/297 (2%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           M SQ N+LLLP I+S PLHQITK ALTT LT   SD+KFKEIAVPLT+SLQ+YEKAQR Q
Sbjct: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120
           DLR SLKALESI+YQTHFQWNNP PRHAHLFQKHYHFLL+HWPFENHR LVDSI   NGK
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120

Query: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRL-------SGTDLDTFTPERIFLINS 173
           L S +S+  WLKADW TLF VKNPWV+TPP            S  +LD FT ER FL+ S
Sbjct: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKS 180

Query: 174 LGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFI 233
           LGNHYKFL+ NSHLSYNHKKYPSP VQIP+RNALGE+SP KQI++LFARQL+ IY SLF+
Sbjct: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240

Query: 234 ENPPLSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRW 290
           ENPPLS  NELAL  VF D T+ERR  RLYMRACARAYT  NADS  EPL F CT W
Sbjct: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  144 bits (364), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 140/281 (49%), Gaps = 24/281 (8%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           M  Q+   LL  +E  PLH  T   L   L   +     K + +PL K +   E + R +
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDE----LKTVIIPLAKLVSNLE-SSRAE 55

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120
             R  +KALESIIY THF W +PLP H  +FQ HY  +L HWP+E HR +     +N  K
Sbjct: 56  TQR--IKALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSI-----LNMEK 108

Query: 121 LNSTSSRSVWLKADWITLFNV---KNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNH 177
             STS R  W  +    L      KNPW++      +L+         +R  L +S+ +H
Sbjct: 109 PRSTSLRYRWEDSSKTVLSMAEYSKNPWIEDNILSKKLTII-------QRDLLFHSVFSH 161

Query: 178 YKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPP 237
           Y FL AN  L  N +  P P V+IP+R  LG      +I  LF  +++H Y+ L IENP 
Sbjct: 162 YLFLKANPRLCNNGRNLPIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRILAIENPV 220

Query: 238 LSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADS 278
           LS  +E  L+ +  D +  R+ RRLY  +C RAY     D 
Sbjct: 221 LSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDG 260

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  118 bits (295), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 134/290 (46%), Gaps = 45/290 (15%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           +  +V   +   IE  PLHQ T + L  TL  K++D     +A+PL + +  YE   +  
Sbjct: 12  VTKEVRDKITNAIEGLPLHQKTLLQLQDTL--KRND----ALAIPLLRDVVSYETTGKS- 64

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120
                 K LESIIY+ +FQW N +P H       Y  L ++WP E H      I   N +
Sbjct: 65  ------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERH------IKFKNAE 112

Query: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKF 180
             + S R+ W                      MR   T +D  T + +  I  + NH+++
Sbjct: 113 PEAISLRNAW----------------------MRNKATAVDLSTSDGV--IKPILNHFRY 148

Query: 181 LIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSP 240
           L  N       KK   P +++P+ N  G   P  ++  L  ++++H+ KSL  +NP LSP
Sbjct: 149 LRVNED-RLCKKKVGLPILEVPL-NVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSP 206

Query: 241 ENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRW 290
           + E  L ++  D    R L+R+Y+R+C+RAYT  +    +  + FH   W
Sbjct: 207 KLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSSNITFHIIDW 256

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  115 bits (288), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 137/287 (47%), Gaps = 36/287 (12%)

Query: 1   MASQVNALLLPVIESTPLH-----QITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEK 55
           + S++   LL  +++ PLH     Q+ +  LT  + + +S   FK   +PL   +  YEK
Sbjct: 4   LNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKS---FK---IPLLTLINSYEK 57

Query: 56  AQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIA 115
           AQ     + S K LESIIY T+F+W N L  H   FQ+ Y  LLT WP   H  +     
Sbjct: 58  AQASGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----- 112

Query: 116 VNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERI---FLIN 172
             + K NS       +   W    N KN   +    L  L+ T   +  P++     +  
Sbjct: 113 --DSKKNS-------IILTWNKSSNSKNMLREL---LSHLNYT--QSLVPQKKDFQVIFK 158

Query: 173 SLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLF 232
            +  HY FL  N  L  N K+ PSP V+IP+ NA+G   P K+I  L   +++  +  L 
Sbjct: 159 KIYQHYIFLSLNPSLCSNGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYLA 217

Query: 233 IENPPLSPENELALTAVFYDETV--ERRLRRLYMRACARAYTTTNAD 277
           I NP L+ ENE  L  +    +    R+LR+LY RAC+ +Y   N D
Sbjct: 218 ITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNED 264

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  109 bits (272), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 131/297 (44%), Gaps = 46/297 (15%)

Query: 1   MASQVNALLLPVIESTPLHQITKVAL---TTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQ 57
           M   V   LL  + + PLH+ T   L     T   K + + FK   VPL + L  YE+  
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFK---VPLLQLLCKYERYN 57

Query: 58  RRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDL---VDSI 114
            ++D R   K LESI Y T+F WNNP+P H  +FQK+   L  +WP   HR +    DSI
Sbjct: 58  IQEDKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSI 117

Query: 115 AVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTP----ERIFL 170
            V                            W ++      L GT ++   P    E + +
Sbjct: 118 IVQ---------------------------WAKSNNGDALLKGT-MNHIQPGASAEELLM 149

Query: 171 INSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKS 230
              +  HY FL  N+ ++ N K+   P V +P+ N++GE  P  ++  LF +++S    +
Sbjct: 150 FKKIFQHYIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANA 208

Query: 231 LFIENPPLSPENELALTAVFYD--ETVERRLRRLYMRACARAYTTTNADSTTEPLMF 285
           L   NP L+ EN   L  +     E   R LRRLY RA   A+    A  + E + F
Sbjct: 209 LCALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVI--AGESPESIQF 263

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  108 bits (269), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 124/265 (46%), Gaps = 28/265 (10%)

Query: 41  EIAVPLTKSLQLYEKAQRRQDLRAS--LKALESIIYQTHFQWNNPLPRHAHLFQKHYHFL 98
           E  V L  S  L    Q+  D +A+   K+LE I+Y T+F WNN  P H   F+++YH L
Sbjct: 25  EGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDL 84

Query: 99  LTHWPFENHRDLV-----DSIAV------NNGKLNSTS--SRSVWLKAD---WITLFNVK 142
             HWP+E HRDL+     + +++      NN K+ S+    R+ W + D    +  FNV 
Sbjct: 85  REHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVN 144

Query: 143 NPWVQTPPSLMRLSGTDLDTFTP----ERIFLINSLGNHYKFLIANSHLSYNHKKYPSPG 198
                      +  G+ L T       E   L + +  HY FL  N  L    KK P P 
Sbjct: 145 KILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPI 204

Query: 199 VQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPENELALTAVFYD-----E 253
           V+IP++  LG+  P  +I  LF R+ +  +K L  ENP LS ENE  L  +         
Sbjct: 205 VEIPMK-PLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTS 263

Query: 254 TVERRLRRLYMRACARAYTTTNADS 278
              R+++RLY RAC  +Y      S
Sbjct: 264 VSNRKIKRLYQRACKHSYVICEDRS 288

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  101 bits (252), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 113/213 (53%), Gaps = 20/213 (9%)

Query: 67  KALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSS 126
           K LE++I +THF W+NPLP     FQ ++  L  HWP+E  R L   ++++N +  S   
Sbjct: 58  KYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSL---LSMSNPRKESQG- 113

Query: 127 RSVWLKADWITLFNV---KNPWVQTPPSLMRLSGTDLDTFTPER-IFLINSLGNHYKFLI 182
             +W     + L N+   K+ W              ++  +PE+   L++S+ + Y FL 
Sbjct: 114 -YLWRDGKELALSNLRFEKHRWADE---------NIIERLSPEQGTQLLHSIFHQYFFLK 163

Query: 183 ANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPEN 242
           +++ L YN++K P P V+IP+R    +V+  + I  LF R+ + ++  L  EN PLS  N
Sbjct: 164 SHARLCYNNRKIPVPIVEIPLRPMGNDVADCR-IRNLFKRKTAVVWNLLAWENRPLSTRN 222

Query: 243 ELALTAVFYDETVERRLRRLYMRACARAYTTTN 275
           E  L  +   ++  R +RRLY RA  RAY  TN
Sbjct: 223 EQLLGEII-TKSETRSMRRLYQRASRRAYVVTN 254

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 99.0 bits (245), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 118/248 (47%), Gaps = 32/248 (12%)

Query: 38  KFKEIAVPLTKSLQLYEKAQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHF 97
           K  E  +   +SL+  E A R+ + +   K LE+II+ T+F W N +P+H   F++HY+ 
Sbjct: 19  KLIEKRLERAESLRFLELA-RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNE 77

Query: 98  LLTHWPFENHRDLVDSIAVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLS- 156
           L   WP+E HR ++         + S  S+S+        L++  NP V    + MR   
Sbjct: 78  LRDFWPYECHRTILG--------MQSPKSQSIRF------LWSAGNPRVL---AAMRYGS 120

Query: 157 ------GTDLDTFTPERIFLINSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEV 210
                 G        ER    + +  H+ FL     L  N K    P V+IP++  LG+ 
Sbjct: 121 YGWNREGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQN 179

Query: 211 SPAKQIAQLFARQLSHIYKSLFIENPPLSPENELALTAVF------YDETVERRLRRLYM 264
               +I  LF R+++++++ L ++NP LS ENE  L  +         +T  R L+RLY 
Sbjct: 180 IADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQ 239

Query: 265 RACARAYT 272
           RAC  AY 
Sbjct: 240 RACRGAYV 247

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 109/224 (48%), Gaps = 35/224 (15%)

Query: 64  ASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNS 123
            S K+LESI++ T+F W N    H   F++HY  L  HWP+E HR +   ++++  K  S
Sbjct: 44  GSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSI---LSMDTPKTQS 100

Query: 124 TSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLG-------- 175
              R +W                 +P  L ++S       T ER   +  L         
Sbjct: 101 I--RFLWSS--------------NSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEV 144

Query: 176 -NHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIE 234
             H+ FL +  HL    K    P V+IP++  LG+  P  ++  LF R++++++K L ++
Sbjct: 145 FQHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALD 203

Query: 235 NPPLSPENELALTAVF------YDETVERRLRRLYMRACARAYT 272
           +P LS +NEL+L  +        D + +R L+RLY RAC  AYT
Sbjct: 204 SPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYT 247

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 86.3 bits (212), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 131/283 (46%), Gaps = 27/283 (9%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           +  ++  +LL  +E  PLH+ T   L   +    +D  F E  V +   L  YE ++   
Sbjct: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHV--ADLPFMEEYVGI---LNEYEISKINS 61

Query: 61  DLRASLKALESIIYQTHFQWNN-PLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNG 119
            +    +ALE I+ +TH  WNN   P H   F+ HY  LL HWP+E H D+++      G
Sbjct: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121

Query: 120 K-----LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSL 174
                 LN+      + K+       + N W     S+ +   TD      +R+ + N +
Sbjct: 122 SLIYLCLNNDDRFFNFYKS------QINNKWFN---SVDQYKLTD-----EQRVSIYNDI 167

Query: 175 GNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIE 234
                FL  ++ +S  +K    P V++P++  +G   PA +I  LF +++ +I+K L + 
Sbjct: 168 FKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKLLSLS 225

Query: 235 NPPLSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNAD 277
           +P +S  +E  +  +  D    RR+ RLY R+   +Y   + +
Sbjct: 226 SPAISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFDDTN 268

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 74.3 bits (181), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 124/272 (45%), Gaps = 30/272 (11%)

Query: 12  VIESTPLHQITKVALTTTLTSKQSDYKFKEIAV--PLTKSLQLYEKAQRRQDLRASLKAL 69
           ++   PLH+ T   +   L+ +Q+ Y  + I +  PL   L+           +   + L
Sbjct: 8   IVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR-----------KGGHQGL 56

Query: 70  ESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSSRSV 129
           + +++  HFQ     P H  L ++H   L   WP+E H  L   +A+++  + S S R +
Sbjct: 57  QRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSL---LALSD--VRSQSLRRL 111

Query: 130 WLKADWITLFNV---KNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKFLIANSH 186
           W       L  +   ++ W++      R + T       +R  +++ +   Y FL     
Sbjct: 112 WEDGQEEVLQQMQYCRHHWLREGDVPERYALTQ-----AQREEVLHRVFAQYMFLKQRPA 166

Query: 187 LSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPENELAL 246
           L ++ ++ P P V+I +   LG   P  ++  LF  +   + + L+ E+P L+P  E  +
Sbjct: 167 L-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDM 224

Query: 247 TAVFYDETVERRLRRLYMRACARAYTTTNADS 278
             +   E   R +RR+Y+RAC RAY   +AD+
Sbjct: 225 LRII-AECPTRAMRRIYLRACRRAY-VLDADA 254

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 127/290 (43%), Gaps = 39/290 (13%)

Query: 3   SQVNALLLPVIESTPLHQITKVALTTTLTS-KQSDYKFKEIAVPLTKSLQLYEKAQRRQD 61
             +N  +L ++   PLH  TK  +   + S  + ++K  ++  P+ + L           
Sbjct: 2   GGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL----------- 50

Query: 62  LRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLV-------DSI 114
           L   +  L  +I+  +F+  NP   H   F+++   L   WP+E H  L+       DS 
Sbjct: 51  LSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSA 110

Query: 115 ----AVNNGKLNSTS--SRSVWL-----KADWITLFNVKNPWVQTPPSLMRLSGTDLDTF 163
               + NN K+       R +WL     K    ++F    P+ Q    L      D +T 
Sbjct: 111 RYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFG--EPFTQQLQYLR--HEKDKNTL 166

Query: 164 TP-ERIFLINSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFAR 222
              ERI L+  + +HY F+ +   L   HK  P P V++ + + LGE  P  +I  LF +
Sbjct: 167 GETERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFRK 224

Query: 223 QLSHIYKSLFIENPPLSPENELALTAVFYDETVERRLRRLYMRACARAYT 272
           +     K+L  + PPLS E E  L ++   +  +R + RLY  +C  AYT
Sbjct: 225 RSKATLKTLLHDFPPLSREVESLLHSII--KECDRSMGRLYKWSCNGAYT 272

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 101/226 (44%), Gaps = 29/226 (12%)

Query: 67  KALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSS 126
           K LE ++Y  HF   N  P+H  + +++ + L   WP+E    +++         N TS 
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEM-----DDPNLTSQ 105

Query: 127 RSVWLKADWITL----FNVKNPWV-----QTPPSLMRLSGTDLDTFTPERIFLI------ 171
             +W + +   L    FN ++ W+     QTP   +    T +D     +I  +      
Sbjct: 106 TILWSRNNKDALDFLSFN-RHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAE 164

Query: 172 ------NSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLS 225
                   +  HY FL  N  L    KK  +P V+I ++    +++  + I  LF +++ 
Sbjct: 165 KIKETLRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIR-IDNLFKKKVK 222

Query: 226 HIYKSLFIENPPLSPENELALTAVFYDETVERRLRRLYMRACARAY 271
            I   L+ +NP L+ + E  LT++  D  + RR +RLY    +R+Y
Sbjct: 223 LISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSY 268

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 123/291 (42%), Gaps = 55/291 (18%)

Query: 5   VNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIA--------VPLTKSLQLYEKA 56
           V   LL  + S PLH +T   L+  + + +S  + K +A        VP TK    Y   
Sbjct: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQY--- 60

Query: 57  QRRQDLRASLKALESIIYQTHFQWNNPLPRHAHL------FQKHYHFLLTHWPFENHRDL 110
                     K L +++ Q + QW+N   R +HL      F++ +  L+  WP E+H  L
Sbjct: 61  ----------KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSL 110

Query: 111 VDSIAVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFL 170
             S      K ++T      LK  W+T  N K+    +       +  +  +   E    
Sbjct: 111 KQST-----KGHAT------LKHAWVT--NNKHALQMS----FDAAAANPTSGNIELRGS 153

Query: 171 INSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKS 230
           +  + +HY+ L  N  + +   K   P  +IP+ N  GE  PA + A L  R++ ++ + 
Sbjct: 154 LRQILSHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRV 211

Query: 231 LFIENPPLSPENELA-LTAVFYDET--------VERRLRRLYMRACARAYT 272
           L  E P L     +A LTA+   +           R+LRRLY RA A  YT
Sbjct: 212 LIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYT 262

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 40  KEIAVPLTKSLQL------YEKAQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHL--F 91
           K++   LTK+ +L      Y  A   +     LK L+ II++TH  +NN    + HL  F
Sbjct: 40  KQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIFKTHLIFNNSYKNYDHLKAF 99

Query: 92  QKHYHFLLTHWPFENH 107
           +  Y++L  +WP+E H
Sbjct: 100 KLKYNYLTHNWPYERH 115

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 82  NPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNG 119
           N LP H   +Q  YH L+  WP    R ++D++ +  G
Sbjct: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKG 107

>KLTH0H14982g Chr8 (1298040..1299089) [1050 bp, 349 aa] {ON}
           conserved hypothetical protein
          Length = 349

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 11/144 (7%)

Query: 9   LLPVIE-STPLHQITKVALTTT-----LTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQDL 62
           +L V++ S P+  I+   L        L  +  D+  +E+ +  T S Q +E+     D+
Sbjct: 4   VLKVVDISEPIESISDTLLEAAREQGFLFVEGHDFTQEEVDILFTLSKQFFEETP--DDV 61

Query: 63  RASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLN 122
           ++     ++ I  THF      PR A  F++ Y+F   ++         D      GK N
Sbjct: 62  KSQYSINKNNIGYTHFTNEQLDPRKARDFKEGYNFGFINFKTGQFNINEDEYM---GKEN 118

Query: 123 STSSRSVWLKADWITLFNVKNPWV 146
           + S R+   K D  T F  K   +
Sbjct: 119 TDSQRTSGSKNDVPTFFQSKQELI 142

>CAGL0H04609g Chr8 complement(433499..441790) [8292 bp, 2763 aa] {ON}
            similar to uniprot|P38110 Saccharomyces cerevisiae
            YBL088c TEL1
          Length = 2763

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 46   LTKSLQLYEKAQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFE 105
            L  S QL EK +  +  R  LK +ES++  ++      L     + QKHYH L TH   E
Sbjct: 2124 LNGSDQLKEKQKSYRRTRQELKDIESVVKSSNLSNEELL-----VGQKHYHNLKTH--ME 2176

Query: 106  NHRDLVDSIAVNNGKL 121
            N R  +++I +   KL
Sbjct: 2177 NDRLAIENICLTRKKL 2192

>TDEL0C03570 Chr3 (623664..627005) [3342 bp, 1113 aa] {ON} Anc_7.494
            YJR109C
          Length = 1113

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 58/139 (41%), Gaps = 11/139 (7%)

Query: 78   FQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSSRSVWLKAD--- 134
            F     +P+   L  K Y ++ T  P  +   L  +      ++ ST   + + K +   
Sbjct: 888  FLGGEKVPKPVDLMSKKYDYVATKCPQFSFTRLAGADPFLGVEMASTGEVASFGKDEIES 947

Query: 135  -WITLFNVKNPWVQTPPSLMRLSGTDLDT-FTPERIFLINSLGNHYKFLIANSHLSYNHK 192
             W  + +  N  V  PP+ + L G DL+  F  E I  I+SLG  + F +AN       +
Sbjct: 948  YWTAMQSTMNFHVPLPPNGI-LFGGDLNKPFLGEVISTISSLG--FNFYVANEAAKQYLE 1004

Query: 193  KY---PSPGVQIPVRNALG 208
            KY   P   ++ P  +  G
Sbjct: 1005 KYTKDPVSVIEFPKNDKRG 1023

>KAFR0B03240 Chr2 (669954..670715) [762 bp, 253 aa] {ON} 
          Length = 253

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 22/33 (66%)

Query: 196 SPGVQIPVRNALGEVSPAKQIAQLFARQLSHIY 228
           +PG+ +P+ + +G+    K +A++F   +S+IY
Sbjct: 153 NPGIDLPIHSGIGDFYDYKPLARIFQSLISYIY 185

>KNAG0A01510 Chr1 (64382..66688) [2307 bp, 768 aa] {ON} Anc_5.90
           YGR237C
          Length = 768

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 11/114 (9%)

Query: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60
           MA +++  L P   S+P   +T  A++ T+     +YKF E    + K + + ++ +R  
Sbjct: 280 MALELSDKLAPTYPSSP--SVTHRAISLTI----QNYKFTEYVTGIQKRIPIKDQKER-- 331

Query: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSI 114
             R+SL+ +   I    + W++ +  +     K    L+      N  D +DSI
Sbjct: 332 --RSSLRVVNCYISGRRYTWSS-VDWYVENLAKDGDHLIIMTSIPNFEDKIDSI 382

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.132    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,103,864
Number of extensions: 1316577
Number of successful extensions: 3703
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3759
Number of HSP's successfully gapped: 31
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)