Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR090W (XDJ1)8.264ON45945921150.0
Smik_12.1498.264ON46046017690.0
Skud_12.1588.264ON45546116670.0
Suva_10.1748.264ON45645916610.0
SAKL0H16984g8.264ON4354407693e-97
TDEL0F039108.264ON4294207623e-96
NDAI0B020008.264ON4334317606e-96
Ecym_43068.264ON4344627014e-87
CAGL0L12276g8.264ON4524515998e-72
ZYRO0C01606g8.264ON4322925856e-70
NCAS0B050308.264ON4333135804e-69
TPHA0A017908.264ON4392995612e-66
Kpol_543.408.264ON4142965567e-66
AGR084C8.264ON4272875342e-62
KLTH0G13640g8.264ON4142945159e-60
KNAG0G020508.264ON4323224774e-54
KLLA0F19184g8.264ON5122954747e-53
Kwal_56.237828.264ON4142554652e-52
NDAI0D010302.243ON4112632581e-23
KLLA0F03333g2.243ON4092682458e-22
TDEL0C046002.243ON4112682449e-22
Kpol_1003.122.243ON4082532422e-21
KAFR0J009402.243ON4112992412e-21
ADL257C2.243ON4102532403e-21
TBLA0E038102.243ON4102682403e-21
KLTH0G09394g2.243ON4112692385e-21
SAKL0E08734g2.243ON4112532386e-21
Kpol_1002.1222.218ON5032512407e-21
TPHA0C031102.243ON4072682378e-21
Ecym_32812.243ON4092532351e-20
NCAS0G028502.218ON4942442343e-20
Kwal_23.48302.243ON4112692323e-20
KLLA0E07899g2.218ON4953182344e-20
KNAG0I019002.243ON4092582306e-20
AER427W2.218ON4704282316e-20
NCAS0G030002.243ON4102682291e-19
Skud_14.2532.218ON5323442301e-19
Smik_14.2632.243ON4092532262e-19
CAGL0J09966g2.243ON4072682262e-19
ZYRO0A01496g2.243ON4122632263e-19
YNL064C (YDJ1)2.243ON4092532236e-19
Suva_14.2772.243ON4092672227e-19
Smik_14.2492.218ON5332672239e-19
ZYRO0C15048g2.218ON4912542221e-18
Skud_14.2682.243ON4102672201e-18
YNL077W (APJ1)2.218ON5282422202e-18
KLTH0G08756g2.218ON4622872183e-18
TDEL0C043502.218ON4622432158e-18
SAKL0E09306g2.218ON4612642131e-17
Ecym_53842.218ON5032852122e-17
Suva_14.2622.218ON5362412122e-17
TPHA0C029802.218ON5542312087e-17
Kwal_23.30612.218ON4582892006e-16
KAFR0A041608.730ON3782381907e-15
NDAI0E008708.730ON3762381891e-14
NDAI0F024502.218ON5302601864e-14
CAGL0J10296g2.218ON4792541821e-13
TBLA0E036602.218ON4482371802e-13
Kwal_26.90248.730ON3752361782e-13
KNAG0M020202.218ON4602361758e-13
CAGL0H03707g1.398ON349681721e-12
KLLA0C07260g8.730ON3682391721e-12
NDAI0G042501.398ON363681683e-12
YNL007C (SIS1)1.398ON352681674e-12
SAKL0H05258g8.730ON3682381675e-12
Suva_14.3411.398ON359681667e-12
NDAI0C026101.398ON340681649e-12
TPHA0B037601.398ON355681641e-11
AAL008W1.398ON349681632e-11
TBLA0C014801.398ON353681632e-11
Kwal_0.2071.398ON353681612e-11
ZYRO0E04598g1.398ON357681612e-11
KAFR0H031501.398ON359681613e-11
Kpol_457.151.398ON357671603e-11
NCAS0C048901.398ON367681604e-11
NCAS0G036101.398ON327681594e-11
KLTH0H12100g1.398ON350681595e-11
SAKL0D08778g1.398ON348681585e-11
TDEL0B059601.398ON369681596e-11
KLLA0D04818g1.398ON354681578e-11
Smik_14.3211.398ON366681578e-11
Skud_14.3201.398ON368681578e-11
KNAG0H016801.398ON363681561e-10
TBLA0D042407.217ON389661561e-10
Smik_13.4228.730ON3782381542e-10
Ecym_12921.398ON347681532e-10
TPHA0G006308.730ON3932291542e-10
Ecym_43727.217ON579661553e-10
KLTH0A03740g7.217ON395661543e-10
YMR214W (SCJ1)8.730ON377661533e-10
NCAS0B005308.730ON375661533e-10
Suva_13.3978.730ON375661524e-10
CAGL0F03729g8.730ON361661515e-10
TDEL0H022907.217ON387661515e-10
NCAS0E029307.217ON387661507e-10
TBLA0D026008.61ON5102721518e-10
ZYRO0A06226g8.730ON377661508e-10
AER346W8.730ON367661498e-10
NDAI0E045607.217ON394661491e-09
TPHA0C012607.217ON380661491e-09
YMR161W (HLJ1)2.350ON224651441e-09
KNAG0G028808.730ON378661481e-09
TDEL0B037908.730ON373661471e-09
KLTH0D12496g8.730ON375661472e-09
Kpol_1064.408.730ON3872341472e-09
CAGL0J02750g7.217ON382671462e-09
Skud_5.1587.217ON391661462e-09
Smik_13.3612.350ON224651404e-09
Kpol_1070.227.217ON380661444e-09
Ecym_62368.730ON374671444e-09
Kwal_47.181337.217ON393661444e-09
KLLA0E04423g7.217ON428661445e-09
Skud_13.3232.350ON224651395e-09
Suva_12.1851.113ON168641365e-09
CAGL0J07370g2.15ON623641437e-09
Smik_5.1737.217ON391661428e-09
YNL227C (JJJ1)2.15ON590641429e-09
KLTH0F09944g2.350ON233651371e-08
TPHA0C045902.350ON233651371e-08
Skud_13.3838.730ON375661411e-08
YER048C (CAJ1)7.217ON391661411e-08
SAKL0F08052g7.217ON393671411e-08
Smik_14.1062.15ON593641421e-08
TDEL0G028002.350ON225651361e-08
TBLA0E024907.217ON366661401e-08
Kpol_529.212.15ON622661412e-08
KNAG0L013307.217ON396661392e-08
TPHA0G014808.698ON660701402e-08
TBLA0B034908.730ON3842391382e-08
NCAS0G013602.15ON616661392e-08
AFR507W8.61ON474661382e-08
TPHA0L007907.157ON446661383e-08
KNAG0F008602.15ON626641393e-08
NDAI0H031802.350ON229651343e-08
KLLA0D19602g2.15ON620661384e-08
Suva_13.3402.350ON225651334e-08
TBLA0G001702.15ON659641374e-08
CAGL0L00957g7.217ON373641355e-08
ZYRO0A07502g2.350ON238661325e-08
Kpol_1072.48.698ON661691375e-08
KAFR0A016201.297ON665661375e-08
TBLA0J018707.157ON470671356e-08
NCAS0D009602.350ON224651316e-08
KNAG0I007407.157ON425661356e-08
Skud_10.3191.113ON168641286e-08
TPHA0D005508.61ON486661357e-08
ZYRO0F15400g2.15ON525641357e-08
Suva_5.1507.217ON391661347e-08
CAGL0H04499g2.350ON232651308e-08
Kwal_23.3578singletonOFF85611218e-08
Smik_9.2037.157ON432661349e-08
NDAI0F038002.15ON638641359e-08
Suva_14.1162.15ON600641341e-07
Skud_14.1102.15ON596641331e-07
SAKL0E06050g2.350ON232651291e-07
KNAG0I008602.350ON219651281e-07
Kwal_23.44202.15ON592641331e-07
AFR639W1.113ON156641251e-07
ZYRO0D16390g7.217ON398661321e-07
KLLA0D06402g1.297ON631661331e-07
Suva_8.3038.698ON664691331e-07
KAFR0L007407.217ON364661312e-07
KAFR0A079502.15ON551641322e-07
Kpol_526.62.350ON228651282e-07
Smik_15.4378.698ON663691322e-07
ABL194C2.15ON552661312e-07
YOR254C (SEC63)8.698ON663691313e-07
SAKL0E14234g2.15ON678641303e-07
Skud_15.4208.698ON665691303e-07
KLTH0B08338g2.15ON590641303e-07
TBLA0B093802.350ON227651253e-07
TDEL0E005002.15ON581641293e-07
TBLA0C027201.297ON715671294e-07
KLLA0C09823g8.698ON669731294e-07
NDAI0D005001.113ON190701234e-07
Kpol_1027.131.297ON641701294e-07
TPHA0O019402.15ON598641294e-07
KNAG0B052401.297ON668661285e-07
ADR015W7.157ON436661276e-07
Ecym_56262.350ON243651246e-07
SAKL0D06226g1.297ON615671286e-07
KLLA0E01629g2.350ON231651236e-07
NCAS0A093201.297ON635671277e-07
KAFR0H023108.698ON655691277e-07
Suva_9.2137.157ON431661267e-07
KAFR0B048902.350ON220651227e-07
Kwal_14.24521.297ON607661277e-07
Smik_10.3851.113ON172641208e-07
NDAI0A028207.157ON482661268e-07
TBLA0J009701.185ON586641269e-07
Skud_9.1817.157ON421661259e-07
YFL016C (MDJ1)8.61ON5112061251e-06
KNAG0J018408.698ON650691251e-06
NCAS0C012208.698ON669691251e-06
KAFR0B047807.157ON423651241e-06
KLTH0F03124g1.113ON162641181e-06
CAGL0G07469g8.698ON668691241e-06
TBLA0A011007.157ON434671232e-06
Smik_6.638.61ON5102061232e-06
KNAG0G011308.61ON500641232e-06
ZYRO0D10934g8.698ON663691232e-06
CAGL0C04565g1.113ON175681172e-06
KLLA0D13464g7.157ON433661222e-06
TPHA0A028101.185ON492651222e-06
ZYRO0F15972g1.113ON162641162e-06
SAKL0F04444g7.157ON429661222e-06
KLTH0H10032g1.297ON607661223e-06
AFL190C2.350ON235651193e-06
YIR004W (DJP1)7.157ON432671213e-06
ADR124C1.297ON611671223e-06
SAKL0C03476g1.113ON165661153e-06
ZYRO0G03850g7.157ON418641204e-06
CAGL0J01936g7.157ON425671204e-06
TDEL0H032107.157ON411671194e-06
Skud_10.1691.297ON644761205e-06
Skud_6.568.61ON5172061196e-06
Suva_6.448.61ON5072061196e-06
ADL111W7.217ON578631196e-06
YJR097W (JJJ3)1.113ON172641136e-06
TPHA0B041901.113ON168641137e-06
Ecym_14508.61ON492661187e-06
Smik_10.1681.297ON649761197e-06
Suva_6.1481.297ON642671197e-06
NCAS0A132107.157ON414661187e-06
KNAG0B018901.92ON370761179e-06
SAKL0H05984g8.698ON658661189e-06
TBLA0B037308.698ON693691181e-05
NDAI0C002001.92ON276711151e-05
TDEL0D016401.297ON604721171e-05
Ecym_44697.157ON433661161e-05
CAGL0H02827g1.297ON656771171e-05
Kpol_499.307.157ON408661151e-05
TDEL0A064308.698ON666691152e-05
Kwal_33.138601.185ON578641152e-05
KAFR0F018101.185ON555641152e-05
KNAG0C024501.185ON544641152e-05
YJL073W (JEM1)1.297ON645671152e-05
ZYRO0G21230g1.297ON584671152e-05
KLTH0D11770g8.698ON652691143e-05
KLTH0F13398g7.157ON419661123e-05
TDEL0C058801.113ON159651073e-05
KLLA0B07271g1.185ON653791134e-05
KNAG0A056502.350ON175661075e-05
NDAI0K012308.698ON680691125e-05
YJL162C (JJJ2)1.185ON583641125e-05
Ecym_80931.185ON543641115e-05
TBLA0A055601.92ON312681105e-05
ZYRO0C01210g5.4ON433731106e-05
Kwal_55.209657.157ON421661106e-05
KAFR0C024507.217ON373641098e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR090W
         (459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   819   0.0  
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   686   0.0  
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   646   0.0  
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   644   0.0  
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   300   3e-97
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   298   3e-96
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    297   6e-96
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   274   4e-87
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   235   8e-72
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   229   6e-70
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    228   4e-69
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   220   2e-66
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   218   7e-66
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   210   2e-62
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   202   9e-60
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   188   4e-54
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   187   7e-53
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   183   2e-52
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   103   1e-23
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...    99   8e-22
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...    99   9e-22
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...    98   2e-21
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...    97   2e-21
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...    97   3e-21
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...    97   3e-21
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    96   5e-21
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    96   6e-21
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    97   7e-21
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...    96   8e-21
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...    95   1e-20
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     95   3e-20
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...    94   3e-20
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    95   4e-20
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    93   6e-20
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    94   6e-20
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...    93   1e-19
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    93   1e-19
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...    92   2e-19
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...    92   2e-19
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...    92   3e-19
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...    91   6e-19
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    90   7e-19
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    91   9e-19
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    90   1e-18
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...    89   1e-18
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    89   2e-18
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    89   3e-18
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    87   8e-18
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...    87   1e-17
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    86   2e-17
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    86   2e-17
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    85   7e-17
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    82   6e-16
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    78   7e-15
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    77   1e-14
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    76   4e-14
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    75   1e-13
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    74   2e-13
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    73   2e-13
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    72   8e-13
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    71   1e-12
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    71   1e-12
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    69   3e-12
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    69   4e-12
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    69   5e-12
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    69   7e-12
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               68   9e-12
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    68   1e-11
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    67   2e-11
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    67   2e-11
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    67   2e-11
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    67   2e-11
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    67   3e-11
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    66   3e-11
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     66   4e-11
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      66   4e-11
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    66   5e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    65   5e-11
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    66   6e-11
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    65   8e-11
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    65   8e-11
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    65   8e-11
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    65   1e-10
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    65   1e-10
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    64   2e-10
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    64   2e-10
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    64   2e-10
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    64   3e-10
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    64   3e-10
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    64   3e-10
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       64   3e-10
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    63   4e-10
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    63   5e-10
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    63   5e-10
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     62   7e-10
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    63   8e-10
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    62   8e-10
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    62   8e-10
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             62   1e-09
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    62   1e-09
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    60   1e-09
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    62   1e-09
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    61   1e-09
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    61   2e-09
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    61   2e-09
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    61   2e-09
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    61   2e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   4e-09
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    60   4e-09
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    60   4e-09
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    60   4e-09
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    60   5e-09
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    58   5e-09
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    57   5e-09
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    60   7e-09
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    59   8e-09
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    59   9e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    57   1e-08
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    57   1e-08
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    59   1e-08
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    59   1e-08
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    59   1e-08
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    59   1e-08
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    57   1e-08
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    59   1e-08
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    59   2e-08
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    58   2e-08
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    59   2e-08
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    58   2e-08
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    58   2e-08
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    58   2e-08
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    58   3e-08
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    58   3e-08
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      56   3e-08
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    58   4e-08
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    56   4e-08
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    57   4e-08
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    57   5e-08
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    55   5e-08
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    57   5e-08
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    57   5e-08
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    57   6e-08
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    55   6e-08
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    57   6e-08
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    54   6e-08
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    57   7e-08
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    57   7e-08
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    56   7e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    55   8e-08
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    51   8e-08
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    56   9e-08
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      57   9e-08
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    56   1e-07
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    56   1e-07
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    54   1e-07
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    54   1e-07
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    56   1e-07
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    53   1e-07
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    55   1e-07
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    56   1e-07
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    56   1e-07
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    55   2e-07
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    55   2e-07
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    54   2e-07
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    55   2e-07
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    55   2e-07
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    55   3e-07
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    55   3e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    55   3e-07
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    55   3e-07
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    53   3e-07
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    54   3e-07
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    54   4e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    54   4e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    52   4e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    54   4e-07
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    54   4e-07
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    54   5e-07
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    54   6e-07
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    52   6e-07
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    54   6e-07
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    52   6e-07
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    54   7e-07
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    54   7e-07
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    53   7e-07
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    52   7e-07
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    54   7e-07
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    51   8e-07
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    53   8e-07
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    53   9e-07
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    53   9e-07
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    53   1e-06
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    53   1e-06
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     53   1e-06
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               52   1e-06
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    50   1e-06
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    52   1e-06
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    52   2e-06
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    52   2e-06
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    52   2e-06
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    52   2e-06
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    50   2e-06
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    52   2e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    52   2e-06
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    49   2e-06
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    52   2e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    52   3e-06
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    50   3e-06
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    51   3e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    52   3e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    49   3e-06
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    51   4e-06
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    51   4e-06
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    50   4e-06
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    51   5e-06
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    50   6e-06
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    50   6e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    50   6e-06
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    48   6e-06
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    48   7e-06
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    50   7e-06
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    50   7e-06
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    50   7e-06
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    50   7e-06
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    50   9e-06
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    50   9e-06
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    50   1e-05
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         49   1e-05
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    50   1e-05
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    49   1e-05
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    50   1e-05
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    49   1e-05
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    49   2e-05
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    49   2e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    49   2e-05
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    49   2e-05
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    49   2e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    49   2e-05
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    49   3e-05
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    48   3e-05
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    46   3e-05
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    48   4e-05
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    46   5e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    48   5e-05
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    48   5e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    47   5e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    47   5e-05
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    47   6e-05
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    47   6e-05
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    47   8e-05
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    47   8e-05
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    47   9e-05
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    45   1e-04
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    47   1e-04
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    46   1e-04
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    47   1e-04
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    46   1e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    46   1e-04
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    46   1e-04
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    44   2e-04
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    46   2e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    46   2e-04
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    46   2e-04
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    44   2e-04
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    46   2e-04
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    46   2e-04
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    45   2e-04
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    45   2e-04
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    44   2e-04
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    45   2e-04
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    44   3e-04
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    45   3e-04
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    45   3e-04
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    45   4e-04
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    44   5e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    44   5e-04
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    44   5e-04
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    44   5e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    44   6e-04
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    42   7e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    43   7e-04
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    43   7e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    44   8e-04
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    44   8e-04
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    43   0.001
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    44   0.001
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    44   0.001
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    42   0.001
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    43   0.001
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    43   0.001
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    43   0.001
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    41   0.001
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    42   0.002
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    42   0.002
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    42   0.002
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    42   0.003
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    40   0.003
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       42   0.003
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    42   0.003
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    42   0.003
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    42   0.004
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    41   0.005
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    41   0.007
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    40   0.007
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    41   0.007
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    40   0.007
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    40   0.008
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    40   0.008
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    40   0.008
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    40   0.009
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    40   0.009
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    40   0.011
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    40   0.012
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    39   0.018
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    39   0.025
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    39   0.026
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    39   0.030
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    38   0.030
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    39   0.032
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    38   0.043
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    38   0.061
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    37   0.074
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.076
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    36   0.15 
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    36   0.15 
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    36   0.16 
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    36   0.19 
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    35   0.35 
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    34   0.38 
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    34   0.46 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    34   0.60 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    34   0.64 
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    34   0.77 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    33   1.4  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   1.7  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    33   1.8  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    32   2.6  
Ecym_7058 Chr7 complement(120589..121734) [1146 bp, 381 aa] {ON}...    32   2.9  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    32   2.9  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    32   3.2  
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    31   4.1  
Smik_13.51 Chr13 complement(93473..95053) [1581 bp, 526 aa] {ON}...    32   4.2  
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    32   4.6  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    31   4.8  
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    31   4.9  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    31   4.9  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    31   5.1  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    31   5.2  
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    31   5.5  
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    31   5.8  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    30   6.3  
CAGL0K09416g Chr11 complement(931067..932143) [1077 bp, 358 aa] ...    31   6.6  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    31   6.9  
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    30   7.7  
Smik_9.215 Chr9 (357725..358153) [429 bp, 143 aa] {ON} YIR015W (...    30   9.2  

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/459 (87%), Positives = 403/459 (87%)

Query: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60
           MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA
Sbjct: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDA 120
           YEILSDPEKKSHYDLY                                      PGEYDA
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDA 120

Query: 121 YEEGNXXXXXXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180
           YEEGN                  YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE
Sbjct: 121 YEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180

Query: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240
           CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK
Sbjct: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240

Query: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300
           EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA
Sbjct: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300

Query: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360
           GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN
Sbjct: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360

Query: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNET 420
           PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNET
Sbjct: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNET 420

Query: 421 ISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459
           ISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ
Sbjct: 421 ISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/460 (72%), Positives = 368/460 (80%), Gaps = 1/460 (0%)

Query: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60
           MSGSDR  +LYDVLGVT DA+VQEIKTAYRKLALKHHPDKYVDQ+SKEVNEIKFKEITAA
Sbjct: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDA 120
           YEILSDPEKKSHYDLY                                      P EYD 
Sbjct: 61  YEILSDPEKKSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDT 120

Query: 121 YEEGNXXXXXXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180
           YEE                    YMGKKLKF+LKRQ++C+ CHGSGWK K+KIHVTH+VE
Sbjct: 121 YEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180

Query: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240
           CESC GKGSKERLKRFGPGLVASQWV CEKC+GKGKY KRPKNPKNFCPDCAG+GL SKK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240

Query: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300
           EIITVNVAPGHHFNDVIT+KGMADEE+DK+ CGDLKFHL EKQENLEQKQIFLKNFD+G+
Sbjct: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300

Query: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360
            EDLYTS TISLSEALTGFEKFLT+TFDDRLLTLS+KPGRV+RPGD IKI NEGWPI+D+
Sbjct: 301 AEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDD 360

Query: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNT-EDDSNLTNNE 419
           P G+ GDLYVF+HIEFPPDNWFNEKSELLAIKT LPSSSSC    T NT EDD N  NNE
Sbjct: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420

Query: 420 TISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459
           TISNF+II+ ++LPEG++ F  E+Q+SAHQKA+SSYC +Q
Sbjct: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/461 (69%), Positives = 358/461 (77%), Gaps = 8/461 (1%)

Query: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60
           MS SDR +RLY VLGVTRDA VQEIKTAYRKLALKHHPDKYVDQDSK+VNEIKFKEITAA
Sbjct: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDA 120
           YEILSDPEKKSHYDLY                                        EY  
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKM 120

Query: 121 YEEGNXXXXXXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180
           YE+ +                  YMGKKL+FDLKRQV+C+KCHGSGWK K+++HVTH+VE
Sbjct: 121 YEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180

Query: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240
           CESC GKGSKERLKRFGPGLVASQWV+CEKC+GKGKY K PKNPKNFCPDCAG+GL SKK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240

Query: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300
           E+ITV VAPGHHFNDVIT++GMADEEI K  CGDL+FHL E+QE+   KQ+FLKNF DG 
Sbjct: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300

Query: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360
            ED Y S+TISLSEALTGFEKFLTKTFDDRLLTLS+KPGRV+RPGD +KI NEGWPILD+
Sbjct: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360

Query: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLP--SSSSCASHATVNTEDDSNLTNN 418
             GRCGDLYVF+HIEFPPDNWFNEKSELL IKTNLP  SSSSCAS       D ++L NN
Sbjct: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASG------DANDLINN 414

Query: 419 ETISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459
           ET+SNF+IIHTDDLPEG++ FKP+ Q+ AH+KARS+YC +Q
Sbjct: 415 ETVSNFQIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/459 (68%), Positives = 355/459 (77%), Gaps = 3/459 (0%)

Query: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60
           MSGSD  DRLYDVLGVTR+A+VQEIKTAYRKLALKHHPDK VDQDSKE+NE KFKEITAA
Sbjct: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDA 120
           YEILSDPEKKSHYDLY                                      P E++ 
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDF---PNEHEM 117

Query: 121 YEEGNXXXXXXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180
           YE                     YMGKKLKF+LKRQ+IC KC GSGWK K+K+HVTH++E
Sbjct: 118 YEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177

Query: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240
           CESC GKGSKERLKRFGPGLVASQWVVCEKC+GKGKYTKRPKN KNFCPDC  +GL  KK
Sbjct: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237

Query: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300
           E+ITVNV PGHHFNDV+TVKGMADEEIDK  CGDL FHL EK E+L+QKQ+ +K F  G 
Sbjct: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297

Query: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360
            +DLY SIT+SLSEALTGFEKFLT+TFDDRLLTLS+KPG+V+RPGD IKI NEGWPILD+
Sbjct: 298 LQDLYVSITVSLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDH 357

Query: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNET 420
           P G+CGDLYVFV IEFPPDNWFNEKSELLAIKT+LPSS+S  S+ TVNT  D++  N+ET
Sbjct: 358 PRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSET 417

Query: 421 ISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459
           +SNF+IIH+DDLPEG++ F P+ Q SAHQKA SSYC +Q
Sbjct: 418 VSNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  300 bits (769), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 176/440 (40%), Positives = 244/440 (55%), Gaps = 28/440 (6%)

Query: 9   RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
           +LY+VLGV  DA+  EIK AYRKLAL+HHPDK  D+  +E +E+KFKEITAAYEILSD +
Sbjct: 3   KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDAYEEGNXXX 128
            +  YD+Y                                      P      EE     
Sbjct: 63  SRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPY---PEEENRSVR 119

Query: 129 XXXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKG 188
                          Y GK  KF  KR V+C +C GSG + K + H    V C+SC G G
Sbjct: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179

Query: 189 SKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVA 248
            KER+KR   G V  + V CE+CNGKG+ T  P  P++ C  C G  ++S+++ +TV + 
Sbjct: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTVYIP 237

Query: 249 PGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE---NLEQKQIFLKNFDDGAGEDLY 305
            G    D++ ++G AD+E DK T GDL F + E  E   NLE++           G+DL+
Sbjct: 238 RGSRNGDIVKLEGEADQEPDKVT-GDLLFVIEENPETSTNLERR-----------GDDLH 285

Query: 306 TSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRC 365
           T + ISLSEA+TGFEK +T T DDR+L L +  G+V+RPG+ I++ NEGWP LD+   + 
Sbjct: 286 TRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKF 344

Query: 366 GDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFR 425
           GD+YV VHIEFPPDNWF+EKS++  ++T LP   +          D  +L N ET+ ++ 
Sbjct: 345 GDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPN------ARVADTGDLNNTETVIDYS 398

Query: 426 IIHT-DDLPEGIRPFKPEAQ 444
           ++ + D+LP+ +   K E Q
Sbjct: 399 VVKSADELPDYLSYEKGEYQ 418

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  298 bits (762), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 168/420 (40%), Positives = 231/420 (55%), Gaps = 25/420 (5%)

Query: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           LY++LGV  DAT  EIK AYRK AL+HHPDK  D+  +E +E++FKEI AAYE+L D EK
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDAYEEGNXXXX 129
           ++ YD Y                                         YD Y E      
Sbjct: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNA-------YDHYGEQKVDRS 116

Query: 130 XXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTH--DVECESCAGK 187
                         Y GK  KF  KR ++C +C GSGW+ +R  HV     VEC+ C G+
Sbjct: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQ 175

Query: 188 GSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNV 247
           G K+R++R  PG   ++ + C  C+GKGK   +P N KN C  C G G+ ++ + +TV++
Sbjct: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSL 235

Query: 248 APGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTS 307
             G   +D I +KG AD+E+ K+  G+L F + E  E  E   +    F      DL T 
Sbjct: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF------DLITH 289

Query: 308 ITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGD 367
           +T+SL+EA+TGF K LTKT D R+L L + PG+V+RPG+ I+I +EGWPI        GD
Sbjct: 290 LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTT---TSGD 346

Query: 368 LYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRII 427
           LYV VHIEFPPDNWF+E+S+L  +K  LP  ++  ++A V  EDD    N ET++N  I+
Sbjct: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLPGETN--NNAAV--EDDPG--NTETVTNINIV 400

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  297 bits (760), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 171/431 (39%), Positives = 244/431 (56%), Gaps = 35/431 (8%)

Query: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           LY +LGVT  AT  EIK AYRKLAL++HPDK +D + +E NEIKFKEIT+AYEILSD EK
Sbjct: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDAYEEGNXXXX 129
           ++HYDLY                                        +YD+Y   N    
Sbjct: 64  RAHYDLYGDANENEYNNQNANDFFNFETDQP----------------DYDSYAFDNDKSK 107

Query: 130 XXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVT--HDVECESCAGK 187
                         Y GK  KF  KR +IC++C G GW+ ++  +VT  H++EC+ C G 
Sbjct: 108 DVKIPLKLSIQEL-YNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166

Query: 188 GSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNV 247
           G KER +   PG V +  + CE C+GKG+   +P + KN C +C G GLLS+ + + V+V
Sbjct: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226

Query: 248 APGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTS 307
             G    D I ++  AD+EI K+  GD+   + E+   +     F++      G D    
Sbjct: 227 PRGLQNKDTIRIENEADQEIGKSKTGDI-ILVIEEDTTMPSDVHFIR-----KGTDFVMY 280

Query: 308 ITISLSEALTGF-EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG-RC 365
           +++SL+EALTGF +KFL+K+ D R+LTLSV  G+V+RPG+ IKI  EGWP+  NP   + 
Sbjct: 281 LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV--NPQASKF 338

Query: 366 GDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFR 425
           GDLYV + IEFPPDNWF+EKS++  ++  LPS      +  +N+    +  N ET++ F 
Sbjct: 339 GDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPS----GINGMMNSWKIDDPLNTETVTTFD 394

Query: 426 IIHTDDLPEGI 436
           I+  ++LP+ +
Sbjct: 395 IL--EELPDTL 403

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  274 bits (701), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 177/462 (38%), Positives = 243/462 (52%), Gaps = 38/462 (8%)

Query: 7   GDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSD 66
           G  LY VLG+  +AT QE+K AYR LAL +HPDK  D+  +  +E KFKEI+AAY+ILSD
Sbjct: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61

Query: 67  PEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDAYEEGNX 126
            +K+S YD Y                                       G+Y+  E+   
Sbjct: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRY----GQYEDAEQKTS 117

Query: 127 XXXXXXXXXXXXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAG 186
                            Y+GK  +F LKR V+C KC G G + KR  H    ++C  C G
Sbjct: 118 QKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLR-KRAAHCM-PMKCGICDG 175

Query: 187 KGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVN 246
           +G KER+ R  PG ++ + V C++C+GKG    R  +P + C  C G  ++ +  I+T+ 
Sbjct: 176 RGFKERVSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVENSILTLY 233

Query: 247 VAPGHHFNDVITVKGMADEEIDKTTCGDLKFHL---TEKQENLEQKQIFLKNFDDGAGED 303
           V  GH   D I + G AD E  K T GDL F +   T+    LE+K           G D
Sbjct: 234 VPRGHRHADTIRIDGQADMEAGKET-GDLVFEIDEITDPDAELERK-----------GTD 281

Query: 304 LYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG 363
           L+ SITISL+EALTGF + + +TFDDRLL +++  G+V+RPG+ +K  NEGWPI  N   
Sbjct: 282 LHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPI--NNGS 339

Query: 364 RCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPS-SSSCASHATVNTEDDSNLTNNETIS 422
           R GDLYV V+IEFP DNW NEKSEL AIK  LP   +S  SH      D  +  N E I+
Sbjct: 340 RFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQG----DGDDPANTEDIN 395

Query: 423 NFRIIH-TDDLPEGIRPFKPEAQDSAHQ----KARSSYCCIQ 459
           ++ +I  +  LP+ +     E Q  ++Q    +  +S C +Q
Sbjct: 396 SYYVIQDSSRLPDYL---AQEGQQRSNQQYGERNTASECPVQ 434

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  235 bits (599), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 151/451 (33%), Positives = 229/451 (50%), Gaps = 53/451 (11%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-----DQDSKEVNEIKFKEITAAYEILS 65
           Y +LGV +DA+  EIK AYRKLAL+HHPDK       +  S ++ ++ FKE+TAAY++LS
Sbjct: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 66  DPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDAYEEGN 125
           D   ++ YD                                        PG    ++ G 
Sbjct: 64  DASLRAEYD-------------QKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGR 110

Query: 126 XXXXXXXXXXX---XXXXXXXYMGKKLKFDLKRQVICIKCHGSGWKP-----KRKIHVTH 177
                                Y GKK+ F+LKR+  C +C G+GWK      K+K     
Sbjct: 111 GARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFF 170

Query: 178 DVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDC---AGL 234
              CE C G+G ++RL++  PG V ++ + C +C GKGK    PK+ KN CPDC     +
Sbjct: 171 WNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTV 230

Query: 235 GLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLK 294
           G++ + +++T+N+  G    D I +KG ADE+++ T  GDL   +   QE  E +   ++
Sbjct: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKI---QEVKEPQYDIVR 287

Query: 295 NFDDGAGEDLYTSITISLSEALTGF-EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANE 353
           N     G DL     I L++A+ GF EK L +T+D R+L  S K G+V+RP D ++I NE
Sbjct: 288 N-----GYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNE 342

Query: 354 GWPILDNPHG-----RCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSS-----SSCAS 403
           GWP  ++ +      + GDLYV V I FPPDNW  E ++  A++  +PS+     SS + 
Sbjct: 343 GWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSG 402

Query: 404 HATVNTEDDSNLTNNETISNFRIIHTDDLPE 434
            + +N E   N+  +E +    I + D+LP+
Sbjct: 403 ESILNVE---NINVSEIVK--EIPNCDELPK 428

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  229 bits (585), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 122/292 (41%), Positives = 176/292 (60%), Gaps = 19/292 (6%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  KF  KR+++C KC GSGW+ +R         C+SC G+G KE+L+R  PG+VA 
Sbjct: 129 YNGKVFKFQSKRKIVCEKCEGSGWR-RRSGGPPPQTNCKSCQGRGYKEQLRRVAPGMVAQ 187

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
           Q V C  C+GKGKY  +P + KN C  C G G++ + + +TV++  G    D I  +G A
Sbjct: 188 QTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEA 247

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+E+ K+  GDL F + E  E  E  ++  + +      DL T+I+ISL+EA+TG ++ L
Sbjct: 248 DQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNISISLAEAITGLDRTL 301

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG-RCGDLYVFVHIEFPPDNWF 382
           TKT D R+L LS   G+V+ PG  IK+  EGWP+  N H  + GDLYV V I FP DNWF
Sbjct: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL--NSHATKFGDLYVLVDIVFPRDNWF 359

Query: 383 NEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHTDDLPE 434
            EKS+LL I+  LPS ++       N +  ++  N E +S+ +++  D LP+
Sbjct: 360 AEKSDLLKIRNILPSEAA-------NNDVKADPGNTEQVSDMKLV--DQLPD 402

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (80%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD LGV++DAT  EIK AYRKLAL+HHPDK  D   +E +E++FKEITAAYE+LSD EK
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 63 RSKYDTY 69

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  228 bits (580), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 182/313 (58%), Gaps = 22/313 (7%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKR--KIHVTHDVECESCAGKGSKERLKRFGPGLV 201
           Y GK  KF  KR VIC  C G GW+ ++  ++ V  +VEC+ C G+G  E+++   PG  
Sbjct: 125 YNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFA 184

Query: 202 ASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
             +   C++C+GKGK+  +  + KN C  C G GL ++ +++TV+V  G    D I V  
Sbjct: 185 TREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVN 244

Query: 262 MADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGF-E 320
            AD+E+ K   GDL F + E Q   +  Q+  K      G +  T + ISL+EALTGF +
Sbjct: 245 EADQELGKPKTGDLIFSIEEDQRCPKDVQLERK------GSNFMTELNISLAEALTGFKD 298

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDN 380
           KF+TKTFD R+L LS+ PG+V+RPG+ IKI  EGWP L+    + GDLY+ V+IEFPPDN
Sbjct: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP-LNGEATKFGDLYISVNIEFPPDN 357

Query: 381 WFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHTDDLPEGIRPFK 440
           WF EKS+L  IK  LP S+S  +  +    DD    N E +  F ++ T  LP+ ++   
Sbjct: 358 WFTEKSDLTQIKNILPRSTSDKTKLS----DDP--LNTELLLKFEVLET--LPDTLK--- 406

Query: 441 PEAQDSAHQKARS 453
            E QD     A S
Sbjct: 407 -EGQDQGENNAES 418

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 57/69 (82%), Gaps = 2/69 (2%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDS--KEVNEIKFKEITAAYEILSDP 67
          LY VLGV  +AT  +IK AYRKLAL+HHPDK V+ +S  +E +EIKFKEI+AAYEILSD 
Sbjct: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63

Query: 68 EKKSHYDLY 76
          +K++HYDLY
Sbjct: 64 DKRAHYDLY 72

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  220 bits (561), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 182/299 (60%), Gaps = 16/299 (5%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKR--KIHVTHDVECESCAGKGSKERLKRFGPGLV 201
           Y GK +++D+KR VIC KC G GW+ ++  K +V    EC++C G G K+  ++  PG  
Sbjct: 123 YNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFF 182

Query: 202 ASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
             Q +VC+ C+GKG+Y K+P + KNFC  C G G++   E ITVN+  G    D I +  
Sbjct: 183 TKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDN 242

Query: 262 MADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGF-E 320
            AD+E+ K   GDL F L    E ++ +Q  LK + D   +DL T +TISL++A+TGF E
Sbjct: 243 KADQELGKFKTGDLIFVL----EEIDDEQTALKRYGD---KDLITELTISLADAITGFKE 295

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDN 380
           K + KT D RLL LS+  G+V+R GD +K+  EGWP+  N   R GDLY+  +IEFP DN
Sbjct: 296 KPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT-RSGDLYIKFNIEFPADN 354

Query: 381 WFNEKSELLAIKTNLPSSSSCASH--ATVNTEDDSNLT-NNETISNFRIIHTDDLPEGI 436
           W +E ++++ I+  LP+ S   +     +  +D  N+T N+E ISN+  +   DLP+ I
Sbjct: 355 WNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVK--DLPDII 411

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 45/71 (63%), Gaps = 5/71 (7%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVN-----EIKFKEITAAYEIL 64
          LY +L V    T  E+K  YRKLALK+HPDK    D  E +     E+KFKEI +AYEIL
Sbjct: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 65 SDPEKKSHYDL 75
          SD EK+  YDL
Sbjct: 72 SDEEKRKQYDL 82

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  218 bits (556), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 169/296 (57%), Gaps = 21/296 (7%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKR--KIHVTHDVECESCAGKGSKERLKRFGPGLV 201
           Y GK +KF+  R  IC  C+G GW+ K+  K +V  ++EC+ C G+G K    +  PG  
Sbjct: 121 YNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFY 180

Query: 202 ASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
            +Q V+C  C G GKY K+P +PKNFC DC G  L+   + I V++  G    D I +KG
Sbjct: 181 TTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKG 240

Query: 262 MADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD-DGAGEDLYTSITISLSEALTGFE 320
            ADEE+ K   GDL F + E         I   N D +  G  L     ISL+EA+TGFE
Sbjct: 241 EADEELGKKNAGDLIFEINE---------IIDSNNDLERYGNHLINHTHISLAEAITGFE 291

Query: 321 -KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPD 379
            KF+ KTFDDR L LS   G+V+RPGD +++ NEGWP +D      G+LYV + IEFPPD
Sbjct: 292 NKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP-MDKYGASFGNLYVILEIEFPPD 350

Query: 380 NWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHTDDLPEG 435
           NW NEK++++ I+  LP+  +  ++         +  N+E IS F I+ +    EG
Sbjct: 351 NWINEKNDIIKIRNILPNEKTKRNNIV-------DPINSEYISTFEIVKSLPQEEG 399

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/72 (56%), Positives = 54/72 (75%)

Query: 3  GSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYE 62
          GS      Y++LGV  DAT +EIK  YRKLAL++HPDK +D+  K +NEIKFK+ITAAY+
Sbjct: 6  GSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQ 65

Query: 63 ILSDPEKKSHYD 74
           LSD +K++ YD
Sbjct: 66 TLSDEDKRNEYD 77

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  210 bits (534), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 168/287 (58%), Gaps = 27/287 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y+GK  +F  +R+V+C +C GSG +  ++      + CE C G+G KER+ R GPGL++ 
Sbjct: 131 YLGKTFQFKARRKVLCPRCGGSGLR--KRAAARPMIRCEGCEGQGYKERISRIGPGLISR 188

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
           + V C  C GKGK  + P    + C  C G  ++ ++ II+V V  G    D +   G +
Sbjct: 189 ERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRYPGQS 246

Query: 264 DEEIDKTTCGDLKFHLTEKQE---NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
           D E  K T GDL F + E+ +   +LE+K           G DLY ++ ISL+EALTGF 
Sbjct: 247 DMEPGKET-GDLVFVIDEQTDVSSSLERK-----------GTDLYCTMKISLAEALTGFT 294

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDN 380
           + +T+TFD+R+L +++  G+V+RPG+ +K  NEGWPI D    R GD+YV V IEFP DN
Sbjct: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDG--ARFGDMYVQVLIEFPKDN 352

Query: 381 WFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRII 427
           WFNEK+EL AI+  LP     A   +  TED S   N E +  + II
Sbjct: 353 WFNEKAELDAIRNILP---GLADAPSTKTEDPS---NTEEVRAYSII 393

 Score = 84.0 bits (206), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 52/67 (77%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LY+VLG+   A+ QE+K AYR+LAL++HPDK  D+  +E +E KFKEI+AAY +LSD +K
Sbjct: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 70 KSHYDLY 76
          ++ YD +
Sbjct: 65 RAEYDQF 71

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  202 bits (515), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 169/294 (57%), Gaps = 25/294 (8%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK ++F  KR V+C +C G+G + + +    H   C  C G G K+RL+R GPG V  
Sbjct: 128 YNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVKQRLRRLGPGFVTR 183

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
           + V C+KC G GK  +     ++ C  C G  +  + + + V +  G    D + +KG A
Sbjct: 184 EIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEA 239

Query: 264 DEEIDKTTCGDLKFHLTEKQ--ENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEK 321
           DEE  K   GDL F + E     +LE++           G DLY  ITISLS+ALTGFEK
Sbjct: 240 DEEPGKIP-GDLVFDIAENSASSSLERR-----------GSDLYAKITISLSDALTGFEK 287

Query: 322 FLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNW 381
            +  T D RLL L V  G+VVRPG+ ++I NEGWP LD+   + GD+YV + IEFPPD+W
Sbjct: 288 EVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDMYVQIDIEFPPDHW 346

Query: 382 FNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHT-DDLPE 434
           F+E+S++ +++  LP + S ++ +  N    S+  N ET   F I+ + ++LP+
Sbjct: 347 FSERSDVKSLQNLLPQAVSSSATSDFNAS-ASDPANTETPLKFSIVKSAEELPQ 399

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y+ LGV  DAT  EIK AYR+LAL+HHPDK  D+  ++ +EIKFKE+ AAYE+LS+ EK+
Sbjct: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 71 SHYDLY 76
           +YD Y
Sbjct: 64 QNYDTY 69

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  188 bits (477), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 173/322 (53%), Gaps = 21/322 (6%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRK--IHVTHDVECESCAGKGSKERLKRFGPGLV 201
           Y GK +KF L R VIC  C G+ W+ ++   ++    + C  C G G  ERL    P   
Sbjct: 126 YNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSPFFQ 185

Query: 202 ASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
             Q + C KC GKG+YT +P + KN C  C G GL+ +K+ + V +  G   ++ I  K 
Sbjct: 186 YVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKE 245

Query: 262 MADEEIDKTTCGDLKFHLTEKQE-NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
             DE++     GD+ F L    E N     I +       G DL+ +I I L EA++G +
Sbjct: 246 KGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTK----EGTDLHMNIEIPLIEAISGTQ 301

Query: 321 -KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG-RCGDLYVFVHIEFPP 378
            +FLTKTFDDR+L L++  G+V+RPGDTI I  EGWP    P+G   GD++V V++EFPP
Sbjct: 302 GRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP--KTPNGTEFGDMFVHVNVEFPP 359

Query: 379 DNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHTDDLPEGIRP 438
           DNW +E++++  +   LP+  S   HA      D+N  N E + ++ I+   D  EG R 
Sbjct: 360 DNWISERNDITTLTNVLPAGKSDDGHAQTG---DAN--NAEFVKDYEILKATD--EGTR- 411

Query: 439 FKPEAQDSAHQKARSSY-CCIQ 459
                + ++   A+  Y C IQ
Sbjct: 412 -SSNTKTASRPPAQGLYKCSIQ 432

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 45/56 (80%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSD 66
          YD+LGV RD+T  EI+ AYRKLALK HPDK +D + K  NE+KFKEIT AYEILS+
Sbjct: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  187 bits (474), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 168/295 (56%), Gaps = 30/295 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTH-DVECESCAGKGSKERLKRFGPGLVA 202
           YMGK + F LKR+ +C  C G+G    RK H    ++ C SC G+G KER+ R   G + 
Sbjct: 208 YMGKTVTFQLKRKCLCPHCSGTGL---RKKHFQKPEISCTSCNGQGFKERITRLAGGYMV 264

Query: 203 SQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGM 262
               VC+ C GKG+Y  R K+  + C  C+G GL+++++  TV +  G    D   +  M
Sbjct: 265 KDHTVCDACKGKGRY--RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQM 322

Query: 263 ADEEIDKTTCGDLKFHLTE--KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
           AD E  K T GD+   + E   + +LE+K             DL+T++ ISL +ALTGF 
Sbjct: 323 ADMEYGKET-GDVIIVIDEDSSKSHLERK-----------SNDLHTTLNISLVDALTGFS 370

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDN 380
             + +T+D+R L ++V  G+V+RPG+  K   EGWP+ +      GD+YV ++IEFP DN
Sbjct: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG--DSFGDMYVQINIEFPKDN 428

Query: 381 WFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHT-DDLPE 434
           WFNEKSE+ A++  LP   S       +T+D   L N E + ++ ++H+ D+LP+
Sbjct: 429 WFNEKSEITALRNILPGLKS------KDTKDPDPL-NTEDVLSYSVLHSHDELPD 476

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 55/72 (76%)

Query: 5   DRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEIL 64
           D     YDVLGV +DAT  EI+ AYRKLALK+HPDK +D+  +E +E  FKE+TAAYEIL
Sbjct: 68  DMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEIL 127

Query: 65  SDPEKKSHYDLY 76
           SDPE KS YD+Y
Sbjct: 128 SDPELKSRYDMY 139

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  183 bits (465), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/255 (39%), Positives = 148/255 (58%), Gaps = 23/255 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK ++F   R V+C +C G+G + + +    H   C  C G G K+RL+R GPG V  
Sbjct: 128 YNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCEGHGVKQRLRRLGPGFVTR 183

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
           + V C KC G GK  +     ++ C  C G  +  + + + V +  G   ND I ++G A
Sbjct: 184 ETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEA 239

Query: 264 DEEIDKTTCGDLKFHLTEKQ--ENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEK 321
           DEE  K T GDL F ++E     NLE++           G DL+T I ISLS+ALTGFEK
Sbjct: 240 DEEPGKLT-GDLVFDISEDSTTSNLERR-----------GSDLHTKIIISLSDALTGFEK 287

Query: 322 FLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNW 381
            +  T D R L L +  G+V+RPG+ I + NEGWP LD+   + G++YV ++IEFPPD+W
Sbjct: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKKFGNMYVQINIEFPPDHW 346

Query: 382 FNEKSELLAIKTNLP 396
           ++E+ E+ A++  +P
Sbjct: 347 YSERGEIEALRNIIP 361

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD LGV  DAT  EIK AYR+LAL+HHPDK  D+  +E +EIKFKE+ AAYE+LS+ EK+
Sbjct: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 71 SHYDLY 76
           +YD Y
Sbjct: 64 RNYDTY 69

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 129/263 (49%), Gaps = 32/263 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K K  +      +C SC G+G K   ++ GP L   
Sbjct: 130 YKGRTAKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGVKFVTRQMGPMLQRF 183

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
           Q   CE C+G G       +PK+ C  C    + ++++I+ V++ PG      +  KG A
Sbjct: 184 Q-AECEVCHGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQKVVFKGEA 238

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F +++K     Q+          AG+DL     I L  A+ G E F 
Sbjct: 239 DQAPD-IIPGDVIFVVSQKPHEHFQR----------AGDDLVYEAEIDLLTAIAGGE-FA 286

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            K      L +++ PG V+ PG    I+++G PI    +G  G+L V  +I+FPP+++ +
Sbjct: 287 IKHVSGEWLKVAIVPGEVISPGARKIISDKGMPI--PKYGGYGNLIVKFNIKFPPNHFTD 344

Query: 384 EKS-----ELLA--IKTNLPSSS 399
           E+S     E+L    KTN+P  +
Sbjct: 345 EESLKKLEEILPPRTKTNIPEGA 367

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  A+  EIK AYRK ALK+HPDK   +++ E    KFKE +AAYE+LSD E
Sbjct: 6  KFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAE----KFKEASAAYEVLSDDE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KREMYDQF 69

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score = 99.0 bits (245), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 129/268 (48%), Gaps = 26/268 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           + G+  K  L +Q+IC  C G G K           +C +C+G+G K   ++ GP ++  
Sbjct: 125 FKGRTAKLALNKQLICKSCEGRGGKEGSV------KKCTACSGQGFKFVTRQMGP-MIQR 177

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
             V CE C+G G+      +PK  C  C+G  ++++++++ VN+ PG      I  +G A
Sbjct: 178 FQVECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRIVFQGEA 233

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+       GD+ F ++E+        +F ++     G DL+    I L  A+ G + F 
Sbjct: 234 DQS-PGIIPGDVVFVVSEQPH-----PVFKRD-----GNDLHYDAEIDLLSAIAGGQ-FA 281

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            K      L + + PG V+ PG    I  +G PI    +G  G+L +  +I+FPP ++ +
Sbjct: 282 VKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPI--PKYGGYGNLLIKFNIKFPPAHFTD 339

Query: 384 EKSELLAIKTNLPSSSSCASHATVNTED 411
           +++ L  ++  LP  +  +  A    ED
Sbjct: 340 DET-LKKLEEILPPRNVPSIPADAEVED 366

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   +IK AYRK ALK HPDK   +++ E    KFKEIT+AYEILSD +
Sbjct: 6  KLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE----KFKEITSAYEILSDSQ 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KREVYDQF 69

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score = 98.6 bits (244), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 119/268 (44%), Gaps = 26/268 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C+G G K           +C SC G+G K   ++ GP ++  
Sbjct: 129 YKGRTAKLALNKQILCKGCNGRGGKEGAV------KKCSSCNGQGYKFVTRQMGP-MIQR 181

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               CE C G G       +PK+ C  C G  + ++++I+ V+V PG      I  KG A
Sbjct: 182 FQTECEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDPGMKDGQKIVFKGEA 237

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++EK           KNF    G+DL     I L  A+ G E  L
Sbjct: 238 DQAPD-VIPGDVIFVVSEKPH---------KNFQR-VGDDLVYEAEIDLLTAVAGGEFSL 286

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L +++ PG V+ PG    +  +G PI     G  G+L V   I FPP N F 
Sbjct: 287 EHVSGD-WLKVAIVPGEVISPGMRKVVEGKGMPIAK--FGGYGNLLVTFKINFPP-NHFT 342

Query: 384 EKSELLAIKTNLPSSSSCASHATVNTED 411
               L  ++  LP  +     +  + ED
Sbjct: 343 SDENLKKLEEILPPRAKTTIPSKAHVED 370

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  AT  EIK AYRK ALK+HPDK    ++ E    KFKE+++AYE+LSD E
Sbjct: 6  KYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAE----KFKEVSSAYEVLSDSE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KRQVYDQF 69

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 124/253 (49%), Gaps = 26/253 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 127 YKGRTAKLALNKQILCKGCEGRGGKEGAV------KKCSSCGGQGVKFVTRQMGP-MIQR 179

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C +C G  + ++++++ V+V PG      +T KG A
Sbjct: 180 FQTECDVCHGSGDII----DPKDRCKECKGNKVANERKVLEVHVEPGMREGQKVTFKGEA 235

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F +TEK           K+F   +G+DL     + L  A+ G + F 
Sbjct: 236 DQAPD-IIPGDVIFVVTEKPH---------KHFKR-SGDDLLYEAEVDLLTAIAGGD-FA 283

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            +      L +++ PG V+ PG    I  +G P+    +G  G+L +   I+F P+N F 
Sbjct: 284 IEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPV--QKYGGYGNLIITFKIKF-PENHFA 340

Query: 384 EKSELLAIKTNLP 396
           ++++L A++  LP
Sbjct: 341 DEAKLKALEDILP 353

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+ +A+  EIK  YRK ALK+HPDK    ++ E    KFKE + AYE+LSD +
Sbjct: 6  KFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAE----KFKECSGAYEVLSDSQ 61

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 62 KREIYDQY 69

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 135/299 (45%), Gaps = 32/299 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  K  L +Q++C  C G G K K  +      +C SC G+G K   ++ GP ++  
Sbjct: 127 YKGKTSKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMGP-MIQR 179

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       + K+ C DC G  + ++++I+ VNV PG      +  KG A
Sbjct: 180 FQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQKVVFKGEA 235

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++EK     Q+           G+DL     I L  A+ G E F 
Sbjct: 236 DQAPD-IIPGDVIFVISEKPHKHFQR----------VGDDLIYEAEIDLLTAVAGGE-FA 283

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            +      L +S+ PG V+ P     +  +G PI    +G  G+L +   I+FP +++ +
Sbjct: 284 LEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPI--QKYGGYGNLIIKFSIKFPENHFAD 341

Query: 384 EKS-----ELLAIKTNLPS--SSSCASHATVNTEDDSNLTNNETISNFRIIHTDDLPEG 435
           E +     E+L  +  LP+   ++      ++  + S   N+         H+DD  EG
Sbjct: 342 EDTLKKLEEILPARKPLPTFPKNAIVDDCVLSDYNPSRHDNSRGARGGASYHSDDEDEG 400

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 4/71 (5%)

Query: 6  RGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILS 65
          R  +LYD+LGV+  A+  EIK AYRK ALK+HPDK   +++ E    KFKE ++AYE+LS
Sbjct: 3  RETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DSEKRDIYDQF 69

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 120/253 (47%), Gaps = 26/253 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L + V+C +C G G K           +C SC G+G K   +  GP ++  
Sbjct: 129 YKGRAAKLALNKTVLCKRCEGRGGK------AGSVKKCTSCNGQGVKFVTRHMGP-MIQR 181

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               CE CNG+G          + C DC G  + S+++I+ VN+ PG      I  +G A
Sbjct: 182 FQTTCEVCNGEGDVIP----AADRCKDCDGKKIASERKILEVNIQPGMKHGQKIVFQGEA 237

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D++  +   GD+ F + E++        F++N     G++L+    I L  A+ G +  L
Sbjct: 238 DQQPGQIP-GDVVFVVNEQEHPR-----FVRN-----GDNLHYEAEIDLLTAIAGGQFAL 286

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    I  +G PI    +G  GDL +  +++FP  ++ +
Sbjct: 287 EHVSGD-WLKIDIVPGEVIAPGMVKVIEGKGMPI--QKYGSYGDLLIKFNVKFPKSHFAD 343

Query: 384 EKSELLAIKTNLP 396
           E++ L  ++  LP
Sbjct: 344 EEA-LKKLEAILP 355

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+ DA   +IK AYRK ALK+HPDK   +++ +    KFK+IT AYEILSD +
Sbjct: 6  KLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD----KFKQITGAYEILSDSQ 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KREMYD 67

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 120/268 (44%), Gaps = 26/268 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   K+ GP ++  
Sbjct: 129 YKGRTAKLALNKQILCKSCEGRGGK------ADAVKKCSSCGGQGIKFVTKQMGP-MIQR 181

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK  C  C G  + ++++I+ V + PG      I  KG +
Sbjct: 182 FQTECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIEPGMKDGQRIVFKGES 237

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F + EK     Q+          +G DL     I L  A+ G E F 
Sbjct: 238 DQAPD-IIPGDVVFVVNEKPHKHFQR----------SGNDLVYLAEIDLLTAIAGGE-FA 285

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            +      L +++  G V+ PG    I  +G PIL   +G  G+L +  +I+F P+N F 
Sbjct: 286 LEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILK--YGGYGNLIIQFNIKF-PENHFT 342

Query: 384 EKSELLAIKTNLPSSSSCASHATVNTED 411
           ++S L  ++  LP  +     A    E+
Sbjct: 343 DESNLKKLEEILPPRNKVTIPAKAEVEE 370

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  A+  EIK  YRK ALK+HPDK    ++ E    KFKE +AAYE+LSDPE
Sbjct: 6  KFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAE----KFKECSAAYEVLSDPE 61

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 62 KRDVYDQY 69

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 127/269 (47%), Gaps = 28/269 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +QV+C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 128 YKGRTAKLALNKQVLCKTCEGRGGKEGAV------KKCASCNGQGVKFITRQMGP-MIQR 180

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ CNG G       +PK+ C  C G  + ++++I+ V++ PG      I  +G A
Sbjct: 181 FQAECDACNGTGDIV----DPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQKIVFQGEA 236

Query: 264 DEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKF 322
           D +      GD+ F ++++  ++ E+K           G++LY    + L  A+ G E F
Sbjct: 237 D-QAPGVIPGDVIFVISQRPHKHFERK-----------GDNLYYQAEVDLLSAIAGGE-F 283

Query: 323 LTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWF 382
             +      L + + PG V+ PG T  I  +G P+    +G  GDL V   + FP +++ 
Sbjct: 284 AIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPV--QKYGGFGDLIVTFKVNFPTNHFA 341

Query: 383 NEKSELLAIKTNLPSSSSCASHATVNTED 411
           +E+S L  ++  LP  +  +   + + E+
Sbjct: 342 DEES-LKKLEEILPPRAKPSFPKSADVEE 369

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV  DA   +IK  YRK ALK HPDK    ++ +    KFKE+T AYE+LSD +
Sbjct: 6  KFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAAD----KFKELTVAYEVLSDSQ 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KRDIYD 67

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 112/253 (44%), Gaps = 26/253 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 129 YKGRTAKLALNKQILCKSCEGRGGK------AGAVKKCSSCNGQGFKFITRQMGP-MIQR 181

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ CNG G       + K+ C  C G  + ++++I+ V++ PG      I  +G A
Sbjct: 182 FQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIEPGMKDGQKIVFQGEA 237

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D      +        E   +K           G+DLY    + L  A+ G E F 
Sbjct: 238 DQAPDVVPGDVVFVVSERPHERFNRK-----------GDDLYYEAEVDLLTAIAGGE-FA 285

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            +      L + + PG V+ PG T  I  +G P+    +G  G+L V   I+FPP N F 
Sbjct: 286 VQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPV--QKYGGFGNLIVKFKIKFPP-NHFA 342

Query: 384 EKSELLAIKTNLP 396
           +++ L  ++  LP
Sbjct: 343 DEASLKQLENILP 355

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD++GV+  A   +IK AYRK ALK+HPDK   +++ E    KFKEI++AYEILSD +
Sbjct: 6  KLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAE----KFKEISSAYEILSDSQ 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KREMYD 67

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 97.1 bits (240), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 113/251 (45%), Gaps = 42/251 (16%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GKK K  L R  +C+ C G G   K K        C +C G GS  + +R GP ++ +
Sbjct: 179 YYGKKTKLRLDRTRLCVLCMGQGSMKKSK--------CFTCNGLGSLTQTRRMGP-MIQT 229

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G G + KR     + C  C+G G + +++I  V + PG     VI + G A
Sbjct: 230 FSQSCPDCQGSGMFVKR----SDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEA 285

Query: 264 DEEID------KTTCGDLKFHLTEKQEN----LEQKQIFLKNFDDGAGEDLYTSITISLS 313
           DE ++      K   GD+   + + ++N    +    + L NF            +++LS
Sbjct: 286 DEVVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNF------------SVNLS 333

Query: 314 EALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILD--NPHGRC-----G 366
           +AL G   F++      L+ + + PG ++ PG    +AN G P  +  +P         G
Sbjct: 334 KALCGGTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKG 393

Query: 367 DLYVFVHIEFP 377
           +LYV   I+FP
Sbjct: 394 NLYVKFDIKFP 404

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD+L ++ +A  ++IK AYR LALK+HPDK    +  E +++ F++I+ AYE+L D EK
Sbjct: 7  LYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDVEK 63

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 64 RKLYDQY 70

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score = 95.9 bits (237), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 124/268 (46%), Gaps = 26/268 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 127 YKGRTAKLALNKQILCKTCEGRGGK------AGAVKKCTSCNGQGIKFVTRQMGP-MIQR 179

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C DC G  + ++++++ V+V PG      I  KG A
Sbjct: 180 FQTECDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEPGMREGQKIVFKGEA 235

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F + EK           K+F   AG+DL     I L  A+ G E F 
Sbjct: 236 DQAPD-VIPGDVIFVVVEKPH---------KHFKR-AGDDLLYEAEIDLLTAIAGGE-FA 283

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            +      L +S  PG V+  G    I  +G P+    +G  G+L V   I+FP +N+  
Sbjct: 284 IQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPV--PKYGGYGNLIVTFKIKFPENNFAT 341

Query: 384 EKSELLAIKTNLPSSSSCASHATVNTED 411
           E  +L  ++  LP+ +  +  A  + ++
Sbjct: 342 E-DKLKELENILPARTPVSIPAKASIDE 368

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+ +A+  EIK  YRK ALK+HPDK   +++ E    KFKE +AAYE+LSD +
Sbjct: 6  KFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE----KFKECSAAYEVLSDSQ 61

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 62 KREVYDQY 69

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 121/253 (47%), Gaps = 26/253 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L + V+C  C G G K           +C SC G G K   ++ GP ++  
Sbjct: 128 YKGRTAKLALNKTVLCKSCEGRGGKS------GSVKKCSSCGGHGVKFVTRQMGP-MIQR 180

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               CE CNG+G       +PK+ C +C+G  + ++++I+ VN+ PG      +  +G A
Sbjct: 181 FQTTCEACNGEGDVI----DPKDRCRECSGKKISNERKILEVNIEPGMKNGQKVVFQGEA 236

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D++  +   GD+ F + E++        F++N     G++L+    I L  A+ G +  L
Sbjct: 237 DQQPGQIP-GDVVFVVNEQEHPK-----FVRN-----GDNLHYEAQIDLLTAVAGGQFAL 285

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    I  +G PI    +G  G+L +  +++F P + F 
Sbjct: 286 EHVSGD-WLKVDIVPGEVIAPGMVKVIEGKGMPI--QKYGSYGNLLIKFNVKF-PKSHFA 341

Query: 384 EKSELLAIKTNLP 396
             ++L  ++  LP
Sbjct: 342 SDADLKKLEEILP 354

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+ DA   +IK AYRK ALK+HPDK    ++ +    KFK++TAAYEILSD +
Sbjct: 6  KLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD----KFKQMTAAYEILSDSQ 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KREVYD 67

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 109/244 (44%), Gaps = 29/244 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  K  L R  +C+ C+G G   +          CESC G G + + +R GP +V +
Sbjct: 166 YNGKMAKLALNRTRLCLPCNGFGGLQR--------TTCESCQGDGFQTQTRRMGP-MVQT 216

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C+G G + K    P + CP C G G + +++I  V V PG      + ++G A
Sbjct: 217 WTQTCASCDGAGCFIK----PNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEA 272

Query: 264 DEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           DE +      +K   GD+   +T KQ   E     + N  D     L     + L  +L 
Sbjct: 273 DEIMLNNLVKEKVIPGDVV--ITIKQSRDENNCFQMINNKDL----LMNGCPVDLVTSLC 326

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPIL----DNPHGRCGDLYVFVH 373
           G E ++      +L+ L + PG +++P     I   G P L    D+   R GDLY+   
Sbjct: 327 GGEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFK 386

Query: 374 IEFP 377
           I++P
Sbjct: 387 IQYP 390

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 6  RGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILS 65
          R  +LY+ L V   AT  +IK AY+KLALK+HPDK    +  E ++ KF+ +  AYEIL+
Sbjct: 3  RDTKLYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILN 59

Query: 66 DPEKKSHYD 74
          D + ++ YD
Sbjct: 60 DKQSRAIYD 68

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 126/269 (46%), Gaps = 28/269 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 129 YKGRTAKLALNKQILCKTCEGRGGK------AGAVKKCSSCNGQGIKFITRQMGP-MIQR 181

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C G  + ++++I+ V++ PG      I  +G A
Sbjct: 182 FQAECDVCSGTGDII----DPKDRCKSCNGKKIDNERKILEVHIEPGMKDGQKIVFQGEA 237

Query: 264 DEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKF 322
           D +      GD+ F ++++  ++ E+K           G+DL     + L  A+ G E F
Sbjct: 238 D-QAPGIIPGDVVFVISQRPHKHFERK-----------GDDLLYQAEVDLLSAIAGGE-F 284

Query: 323 LTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWF 382
             +      L +S+ PG V+ PG T  I  +G PI    +G  G+L V   I FP +++ 
Sbjct: 285 AIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPI--QKYGGYGNLIVTFKINFPTNHFA 342

Query: 383 NEKSELLAIKTNLPSSSSCASHATVNTED 411
           +E+S L  ++  LP  S  +   +   E+
Sbjct: 343 DEES-LKKLEEILPPRSKPSIPKSAEVEE 370

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+ DA   +IK AYRK ALK HPDK   +++ +    KFKE+T AYEILSD +
Sbjct: 6  KFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAAD----KFKELTVAYEILSDSQ 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KRDIYD 67

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 141/318 (44%), Gaps = 37/318 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           + GK+ K  L R  +C +C G G K           +C  C G G     KR GP +V +
Sbjct: 177 FHGKRAKLALNRTRLCQRCQGYGGKKA--------TQCRGCQGTGLFTTTKRMGP-MVQT 227

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C++C+G GKY +     K+ C +C+G G + +++   V V PG    + I + G A
Sbjct: 228 WQTTCKECSGTGKYIR----SKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEA 283

Query: 264 DEEID------KTTCGD--LKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEA 315
           DE I+      +   GD  +   LT  +E+  + +  + + D      +  +  + L  +
Sbjct: 284 DEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHD-----LILDNFEVDLKTS 338

Query: 316 LTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIE 375
           L G    +          + V  G +++PG    + N+G P+  N  G  G+LY+   ++
Sbjct: 339 LCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSN--GNFGNLYIRFRVK 396

Query: 376 FP---PDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHTDDL 432
           FP     +  N+ SE+L    N+ S  S + +      + S++   + +S F    T+DL
Sbjct: 397 FPEQLKSDTINKLSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLSTFT---TEDL 453

Query: 433 PEGIRPFKPEAQDSAHQK 450
                 FK   +DS +++
Sbjct: 454 QS---KFKNAKRDSPNKR 468

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIK-FKEITAAYEILSDP 67
          +LYD+L V   AT QEIK AYRK ALKHHPDK    ++     IK F++I+ AYE LS+ 
Sbjct: 6  KLYDILEVNTTATEQEIKKAYRKKALKHHPDK----NNHSAESIKLFQDISHAYETLSNS 61

Query: 68 EKKSHYDLY 76
           K+  YD Y
Sbjct: 62 NKRELYDQY 70

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 121/258 (46%), Gaps = 30/258 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  K  L +Q++C  C G G K K  +      +C SC G+G K   ++ GP ++  
Sbjct: 127 YRGKTSKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMGP-MIQR 179

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C G  + S+++I+ V+V PG      +  KG A
Sbjct: 180 FQTECDVCHGAGDIV----DPKDRCKSCNGKKVASERKILEVHVDPGMKNGQKVVFKGEA 235

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F + EK     Q+          +G++L     + L  A+ G E F 
Sbjct: 236 DQAPD-VIPGDVVFVINEKPHKHFQR----------SGDNLVYEAEVDLLTAIAGGE-FA 283

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
            +      L +++ PG V+ PG    I  +G P+    +G  G+L +   ++FP  ++  
Sbjct: 284 IEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAK--YGGYGNLIIKFTVKFPEPHFTT 341

Query: 384 EKS-----ELLAIKTNLP 396
           E++     E+L  +T LP
Sbjct: 342 EENLKKLEEILPQRTPLP 359

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYDVLGV+  AT  EIK AYRK+ALK HPDK   +++ E    KFKE ++AYE+LSD +
Sbjct: 6  KLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAE----KFKEASSAYEVLSDAD 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KRDTYDQF 69

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 98/428 (22%), Positives = 162/428 (37%), Gaps = 50/428 (11%)

Query: 9   RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
           RLYDVLGV    +  E+K +Y+  AL++HPDK       E ++ +F++I  AY +L D  
Sbjct: 6   RLYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDER 62

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGEYDAYEEGNXXX 128
            +  YD Y                                      PG+  A+  G+   
Sbjct: 63  LRKIYDRY---------------GTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQG 107

Query: 129 XXXXXXXXXXXXXXXYMGKKLKF-DLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGK 187
                             +  +  D+K ++ C      G K  R + +T    C  CAG+
Sbjct: 108 LGSFAIFGESGASSARCSRVSRGPDIKHKLRCTLEELYGGKVVR-LALTRTRLCTLCAGR 166

Query: 188 GSKE--------------RLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAG 233
           G                 + KR G  LV +    C  C+G G   K      + C  C G
Sbjct: 167 GGSRASTCTACSGQGICSQTKRQGS-LVQTWSSTCRVCSGSGTIVK----DCDTCTSCGG 221

Query: 234 LGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFL 293
            G L ++++  V + PG      +   G ADE ++ T  G  +    +    +E+     
Sbjct: 222 AGYLRERKVFEVEIRPGMRAGSEVVFPGEADEVVN-TPYGKEQVLPGDLAITIEEATPAT 280

Query: 294 KNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANE 353
           +    G    L T + + L  +L G   ++      +L+ L + PG ++ PG    I + 
Sbjct: 281 RYQCRGDANLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHL 340

Query: 354 GWPILDNPHGRCGDLYVFVHIEFP---PDNWFNEKSELLAIKTNL------PSSSSCASH 404
           G P  D+P  + G L++  H++FP    D+     ++ L   TN+       ++  C  H
Sbjct: 341 GMPHPDDP-SQYGHLFIKFHVDFPKTLADSTITAIAQALDADTNVRTRTPPAAADGCEEH 399

Query: 405 ATVNTEDD 412
              N   D
Sbjct: 400 VLSNFHHD 407

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 122/268 (45%), Gaps = 26/268 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K K  +      +C SC G+G K   ++ GP ++  
Sbjct: 131 YKGRTAKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGVKFVTRQMGP-MIQR 183

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C    + ++++I+ V++ PG      I  KG A
Sbjct: 184 FQAECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQNIVFKGEA 239

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F + +K     Q+          +G+DL     I L  A+ G E  L
Sbjct: 240 DQAPD-VIPGDVIFVVAQKPHKHFQR----------SGDDLVYEAEIDLLTAIAGGEFAL 288

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L +S+ PG V+ PG    I  +G PI    +G  G+L V   ++FP  ++ +
Sbjct: 289 EHVSGD-WLKVSILPGEVISPGSKKVIEGKGMPI--PKYGGHGNLIVHFTVKFPQKHFAD 345

Query: 384 EKSELLAIKTNLPSSSSCASHATVNTED 411
           E S L  ++  LP     +  A    +D
Sbjct: 346 EDS-LKKLEEILPPRKKISIPANATVDD 372

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYDVLGV+  A   EIK AYRK ALK+HPDK   ++  E    KFKE++AAYEILSD E
Sbjct: 6  KLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAE----KFKEVSAAYEILSDSE 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KREIYD 67

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 86/344 (25%), Positives = 139/344 (40%), Gaps = 53/344 (15%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           YMGK  K  L R  IC  C G G   K          C++C G+G + +  R GP LV S
Sbjct: 195 YMGKTAKLGLNRTRICQVCDGHGGLKK--------YACKTCKGQGVQTQTNRMGP-LVQS 245

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G G + +     K+ C  C GLG + +++I+ V V PG   N +I + G  
Sbjct: 246 WSQTCADCGGAGIFVES----KDICQQCQGLGFVKQRKILQVAVQPGSCHNQLIVLTGEG 301

Query: 264 DEEI-------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEAL 316
           DE I       +K   GD+   +      L  K    +  DD     +Y    + L  +L
Sbjct: 302 DEVISSKGGGHEKIIPGDVVITI------LRLKDPRFQIVDD--YNLIYKKCKVDLMTSL 353

Query: 317 TGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP-ILDNPHGRCGDLYVFVHIE 375
            G   ++      +L+ L + PG V++PG    + N G P  ++      G +YV   + 
Sbjct: 354 CGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYVKFEVT 413

Query: 376 FP----PDNWFNEKSELLA---IKTNLPSSSSCASHATVNTEDDSNLTNNETISNF---- 424
           +P    P+N    +  L     ++    +  +  +    + E   N+     +S+F    
Sbjct: 414 YPRRLEPENAIKLQKVLANDKYVQNERSAMETADADCYCDLERSYNVVEEHVLSSFEAPD 473

Query: 425 ---RIIHTDDLPEGI----------RPFKPEAQDSAHQKARSSY 455
               II  DDL + I          R F   +  ++++  R+ Y
Sbjct: 474 MKSEIIENDDLDDLINERDSRKRNNRRFGESSNSNSNETKRNKY 517

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT  A+  EIK AYR  ALK+HPDK    +  E ++ KF+EI  AYE L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHL 63

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 64 RSLYDQY 70

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 118/253 (46%), Gaps = 26/253 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K K  +      +C SC G+G K   ++ GP ++  
Sbjct: 128 YKGRTAKLALNKQILCKGCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMGP-MIQR 180

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C G  + ++++I+ V+V PG      I  KG A
Sbjct: 181 FQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEA 236

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++E+           KNF    G+DL     I L  A+ G E  L
Sbjct: 237 DQAPD-VIPGDVVFIVSERPH---------KNFKR-DGDDLVYEAEIDLLTAIAGGEFAL 285

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    I  +G PI    +G  G+L +   I+F P+N F 
Sbjct: 286 EHVSGD-WLKVGIVPGEVISPGMRKVIEGKGMPI--PKYGGYGNLVIKFTIKF-PENHFT 341

Query: 384 EKSELLAIKTNLP 396
            +  L  ++  LP
Sbjct: 342 TEENLKKLEEILP 354

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  AT  EIK AYRK ALK+HPDK   +++ E    KFKE ++AYEILSD E
Sbjct: 6  KFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KREVYDQF 69

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 118/268 (44%), Gaps = 26/268 (9%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 126 YKGRTAKLALNKQILCKSCEGRGGKE------GAVKKCSSCNGQGIKFVTRQMGP-MIQR 178

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       + K+ C  C G  + ++++I+ V + PG      I  KG A
Sbjct: 179 FQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKIVFKGEA 234

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++EK     Q+          AG+DL     I L  AL G +  L
Sbjct: 235 DQAPD-VIPGDVVFVISEKPHKHFQR----------AGDDLIYEAEIDLLTALAGGQFAL 283

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    +  +G PI    +G  G+L +  +I+F P+N F 
Sbjct: 284 EHVSGD-WLKVDIVPGEVIAPGARKIVEGKGMPI--QKYGGYGNLLIKFNIKF-PENHFT 339

Query: 384 EKSELLAIKTNLPSSSSCASHATVNTED 411
            +  L  ++  LP        A    +D
Sbjct: 340 SEENLKKLEEILPPRRQINIPAKAQVDD 367

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 49/68 (72%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD LGV+  A+  EIK AYRK ALK+HPDK   +++ E    KFKE+++AYEILSD +
Sbjct: 6  KLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE----KFKEVSSAYEILSDSQ 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KREVYDQF 69

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 123/263 (46%), Gaps = 32/263 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K           +C SC G+G K   ++ GP ++  
Sbjct: 130 YKGRTSKLALNKQILCKTCEGRGGKEGAV------KKCTSCNGQGVKFITRQMGP-MIQR 182

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       NPK+ C  C+G  + ++++I+ V+V PG      I  KG A
Sbjct: 183 FQTECDACDGTGDII----NPKDRCKACSGKKVANERKILEVHVDPGMKDGQKIVFKGEA 238

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++E+       + F ++ D     DL     I L  A+ G E F 
Sbjct: 239 DQAPD-IIPGDVIFVVSERPH-----KHFRRDSD-----DLVYEADIDLLTAIAGGE-FA 286

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNW-- 381
            +      L + + PG V+ PG    I  +G P+L   +G  G+L V  +I FP D++  
Sbjct: 287 IEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLK--YGGFGNLLVKFNIVFPKDHFTS 344

Query: 382 ---FNEKSELLAI--KTNLPSSS 399
                +  E+L    KT++PS +
Sbjct: 345 LENMKKLEEILPPRKKTSIPSKA 367

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  A+  EIK AYRK ALK+HPDK   +++ E    KFKE ++AYE+L D E
Sbjct: 6  KFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE----KFKEASSAYEVLMDAE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KREAYDQF 69

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 118/253 (46%), Gaps = 26/253 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C +C G G K K  +      +C SC G+G K   ++ GP ++  
Sbjct: 128 YKGRTAKLALNKQILCKECEGRGGK-KGAVK-----KCTSCNGQGIKFVTRQMGP-MIQR 180

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C G  + ++++I+ V+V PG      I  KG A
Sbjct: 181 FQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEA 236

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++E+     ++           G+DL     I L  A+ G E  L
Sbjct: 237 DQAPD-VIPGDVVFIVSERPHKSFKRD----------GDDLVYEAEIDLLTAIAGGEFAL 285

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    I  +G PI    +G  G+L +   I+F P+N F 
Sbjct: 286 EHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPI--PKYGGYGNLIIKFTIKF-PENHFT 341

Query: 384 EKSELLAIKTNLP 396
            +  L  ++  LP
Sbjct: 342 SEENLKKLEEILP 354

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV   AT  EIK AYRK ALK+HPDK   +++ E    KFKE +AAYEILSDPE
Sbjct: 6  KFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASAAYEILSDPE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KRDIYDQF 69

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 124/267 (46%), Gaps = 28/267 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C +C G G K K  +      +C  C G+G K   ++ GP ++  
Sbjct: 128 YKGRTAKLALNKQILCKECEGRGGK-KGAVK-----KCTGCNGQGIKFVTRQMGP-MIQR 180

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C G  + ++++I+ V+V PG      I  KG A
Sbjct: 181 FQTECDACHGTGDIV----DPKDRCKSCNGKKIENERKILEVHVEPGMKDGQKIVFKGEA 236

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++E+     ++           G+DL     I L  A+ G E  L
Sbjct: 237 DQAPD-VIPGDVVFLVSERPHKHFKRD----------GDDLVYEAEIDLLTAIAGGEFAL 285

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    I  +G P+    +G  G+L V   I+F P+N F 
Sbjct: 286 EHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPV--PKYGGYGNLIVKFTIKF-PENHFT 341

Query: 384 EKSELLAIKTNLP--SSSSCASHATVN 408
            +  L  ++  LP  ++ +    ATV+
Sbjct: 342 TEENLKKLEEILPPRATPTIPKKATVD 368

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  AT  EIK AYRK ALK HPDK   +++ E    KFKE ++AYE+LSD E
Sbjct: 6  KFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE----KFKEASSAYEVLSDSE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KREVYDQF 69

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 90.5 bits (223), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 111/267 (41%), Gaps = 53/267 (19%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           YMGK  K  L R  IC  C G G   K          C+ C G+G + + KR GP LV S
Sbjct: 198 YMGKTAKLGLNRTRICHVCDGHGGLRK--------YTCKPCKGQGIQTQTKRMGP-LVQS 248

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G G + K     K+ C  C GLG + +++I+ V V PG   N +I + G  
Sbjct: 249 WSQTCADCGGAGTFVKN----KDICEQCQGLGFIKQRKILQVTVQPGSCHNQLIVLTGEG 304

Query: 264 DEEI-------DKTTCGDL----------KFHLTEKQENLEQKQIFLKNFDDGAGEDLYT 306
           DE I       +K   GD+          KF +T+  + + +K                 
Sbjct: 305 DEVISTKGGGREKVIPGDVVITILRLKDPKFQITDNCDLICKK----------------- 347

Query: 307 SITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP-ILDNPHGRC 365
              + L  +L G   ++      +L+ + + PG V++PG    + N G P  ++      
Sbjct: 348 -CEVDLMTSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGF 406

Query: 366 GDLYVFVHIEFP----PDNWFNEKSEL 388
           G LYV   + +P    P+N    KS L
Sbjct: 407 GHLYVKFDVTYPERLEPENAAKVKSIL 433

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT  A+  EIK AYR  ALK+HPDK    +  E ++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 64 RSLYDQY 70

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 118/254 (46%), Gaps = 20/254 (7%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  K  L R+ +C  C G G   +R         C++C G+G +   +R GP +V +
Sbjct: 177 YDGKITKLGLNRRRMCQSCQGQGSLRRRT--------CKTCRGQGQQTETRRTGP-MVQT 227

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  CNG G YTK+     + C +C G   + +++I  V V+ G      I + G A
Sbjct: 228 WTQTCPDCNGLGTYTKQA----DVCHECRGESYIKERKIFDVEVSKGMCHGQTIVLPGEA 283

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYT-SITISLSEALTGFEKF 322
           DE I KT+ G  K    +    ++Q +    +  +  G DL   S +I LS +L G + +
Sbjct: 284 DELI-KTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIY 342

Query: 323 LTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP----P 378
           +      +LL +S+ PG ++ P     I   G P   +  G+ G+LY+   +E+P    P
Sbjct: 343 IDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGK-GNLYIQFQLEYPVGLEP 401

Query: 379 DNWFNEKSELLAIK 392
           D     +S LL  K
Sbjct: 402 DTIGRLQSVLLQDK 415

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 6  RGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDK-YVDQDSKEVNEIKFKEITAAYEIL 64
          R  RLYD L V+ DAT+ EIK AY+ +ALK+HPDK +  +D+K     KF+E+  AYEIL
Sbjct: 3  RDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKN----KFQEVCKAYEIL 58

Query: 65 SDPEKKSHYDLY 76
          +D +K+  YD Y
Sbjct: 59 ADEDKRVMYDRY 70

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 123/267 (46%), Gaps = 28/267 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G+  K  L +Q++C  C G G K K  +      +C SC G+G K   ++ GP ++  
Sbjct: 129 YKGRTAKLALNKQILCKGCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMGP-MIQR 181

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C+G G       +PK+ C  C G  + ++++I+ V+V PG      I  KG A
Sbjct: 182 FQTECDVCHGTGDIV----DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEA 237

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           D+  D    GD+ F ++E+     ++           G+DL     I L  A+ G E  L
Sbjct: 238 DQAPD-VIPGDVVFLVSERPHKSFKRD----------GDDLVYEAEIDLLTAIAGGEFAL 286

Query: 324 TKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFN 383
                D  L + + PG V+ PG    I  +G P+    +G  G+L +   ++F P+N F 
Sbjct: 287 EHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPV--PKYGGYGNLIIKFTVKF-PENHFT 342

Query: 384 EKSELLAIKTNLPSSSSCA--SHATVN 408
            +  L  ++  LP  +  A    ATV+
Sbjct: 343 AEENLKKLEEILPPRTVPAIPKKATVD 369

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+  AT  EIK AYRK ALK+HPDK   +++ E    KFKE ++AYEILSD E
Sbjct: 6  KFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSE 61

Query: 69 KKSHYDLY 76
          K+  YD +
Sbjct: 62 KRDVYDQF 69

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 104/242 (42%), Gaps = 29/242 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           YMGK  K  L R  IC  C G G   K          C++C G+G + + +R GP LV S
Sbjct: 191 YMGKTAKLGLNRTRICSVCDGHGGLKK--------CTCKTCKGQGIQTQTRRMGP-LVQS 241

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G G + K     K+ C  C GLG + +++I+ V V PG   N +I + G  
Sbjct: 242 WSQTCADCGGAGVFVKN----KDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEG 297

Query: 264 DEEI-------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEAL 316
           DE I       +K   GD+   +      L+     + N+ +     +     I    +L
Sbjct: 298 DEVISTKGGGHEKVIPGDVVITILR----LKDPNFQVINYSNL----ICKKCKIDFMTSL 349

Query: 317 TGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP-ILDNPHGRCGDLYVFVHIE 375
            G   ++      +L+ L + PG +++PG    + + G P  ++      G LYV   + 
Sbjct: 350 CGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVT 409

Query: 376 FP 377
           +P
Sbjct: 410 YP 411

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT  A+  EIK AYR  ALK+HPDK    +  E ++ KF+EI  AYEIL D   
Sbjct: 7  LYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRL 63

Query: 70 KSHYDLY 76
          ++ YD Y
Sbjct: 64 RALYDQY 70

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 116/287 (40%), Gaps = 32/287 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK+ K  LKR  +C KC G G             +C +C G+G +   KR GP +V +
Sbjct: 153 YHGKRAKLALKRTRLCKKCKGEGG--------LKASQCYTCGGRGIRTETKRHGP-MVQT 203

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G+G + K+    K+ C DC G G + ++ I  + V  G      + + G A
Sbjct: 204 WSSTCSDCAGRGSFMKQ----KDICRDCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEA 259

Query: 264 DEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           DE +      +    GD+   L    E L  K  F ++ D      +     + L  +L 
Sbjct: 260 DEVVGSELGSEHVIPGDVIIIL----EQLPHK-AFWRHRDASL---VLDHCKVDLKTSLC 311

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           G   ++      +LL + V PG +++PG    +   G P      GR G+LY+   + FP
Sbjct: 312 GGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP---KSGGRFGNLYIRFDVAFP 368

Query: 378 PDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNF 424
                     L A     P ++S A    V  E          +SNF
Sbjct: 369 ESLKPETVEALRAALGQEPGANSGAGEPAVAVE--GREVEEHVLSNF 413

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score = 87.4 bits (215), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 108/243 (44%), Gaps = 29/243 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  K  L R+ +C  C G G    R         C++C G+G + R ++ GP ++ +
Sbjct: 150 YEGKNTKLGLNRRRVCKACKGRGSMKVRT--------CKACRGRGQQSRSRQMGP-MMQT 200

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  CNG G +TK      + C DC G G + +++I  V V PG      I + G A
Sbjct: 201 WTQTCSDCNGMGTFTK----DSDVCRDCEGEGCIRERKIFDVEVKPGMCQGQQIILPGEA 256

Query: 264 DEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           DE I      +    GD+   +      ++ K    +  +    + +  +  I L  +L 
Sbjct: 257 DEVIKTRFGNETVIPGDVIITI------IQIKDPKFQRVNRNGCDLMVRNCKIPLVTSLC 310

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN---PHGRCGDLYVFVHI 374
           G +  +    + +L+ +++ PG +++P     I N G P  +    P G  G+LY+   +
Sbjct: 311 GGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYEEKRAPEGY-GNLYIQFQV 369

Query: 375 EFP 377
           EFP
Sbjct: 370 EFP 372

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          RLYDVL V+ +A+  EI+ AYR LALKHHPDK    +  E ++ KF E+  AYEIL D +
Sbjct: 6  RLYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEK 62

Query: 69 KKSHYDLY 76
          K+S YD Y
Sbjct: 63 KRSLYDQY 70

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 115/264 (43%), Gaps = 34/264 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GKK K  L R  +C  C G+G         T    C +C G+G   + +R GP +V +
Sbjct: 152 YHGKKSKLRLDRTRLCKTCKGNGG--------TSSSACRACNGQGFYTQTRRHGP-MVQT 202

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C G G + +R    K+ C +C G G + +++I  + V PG H    I +   A
Sbjct: 203 WSTTCQDCGGSGTFVRR----KDVCSECKGQGCIKERKIFEIEVQPGMHHGQEIVLPEEA 258

Query: 264 DEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           DE +      ++   GD+   + + +  L Q    + N  D    D +    + L  +L 
Sbjct: 259 DEIVYTTYGKEQVNPGDVIIIVQQVKHPLFQ----IHNDTDLVMNDCH----VDLKTSLC 310

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGR-CGDLYVFVHIEF 376
           G E  +        L + V PG +++PG    + + G P   +P  +  G+LY+   ++F
Sbjct: 311 GGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMP---HPQSQGFGNLYIRFQVDF 367

Query: 377 PPD---NWFNEKSELLAIKTNLPS 397
           P        N+ SELL    N  S
Sbjct: 368 PDKLQLETINKVSELLGKDENCLS 391

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 4  SDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEI 63
          S +   LYD L ++ DAT QEIK AYR  ALK HPDK    +  E ++ KF+EI  AYEI
Sbjct: 3  SVKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEI 59

Query: 64 LSDPEKKSHYDLY 76
          L D +KK  YD Y
Sbjct: 60 LGDAKKKLLYDRY 72

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 117/285 (41%), Gaps = 44/285 (15%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK  K  L R  +C +C G G        +T  V C  C G+G   + +R GP LV +
Sbjct: 167 YSGKVAKLGLTRTRLCHRCSGHG-------SMTSSV-CGECRGQGVYSQTRRHGP-LVQT 217

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C+G G + K      + C  C G G + +++I  V + PG      I + G A
Sbjct: 218 WSSSCRNCSGAGTFVK----SNDVCQTCRGTGYIRERKIFEVEIKPGLSNKSEIILPGEA 273

Query: 264 DEEID------KTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           D+ I       +   GD+   + E+      ++    +        + T   + L  +L 
Sbjct: 274 DQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFRESDL-------VLTRCVVDLRTSLC 326

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           G   ++      R + L V PG ++ PG    + N G P  DNP  + GDLY+   + FP
Sbjct: 327 GGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNP-SQYGDLYIKFCVNFP 385

Query: 378 PDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETIS 422
                    E L  +T    SS+ AS        DSN+   E I+
Sbjct: 386 ---------ERLEPETMNVISSALAS--------DSNIIRQENIT 413

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          R YD+L V+   + QE+K +Y+  AL++HPDK       E  +  F++IT AY ILSD  
Sbjct: 6  RFYDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDER 62

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 63 KRKIYDRY 70

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 103/241 (42%), Gaps = 28/241 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           YMGK  K  L R  IC  C G G   K          C++C G+G + + K  GP LV S
Sbjct: 202 YMGKTAKLGLNRTRICHVCEGHGGLQK--------YTCKTCKGQGVQTQTKCMGP-LVQS 252

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G G + +     K+ C  C GLG + +++I+ V V PG   N +I + G  
Sbjct: 253 WSQTCADCGGAGIFVES----KDICQQCQGLGFIKQRKILQVTVQPGTSHNQLIVLTGEG 308

Query: 264 DEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           DE I      +K   GD+   +      L  K    +  D+ +   +Y    + L  +L 
Sbjct: 309 DEVISKGGGHEKVIPGDVVITI------LRLKDPKFQVTDNCS--LIYKKCKVDLMTSLC 360

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP-ILDNPHGRCGDLYVFVHIEF 376
           G   ++      +L+ L + PG V++P     I   G P  ++      G LYV   + +
Sbjct: 361 GGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVKFDVSY 420

Query: 377 P 377
           P
Sbjct: 421 P 421

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT  A+  EIK AYR  AL++HPDK    +  E ++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 64 RSLYDQY 70

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 105/231 (45%), Gaps = 27/231 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK+ K  L+R   C+KC G G    +         C  C G+GS  + K+FGP +  +
Sbjct: 245 YSGKRSKLRLERTRCCLKCKGFGSLNIK--------SCSKCNGRGSLTQTKKFGP-MTQT 295

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C+ C G G +     + ++ C +C G G L++K+I  V + PG     +I + G A
Sbjct: 296 FTQTCDGCGGNGTFA----DAQDICNECQGEGFLNEKKIFEVEITPGMTDGQLIILTGEA 351

Query: 264 DEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT 317
           DE I      ++   GD+   +     NL     F      GA + LY +  I+L  +L 
Sbjct: 352 DEVISTNLGKERVIPGDIILTI-----NLLPDPTF--KVVQGA-DLLYANYKINLLTSLC 403

Query: 318 GFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDL 368
           G   ++     + L+ +++ PG +++ G    + N G P +D   G   D+
Sbjct: 404 GGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSNDI 454

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 5/69 (7%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDK-YVDQDSKEVNEIKFKEITAAYEILSDP 67
          +LYD+L V  D+    IK AYR LALK+HPDK  + ++SK++    F++I+ AY +LS+ 
Sbjct: 6  QLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQM----FQKISEAYVVLSNK 61

Query: 68 EKKSHYDLY 76
          +K+  YD Y
Sbjct: 62 DKRQMYDKY 70

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 119/289 (41%), Gaps = 36/289 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK+ K  LKR  +C  C G G K            C +C GKG + + KR GP  +  
Sbjct: 154 YNGKRAKLALKRTRLCQTCQGEGSKKA--------TSCYACRGKGMQTQTKRQGP--IMQ 203

Query: 204 QWV-VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGM 262
            W   C  C G G   K    P + C  C G G + +++I  + V  G      + V   
Sbjct: 204 TWSSTCGTCGGSGTIVK----PSDICNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAE 259

Query: 263 ADEEI------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEAL 316
           ADE +      ++   GD+   L    E L  +   LK   D +   L +   + L  +L
Sbjct: 260 ADEVVISKYGSERVIPGDVIIIL----EQLPHRS--LKRGHDSS--LLLSECQVDLKTSL 311

Query: 317 TGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEF 376
            G   ++      ++L + V PG +++PG    + + G P      G  GDL++   + F
Sbjct: 312 CGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMGMP---KSKGGYGDLFIKFKVIF 368

Query: 377 PPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETI-SNF 424
            PDN   +   +  ++  L    S  + AT   E D  +   E + +NF
Sbjct: 369 -PDNL--KPDTIQTMQAALDKEPSMQTSATTQPEIDEGIPVEEHVFTNF 414

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 3  GSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYE 62
          GS   + LYD LGV  +A+ QEIK AYR  ALKHHPDK       E +++KF++I  AYE
Sbjct: 2  GSAMNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYE 58

Query: 63 ILSDPEKKSHYDLY 76
          IL D +K+  YD +
Sbjct: 59 ILGDDKKREMYDRF 72

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 110/238 (46%), Gaps = 29/238 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G++ K++L+    C KCHG+G K  +   VT    C  C G+G   ++ + G   + +
Sbjct: 154 YNGREFKYNLQLNDFCEKCHGTGSKDGK---VTR---CPDCQGRGVIVQVIQMG---IMT 204

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  VC++C+G G+  K P      CP C G  +    +  TV +  G   N V    G
Sbjct: 205 QQIQHVCDRCSGSGEIIKNP------CPHCHGHKVAKMDKEFTVKLPNGAQRNYVDIKHG 258

Query: 262 MADEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
            A++  D    GDL F   E    N+  ++          G+ LY +  +S+ EAL G  
Sbjct: 259 EAEKGAD-FDAGDLMFEFRENSMNNMGYRR---------RGDHLYRTEVLSVQEALKGGW 308

Query: 321 KFLTKTFD-DRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           +   + FD D+ + L     +VV  G+   +   G PIL++   + GDL++   I  P
Sbjct: 309 ERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVILMP 366

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV +DA  +EIK+AYR+L+ K+HPDK       E    KF E+  AY++LSD EK+
Sbjct: 24 YKILGVNKDANDKEIKSAYRQLSKKYHPDK---NPGDEEAHNKFIEVGEAYDVLSDSEKR 80

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 81 NIYDQY 86

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 109/238 (45%), Gaps = 30/238 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  LKF +    IC  CHGSG    +        +C  C G+G   ++ R G   + +
Sbjct: 151 YNGYVLKFSINLNDICDHCHGSGSNDGKS------TKCPDCQGRGVTVQVIRMG---MMT 201

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  VC KC GKG+  K P      C  C G  ++ K +   + +  G     V    G
Sbjct: 202 QQIQQVCGKCGGKGQIIKNP------CKTCHGSKVVQKPKDFEIELPAGAPRKFVHAEHG 255

Query: 262 MADEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTG-F 319
            AD+  D  + GD+    TE  ++N+  ++          G  LY +  ++ +EAL G +
Sbjct: 256 AADKHPDYDS-GDVYIEFTENDKDNMGYRR---------RGPHLYRTEVLNATEALYGGW 305

Query: 320 EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           E+ L      +++T+  +P ++++ G+T +IA  G P L N     GDL++   +  P
Sbjct: 306 ERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMP-LGNGRKGFGDLFIDYVVVMP 362

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          Y +L + +DAT ++I++AYR+L+ K+HPDK   D+D+      KF E+  AYEILSDPEK
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDAHH----KFIEVGQAYEILSDPEK 79

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 80 RQRYDQF 86

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 107/260 (41%), Gaps = 42/260 (16%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GKK K  L R   C  C+G G          + + C  C GKG     K  GP +V S
Sbjct: 185 YQGKKCKLGLNRTRSCHSCNGMGG--------MNTIICNECQGKGINTETKMLGP-MVQS 235

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C+G G +     + ++ C +C G G L ++ I TV V PG   N  I +KG A
Sbjct: 236 WSSTCFNCSGMGYFI----DSQSGCKECQGEGYLRERTIFTVTVKPGMRNNQKIVLKGEA 291

Query: 264 DEEI-------DKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGED------------L 304
           D+ +       +K   GD+   + + +    +      N D G  ++            L
Sbjct: 292 DQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKND---SNIDQGENKNKFHFEIINEKDLL 348

Query: 305 YTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP--ILDNPH 362
             +  I L  +L G E ++      +L+ L + P  +++P     + N G P  I D  +
Sbjct: 349 LRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDETN 408

Query: 363 GR-----CGDLYVFVHIEFP 377
                   GDLY+   +++P
Sbjct: 409 NGEEYLPNGDLYIQFKVKYP 428

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          RLY +L V   AT+ EIK AY+KLALK+HPDK    +  E +++KF+EI  AYE+L D +
Sbjct: 13 RLYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKD 69

Query: 69 KKSHYDLY 76
          KK  YD Y
Sbjct: 70 KKLLYDTY 77

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 102/254 (40%), Gaps = 45/254 (17%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GKK K  L R  +C  C G G              C +C G+G   + +R GP +V +
Sbjct: 163 YQGKKTKLGLNRMRVCSSCDGKGG--------MRVASCRTCKGQGEVVKTRRVGP-MVQT 213

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C+G G + K      + C  C G G+  +++I  V V  G   N VI + G A
Sbjct: 214 MSSTCNSCHGTGTFIK----DSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEA 269

Query: 264 DEEID------KTTCGDLKFHL----TEKQENLEQKQIFLKNFDDGAGEDLYTSITISLS 313
           DE I+      K   GD+   +      + + +    + LKN +            + L 
Sbjct: 270 DEVIETSHGLIKVQPGDVVIVIDLVKNTQFQVVNDHDLVLKNCE------------VPLK 317

Query: 314 EALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP--ILDNPHGRC------ 365
             L G E  +      +++ LS+ P  +++P     +   G P  I ++ H         
Sbjct: 318 TCLCGGEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDID 377

Query: 366 --GDLYVFVHIEFP 377
             G+LYV   ++FP
Sbjct: 378 GYGNLYVQFQVKFP 391

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          RLYD+L V  DA+   IK A+   AL+ HPDK    +  E ++ +F+EI+ AYE+LSDP+
Sbjct: 6  RLYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPK 62

Query: 69 KKSHYDLY 76
           +  YD Y
Sbjct: 63 SREMYDRY 70

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 102/237 (43%), Gaps = 26/237 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK+ K  L+R  +C  C G G   KR +       C  C G G+     R GP ++ +
Sbjct: 172 YRGKRSKLRLERSKLCSICKGDGG-VKRSM-------CNQCHGDGNITETTRLGP-MLQT 222

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  CNG G      +     C  C G+G  ++ +I  V + PG      I      
Sbjct: 223 FTHTCNICNGNGWVIISQET----CQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEG 278

Query: 264 DEEIDKTTC--GDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYT-SITISLSEALTGFE 320
           DE ++K     G++  H+ E ++N        K  +D  G+DLY  +  I L  +L G  
Sbjct: 279 DEIVNKRRVIPGNVIIHINEIEDNK------FKRVND--GQDLYYWNYEIDLFTSLCGGV 330

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            ++    +++L+ + + PG ++  G    + + G P   N     G LY+   +++P
Sbjct: 331 IYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMP--KNKGNEYGILYIQFQVKYP 385

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          RLY+ L +   A+  +IK AYR  AL++HPDK    +  E ++ KF++I+ AY IL D  
Sbjct: 6  RLYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSILRDEN 62

Query: 69 KKSHYDLY 76
          ++  YD Y
Sbjct: 63 QRKMYDKY 70

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 101/236 (42%), Gaps = 27/236 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  L F L     C  CHGSG +  +  H      C  C G+G   ++ R GP L   
Sbjct: 153 YQGTSLDFTLNLNDFCENCHGSGSQDGKTTH------CSECRGQGVVIQVVRMGP-LTQK 205

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
              +C  C GKG+        KN C  C G  +  K +   V+V  G   + V    G A
Sbjct: 206 IQQMCGACQGKGQVI------KNKCKRCHGAKVERKAKHFHVDVPAGAPRDFVDVKAGEA 259

Query: 264 DEEIDKTTCGDLKFHLTE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKF 322
           D+  D  + GD+    +E  ++N+  ++          G  LY +  +SL EAL G  K 
Sbjct: 260 DKGPDFDS-GDVFIKFSESSRDNMGYRR---------RGPHLYRTEVLSLKEALLGGWKR 309

Query: 323 LTKTFD-DRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
             + FD ++ L L    G  VR G+  ++   G P     HG+ GDL+V   +  P
Sbjct: 310 EIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPT--GGHGKHGDLFVDYVVVIP 363

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (70%), Gaps = 5/65 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          Y +LGV++DA+ +EIK+AYR+L+ K HPDK   D+D+      KF E+  AYE+LSD +K
Sbjct: 27 YGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHH----KFIEVGEAYEVLSDDQK 82

Query: 70 KSHYD 74
          +  YD
Sbjct: 83 RQIYD 87

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 99/236 (41%), Gaps = 37/236 (15%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y GK +K  L+R   C +C                  C SC G G+  R++R GP L  +
Sbjct: 127 YRGKVIKLALRRTAPCERCSLGAANV-----------CSSCNGSGNITRIERVGP-LTQT 174

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C  C G+G+ +         C  C G   L+++ +  V+V PG H    I + G A
Sbjct: 175 WSSTCNACQGQGRMSVD-------CSQCGGAQYLNERVVFKVHVKPGMHDGQTIVLDGEA 227

Query: 264 DE-------EIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYT-SITISLSEA 315
           D+        +     GD+   + E  +   ++    K       E+L+   + + L+ A
Sbjct: 228 DQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKR------ENLFVDQVKVDLTTA 281

Query: 316 LTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIK-IANEGWPILDNPHGRCGDLYV 370
           LTG    L       L+ +++ PG  + P + IK +   G PI D   G+ GDLY+
Sbjct: 282 LTGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDT--GQRGDLYI 334

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYDVLGV  DA+  EIK AYRKLAL++HPDK    +  E     F++I+ AY +L D  +
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDK---NNGDEKCHEAFQKISHAYGVLGDVAQ 60

Query: 70 KSHYD 74
          +  YD
Sbjct: 61 RQRYD 65

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LG++  A  QEIK  YRK ALK+HPDK            KFKEI+ A+EILSDP+
Sbjct: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 16/154 (10%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K F     G     +K  + + + PG      IT K   D          L+F + EK+ 
Sbjct: 196 KTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKH 255

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVR 343
                  F ++     G DL  ++ ++  E+L GF K + +T D R L +S ++P   ++
Sbjct: 256 PF-----FTRD-----GNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQP---IQ 301

Query: 344 PGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           P +      +G PI   P G+ GD+ V   +++P
Sbjct: 302 PSEKSTYPGQGMPIPKTP-GQRGDMIVNYKVDYP 334

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 105/239 (43%), Gaps = 25/239 (10%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y+G + +F L    IC  C GSG +  +         C  C G G   ++ R GP +   
Sbjct: 143 YLGTEFEFTLNLNDICDACDGSGSEDGKT------ETCPDCGGSGQIMKVFRAGP-IEQR 195

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C +C G+G+  K      + C  C G+ ++ K ++ T  V PG   N +  ++G +
Sbjct: 196 VRQPCSRCQGRGQLIK------HVCKKCKGVKVVQKSKVFTAKVEPGMERNHIHVMQGQS 249

Query: 264 DEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFL 323
           ++  D    GDL  +  E +++    +          G  LY +  +S  EAL G  +  
Sbjct: 250 EKHPD-IEPGDLYQYFRESEKDSMGYR--------RRGNTLYRTEILSFKEALQGGWERN 300

Query: 324 TKTFD-DRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNW 381
            + FD ++ L LS   G  V+ G+T  I + G PI  +   + GDL +  ++   P  W
Sbjct: 301 IEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPI-PSATDKFGDL-IIDYVILLPGEW 357

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV + A+ +EIK+AYR+L+ K+HPDK    D    +   F E+  AY++LSDPEK+
Sbjct: 22 YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHH---FIEVGEAYDVLSDPEKR 78

Query: 71 SHYD 74
            YD
Sbjct: 79 QIYD 82

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGVT  A  QEIK  YRK ALK+HPDK            KFK+I+ AYEILSD  
Sbjct: 6  KLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297
           S+K  I + + PG      IT K   D          L+F + EK            NF 
Sbjct: 212 SEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSH---------PNFK 262

Query: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWP 356
              G+DL  ++ +S  E+L GF K + +T D R L LS V+P   V+P  T     +G P
Sbjct: 263 RD-GDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMP 317

Query: 357 ILDNPHGRCGDLYVFVHIEFP 377
              NP  R G+L V   +++P
Sbjct: 318 TPKNPSQR-GNLIVKYKVDYP 337

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 103/238 (43%), Gaps = 28/238 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  + F+L     C  C GSG +  +   VT   +C  C G G   ++ R GP     
Sbjct: 147 YRGTSIDFNLNLNDFCEHCEGSGSQDGK---VT---KCPDCKGHGVVVQIVRMGPVTQQI 200

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
           Q + C KC G+G   K      N C  C G  ++ K +   V+V PG   N V   +G +
Sbjct: 201 QQM-CGKCQGRGSTIK------NKCKHCHGEKVVRKPKSFHVDVPPGAPRNFVEVKQGES 253

Query: 264 DEEIDKTTCGDLKFHLTE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT-GFEK 321
           D+  D    GDL    +E  ++NL  ++          G+DL+ +  +SL EAL  G+E+
Sbjct: 254 DKGPD-FDAGDLFIKFSETSRDNLGYRR---------RGDDLFRTEALSLREALKGGWER 303

Query: 322 FLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPD 379
            +      R + +      V   G+  +I   G P     H + GDLY+   +  P D
Sbjct: 304 EIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP---KEHNKFGDLYIDYVVIVPDD 358

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV++ A  ++IK+AYR+L+ K+HPDK  D DS      KF E+  AYE+LSDPEK+
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHN---KFIEVGEAYEVLSDPEKR 78

Query: 71 SHYDLY 76
            YD Y
Sbjct: 79 KIYDQY 84

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297
           S+K  I + + PG      IT K   D          L+F + EK            NF 
Sbjct: 219 SEKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQEKSH---------PNFK 269

Query: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWP 356
              G+DL  ++ +S  E+L GF K + +T D R L LS V+P   V+P  T     +G P
Sbjct: 270 RD-GDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMP 324

Query: 357 ILDNPHGRCGDLYVFVHIEFP 377
              NP  R G+L V   +++P
Sbjct: 325 TPKNPSQR-GNLIVKYKVDYP 344

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QEIK  YRK AL++HPDK         N  KFK+I+ AYEILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTG------NTEKFKQISEAYEILSDSN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 69/154 (44%), Gaps = 16/154 (10%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G   +K+ I + +  G      IT K   D          L+F L EK  
Sbjct: 187 KSFKIGRKGPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVLQEKAH 246

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVR 343
            L ++           GE+L  ++ +S  E+L GF K   +T D R L+LS  +P   ++
Sbjct: 247 PLFKRD----------GENLLYTVPLSFQESLLGFSK-TVQTIDGRSLSLSRTQP---IQ 292

Query: 344 PGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           P +T     +G P   NP+ R GDL +   I++P
Sbjct: 293 PTETTTYPGQGMPNPKNPNQR-GDLIITYKIDYP 325

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QEIK  YRK ALK+HPDK         N  KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTG------NTEKFKEISEAFEILSDSN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+  E+K  YRK ALK+HPDK            KFKEI+ A+EILSDP 
Sbjct: 6  KLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDTY 67

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 67/153 (43%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G   + +K+ I + + PG      IT K   D          ++F + EK  
Sbjct: 196 KSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPH 255

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344
              ++           G DL  ++ ++  E+L GF+K   +T D R   +S+   + V+P
Sbjct: 256 EFFKRD----------GNDLIYTLPLTFKESLLGFDK-TVRTIDGR--QISIHKTQPVQP 302

Query: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            + ++   +G P+  NP  R GDL V    ++P
Sbjct: 303 SEEMRYPGQGMPLSKNPSER-GDLIVKYKTDYP 334

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+  EIK  YRK ALK+HPDK            KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSN 59

Query: 69 KKSHYDLY 76
          K+S YD Y
Sbjct: 60 KRSVYDQY 67

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSAQETELKKGYRKAALKYHPDK------PSGDAEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDTY 67

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 69/154 (44%), Gaps = 16/154 (10%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G  S+K+ + + + PG      IT K   D          L+F L EK  
Sbjct: 200 KSFKITRKGPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPH 259

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVR 343
           +   +           G DL  S+ ++  E+L GF K + +T D R L +S V+P   V+
Sbjct: 260 SNYTRD----------GNDLIYSLPLTFKESLLGFSKTI-QTIDGRTLPISRVQP---VQ 305

Query: 344 PGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           P D+     +G PI   P  R G+L V   I++P
Sbjct: 306 PSDSSTYPGQGMPIAKTPSQR-GNLIVKYKIDYP 338

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  Y+K ALK+HPDK            KFKEI+ AYEILSD  
Sbjct: 6  KLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSS 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (45%), Gaps = 16/140 (11%)

Query: 239 KKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDD 298
           +K  I + + PG      IT K   D          L+F L EK   L ++         
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYKRD-------- 269

Query: 299 GAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWPI 357
             G++L  S+ +S  E+L GF K + +T D R L +S ++P   V+P +      +G P+
Sbjct: 270 --GDNLIYSLPLSFKESLLGFSKTI-QTIDGRTLPISKIQP---VQPTEVSSYPGQGMPV 323

Query: 358 LDNPHGRCGDLYVFVHIEFP 377
              P G+ GDL V   I++P
Sbjct: 324 SKRP-GQRGDLVVKYKIDYP 342

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QEIK  YRK ALK+HPDK            KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G + +K  I + + PG      IT K   D          L+F L EK  
Sbjct: 206 KSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFMLQEKNH 265

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344
            + +++          G+DL  ++ ++  E+L GF K + +T D R  TL +   + ++P
Sbjct: 266 PVFKRE----------GDDLTCTLPLTFKESLLGFNKQI-QTIDGR--TLPISRTQPIQP 312

Query: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            +T     +G PI   P  R G+L V   I++P
Sbjct: 313 SETSVYPGQGMPIPKTPSQR-GNLIVRYKIDYP 344

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 42/67 (62%), Gaps = 6/67 (8%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
          LYD+L V+  A  QEIK  YRK ALK+HPDK            KFKEI+ A+EILSD EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEK 60

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 61 REVYDQY 67

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+L V   A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 14/139 (10%)

Query: 239 KKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDD 298
           +K  I + + PG      IT K   D          L+F ++EK           K  DD
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYNPKTGGRKTLQFIISEK------PHPHFKREDD 281

Query: 299 GAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPIL 358
               +L  ++ ++  E+L GF K + +T D + L LS   G+ V+P +T     +G PI 
Sbjct: 282 ----NLIYTLPLTFKESLLGFSKTI-QTIDGKNLPLSR--GQPVQPSETTTYPGQGMPIT 334

Query: 359 DNPHGRCGDLYVFVHIEFP 377
             P G+ GDL +   +++P
Sbjct: 335 KKP-GQRGDLLIKYKVDYP 352

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP 
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPN 59

Query: 69 KKSHYDLY 76
           +  YD Y
Sbjct: 60 TREVYDQY 67

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 64/153 (41%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G   +K  I + + PG      +T K   D          L+F + EK  
Sbjct: 174 KSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEKAH 233

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344
              ++           G+DL   + +S  E+L GF K +  T D R L LS    + ++P
Sbjct: 234 PDFKRD----------GDDLIYILRLSFKESLLGFSKTIN-TIDGRKLPLSR--SQPIQP 280

Query: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            +      +G P+  NP  R G+L +   I++P
Sbjct: 281 TEISTYPGQGMPVSKNPSQR-GNLIIKYKIDYP 312

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDNY 67

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 69/155 (44%), Gaps = 18/155 (11%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEK-Q 283
           K+F     G G   +K+ + + + PG      IT K   D          ++F + EK  
Sbjct: 197 KSFKITRKGPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQEKPH 256

Query: 284 ENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVV 342
           EN  +            G DL  ++ ++  E+L GF K + +T D R L +S V+P   V
Sbjct: 257 ENYTRD-----------GNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPISRVQP---V 301

Query: 343 RPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           +P D      +G P+  NP  R G+L V   I++P
Sbjct: 302 QPSDVSTYPGQGMPVAKNPSQR-GNLIVKYKIDYP 335

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDSY 67

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 68/154 (44%), Gaps = 16/154 (10%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G + +K+ I + + PG      IT K   D          ++F + EK  
Sbjct: 195 KSFKITRKGPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVIQEK-- 252

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVR 343
                   L       G +L  ++ +S  E+L GF K + +T D R L +S V+P   ++
Sbjct: 253 --------LHPHFKRDGNNLIYTLPLSFKESLLGFSKTI-QTIDGRTLPISRVQP---IQ 300

Query: 344 PGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           P +T     +G P+   P  R GDL +   +++P
Sbjct: 301 PSETSTYPGQGMPLPKTPAQR-GDLIIKYKVDYP 333

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (46%), Gaps = 16/141 (11%)

Query: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297
           S+K  I + +  G      IT K   D          L+F L EK   L ++        
Sbjct: 229 SEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQFVLQEKAHPLFKRD------- 281

Query: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWP 356
              G++L  ++ +S  E+L GF K + +T D R L +S V+P   ++P ++ +   +G P
Sbjct: 282 ---GDNLIYTLPLSFKESLLGFSKTI-QTIDGRTLPISRVQP---IQPSESSRYPGQGMP 334

Query: 357 ILDNPHGRCGDLYVFVHIEFP 377
           I   P G+ GDL V   I++P
Sbjct: 335 ITKKP-GQRGDLIVKYKIDYP 354

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LG++  A   EIK  YRK ALK+HPDK            KFKEI+ A+EILSD +
Sbjct: 6  KLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDTY 67

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 65/153 (42%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G +S+K  I + + PG      IT KG  D          L+F L EK  
Sbjct: 201 KSFKITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEKPH 260

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344
               +Q            DL  ++ +S  E+L GF K   +T D +  T+ +   + ++P
Sbjct: 261 EFFTRQ----------DNDLIYTLPLSFKESLLGFSK-QVQTIDGK--TIPITRTQPIQP 307

Query: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
             T     +G  +  NP  R GDL +   I++P
Sbjct: 308 TQTSTYPGQGMTLSKNPSQR-GDLIIKFKIDYP 339

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297
           S+K  I + + PG      IT K   D          L+F + EK            NF 
Sbjct: 226 SEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSH---------PNFK 276

Query: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWP 356
              G+DL  ++ +S  E+L GF K + +T D R L LS V+P   V+P  T     +G P
Sbjct: 277 RD-GDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMP 331

Query: 357 ILDNPHGRCGDLYVFVHIEFP 377
              NP  R G+L V   +++P
Sbjct: 332 TPKNPSQR-GNLIVKYKVDYP 351

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297
           ++K  I + + PG      IT K   D          L+F + EK            NF 
Sbjct: 228 AEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGH---------PNFK 278

Query: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWP 356
              G+DL  ++ +S  E+L GF K + +T D R L LS V+P   V+P  T     +G P
Sbjct: 279 RD-GDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMP 333

Query: 357 ILDNPHGRCGDLYVFVHIEFP 377
              NP  R G+L V   +++P
Sbjct: 334 TPKNPSQR-GNLIVKYKVDYP 353

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 66/153 (43%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G G   +K  I + +  G      +T K   D          L+F + EK  
Sbjct: 210 KSFKVGRKGPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKTLQFVIQEKTH 269

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344
            L ++           G+DL  ++ ++  E+L GF K + +T D R L LS      V+P
Sbjct: 270 PLYKRN----------GDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLSRS--SPVQP 316

Query: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            +T +   +G P+   P  R GDL V   I++P
Sbjct: 317 TETSRYPGQGMPMPKMPSQR-GDLVVRFKIDYP 348

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLG+  DAT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP+ K
Sbjct: 8  YDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQS---KFQAVGEAYQVLSDPQLK 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDQF 70

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 100/238 (42%), Gaps = 32/238 (13%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  ++F L     C  CHGSG    +        +C  C G+G   ++ R G   + +
Sbjct: 155 YSGTSIEFTLSLNDECDVCHGSGSADGKL------AQCPDCQGRGVIIQVLRMG---IMT 205

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  +C +C G G+  K      N C  C G  ++ K +   V+V PG   N + T  G
Sbjct: 206 QQIQQMCGRCGGTGQIIK------NQCKTCHGKKVIKKNKFFHVDVPPGAPRNYLDTRAG 259

Query: 262 MADEEIDKTTCGDLKFHLTEKQ-ENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
            A++  D    GDL     EK  EN+  ++          G++LY +  +S  EAL G  
Sbjct: 260 EAEKGPD-FDAGDLVIEFKEKDTENMGYRR---------RGDNLYRTEVLSAEEALYGGW 309

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANE-GWPILDNPHGRCGDLYVFVHIEFP 377
           +   + FD+       +P  VV     I++    G P     H   GDLY+   +  P
Sbjct: 310 QRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKGH---GDLYIDYVVIMP 364

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L V +DA+ +EIK+AYR+L+ K+HPDK  +  S+E +  KF E+  AY++LSDPEKK
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDK--NSGSEEAHH-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+ +    E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP 
Sbjct: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDKY 67

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 67/153 (43%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284
           K+F     G   + +K+ I + + PG      IT K   D          L+F + EK  
Sbjct: 194 KSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMH 253

Query: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344
           +      FLK      G DL  ++ +S  E+L GF K    T D R + +S    + V+P
Sbjct: 254 D------FLKR----DGNDLTYTLPLSFKESLLGFSK-TVHTIDGRQIFISKT--QPVQP 300

Query: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            +  +   +G P+  NP  R GDL V   I++P
Sbjct: 301 SEESRYPGQGMPLSKNPSER-GDLIVKYKIDYP 332

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 96/229 (41%), Gaps = 27/229 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           + G  + F +  +  C  C GSG +  +        +C+ C G G   ++ R GP +   
Sbjct: 169 FTGANVNFQMDFKDTCDHCKGSGSEDGKV------DKCKECGGNGFVVQVIRMGP-VTQQ 221

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
               C KC+G G   K      N C  C G  L++K + I V V  G   + +  V+   
Sbjct: 222 MHTQCPKCHGAGSTIK------NHCKKCHGQKLVTKSKEINVKVPAGAPRDFLKIVENGG 275

Query: 264 DEEIDKTTCGDLKFHLTE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKF 322
           D+E++    GDL     E  Q NL  ++          G DL+ +  +   +A+ G    
Sbjct: 276 DKELN-AEAGDLLVQFQEIAQNNLGYRR---------RGNDLFRTEALVFKDAMEGGWNR 325

Query: 323 LTKTFD-DRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYV 370
               FD  R + +S KPG  V   +  K+   G PI  +   R GDLY+
Sbjct: 326 TIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGS--DRFGDLYI 372

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 7  GDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSD 66
          G   Y +LG+ ++A+ + IK+AYR+L+ K+HPDK  +Q+ +E +   F EI  AYE+LSD
Sbjct: 27 GKDYYKILGIPKEASEKAIKSAYRQLSKKYHPDK--NQNDEEAHN-HFIEIGEAYEVLSD 83

Query: 67 PEKKSHYDLY 76
          PEK+  YD +
Sbjct: 84 PEKRRTYDQF 93

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + YDVLGV  DAT ++IK AYRK A++ HPDK  +    +    KF+E++ AY++LSD E
Sbjct: 6  KYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEAQA---KFQEVSKAYKVLSDGE 62

Query: 69 KKSHYD 74
           +S YD
Sbjct: 63 LRSRYD 68

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  DA+  EIK AYRK A+  HPDK+ D    +    KF+ I  AY++LSDPE +
Sbjct: 8  YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQA---KFQAIGQAYQVLSDPELR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L + +DAT +EIK+AYR+L+ K+HPDK  +  S+E ++ KF E+  AY++LSDPEKK
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 101/237 (42%), Gaps = 30/237 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  ++F L     C  CHGSG    +        +C  C G+G   ++ R G   + +
Sbjct: 154 YSGSSIEFTLNLNDECDACHGSGSADGKL------AQCPDCQGRGVIIQVLRMG---IMT 204

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  +C +C G G+  K      N C  C G  +  K +   V+V PG   N + T  G
Sbjct: 205 QQIQQMCGRCGGTGQIIK------NECKTCHGKKVTKKNKFFHVDVPPGAPRNYMDTRVG 258

Query: 262 MADEEIDKTTCGDLKFHLTEKQ-ENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
            A++  D    GDL     EK  EN+  ++          G++LY +  +S +EAL G  
Sbjct: 259 EAEKGPD-FDAGDLVIEFKEKDTENMGYRR---------RGDNLYRTEVLSAAEALYGGW 308

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           +   +  D+       +P  VV     +++  +G+ +     G  GDLY+   +  P
Sbjct: 309 QRTIEFLDENKPVKLSRPAHVVVSNGEVEVV-KGFGMPKGSKGY-GDLYIDYVVVMP 363

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ +DAT +EIK+AYR+L+ K HPDK       E    KF E+  AYE+LSDP+K+
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSDPQKR 79

Query: 71 SHYDLY 76
            +D +
Sbjct: 80 QTFDQF 85

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 106/243 (43%), Gaps = 32/243 (13%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G +L F L    +C  CHG+G    +         C  C G+G   +L R G   + +
Sbjct: 149 YTGYELNFTLNVNDLCDHCHGTGSDDGKL------TPCPDCQGRGVIIQLIRMG---MMT 199

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPG--HHFNDVITV 259
           Q +  +C +C GKG+  K+       C  C G  ++ +K+   V +  G   H+ DV   
Sbjct: 200 QQIQQMCGRCGGKGQLFKKQ------CRKCHGNKVMPQKKEFQVKLPKGAKRHYMDV--K 251

Query: 260 KGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEAL-TG 318
            G AD+  D    GDL   L E  EN +    + +      G++LY +  ++++EAL  G
Sbjct: 252 HGEADKNPD-LEAGDL---LIEFNENDKSNMGYRRR-----GQNLYRTEVLNVTEALYGG 302

Query: 319 FEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPP 378
           +++ +      + L +  +   VV  G+  +I   G P         GDL++  ++   P
Sbjct: 303 WQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFI-DYVVIMP 361

Query: 379 DNW 381
             W
Sbjct: 362 KQW 364

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L + +DA+ +EIK+AYR+L+ K+HPDK    D       KF EI  AYE+LSDPEKK
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEAHH---KFIEIGEAYEVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 101/238 (42%), Gaps = 32/238 (13%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  ++F L     C  CHGSG    +        +C  C G+G   ++ R G   + +
Sbjct: 152 YSGTSIEFTLSLNDECDGCHGSGSADGKL------AQCPDCQGRGIIVQVVRMG---IMT 202

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  +C +C G G+  K      N C  C G  +  K +   V+V PG   N + T  G
Sbjct: 203 QQIQQICGRCAGTGQVIK------NQCKTCHGKKVTKKNKFFHVDVPPGAPRNYMDTRAG 256

Query: 262 MADEEIDKTTCGDLKFHLTEKQ-ENLEQKQIFLKNFDDGAGEDLYTSITISLSEAL-TGF 319
            A++  D    GDL     E   EN+  ++          G +LY +  +S +EAL  G+
Sbjct: 257 EAEKGPD-FDAGDLVIEFREMDTENMGYRR---------RGHNLYRTEVLSAAEALYGGW 306

Query: 320 EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           E+ +    +++ + LS     VV  G+   +   G P     H   GDLY+   +  P
Sbjct: 307 ERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKGSRDH---GDLYIDYVVVMP 361

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214w SCJ1
          Length = 361

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+++DA+ +EIK+AYR+L+ K+HPDK       E    KF E+  AY+IL DPEK+
Sbjct: 22 YAILGLSKDASDKEIKSAYRQLSKKYHPDK---NPGDEEAHHKFIEVGEAYDILGDPEKR 78

Query: 71 SHYDLY 76
            YD++
Sbjct: 79 KTYDVH 84

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 101/229 (44%), Gaps = 27/229 (11%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G +++F++    IC  CHGSG     K+ V     C +C G+G   ++ R GP     
Sbjct: 140 YSGGEVEFEIPLNDICDSCHGSG-SADGKVKV-----CPACQGRGVVVQVIRMGP----- 188

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
             +  +     G+   + K  +N C  C G  ++ K +        G   N +    G +
Sbjct: 189 --ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNHIDKKSGES 246

Query: 264 DEEIDKTTCGDLKFHLTE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKF 322
           D+  D  + GD+     E ++ENL  ++          G +LY +  I+ +EA+ G    
Sbjct: 247 DKSPDMES-GDIIIEYNESEKENLGYRR---------RGNNLYRTEIITANEAINGGWTR 296

Query: 323 LTKTFDD-RLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYV 370
             +  D+ + + LS   G +V  GD  +I   G PI+ + +   GDLY+
Sbjct: 297 EIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKN--FGDLYI 343

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLGV+  AT  EIK AYRK A++ HPDK  D    E    KF+ +  AY++LSD E +
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAET---KFQAVGEAYQVLSDTELR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDQF 70

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLGV   AT  EIK AYR+ A++ HPDK+ D    +    KF+E+  AY++LSDP  +
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQA---KFQEVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 113/272 (41%), Gaps = 41/272 (15%)

Query: 159 CIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYT 218
           C  C GSG KP      +H  EC SC G G+   + R G  + ++    C  C G G+  
Sbjct: 225 CKTCTGSGMKPG-----SHRSECSSCHGTGTTVHV-RAGFQMAST----CMSCGGTGENI 274

Query: 219 KRPKNPKNFCPDCAGLGLLSK--KEIITVNVAPGHHFNDVITVKG--------MADEEID 268
            R    ++ C +C G G   +  +  + V + PG    DVI V G        +A E+ D
Sbjct: 275 AR----EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRD 330

Query: 269 --KTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKT 326
             K T GDL   +  KQ+         K F    G +L+ +  I ++ A+ G    +  T
Sbjct: 331 QVKVTRGDLLVRIRVKQD---------KVFSIRNGNELWQTREIPVTTAVLG-GNVVIPT 380

Query: 327 FDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFNEKS 386
            D   L L V+ G   R G+T+ +  +G P       R GD+ V   +         E+ 
Sbjct: 381 LDGNQLRLRVRSG--TRDGETVSVPGQGVPRGRGGLSR-GDMKVQWRVPVRTPKTAVERC 437

Query: 387 --ELLAIKTNLPSSSSCASHATVNTEDDSNLT 416
             E LA  TN   +S    H  ++T+  +  T
Sbjct: 438 LWEALADVTNDSGASRSPDHVRLDTDSSAGNT 469

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           Y VLG+ +DA   EIK AY KLA K+HPD   D+ S +    KF +IT AYEILSD +KK
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGSDK----KFHDITNAYEILSDEKKK 104

Query: 71  SHYDLY 76
             YD +
Sbjct: 105 MQYDQF 110

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ +DA+ +++K+AYR+L+ K+HPDK       E    +F E+  AYE+LSDPEK+
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDK---NPGDESAHQRFIEVGEAYEVLSDPEKR 77

Query: 71 SHYDLY 76
            +D Y
Sbjct: 78 GIFDQY 83

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 99/239 (41%), Gaps = 32/239 (13%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE-CESCAGKGSKERLKRFGPGLVA 202
           Y G  ++F+L    IC  C GSG +  +       VE C  C G+G   ++ R G   + 
Sbjct: 152 YSGTGVEFELMLNDICDHCEGSGSEDGK-------VETCPDCGGQGILIQIIRMG---IM 201

Query: 203 SQWVV--CEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVK 260
           +Q +   C +C+G+G         KN C  C G  ++ K +   V V  G   + V    
Sbjct: 202 TQRIQQPCGRCSGRGHII------KNQCKACGGHKVVKKPKSFQVEVPAGAPRDHVEVRH 255

Query: 261 GMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
             AD+  D    GD+    TE  +N      + +      G+ L+ +  +S  EAL G  
Sbjct: 256 QEADQSTD-MEAGDIFVEFTESDKN---NMGYRRR-----GDHLFRTEVLSAREALAGGW 306

Query: 321 KFLTKTFDD-RLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRC-GDLYVFVHIEFP 377
               +  DD + + L    G +V  G+  +I   G P      G+  GDL+V   +  P
Sbjct: 307 SREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMP--KGSSGKSFGDLFVEYAVVMP 363

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV R+AT ++IK+AYR+L+ K+HPDK     +   N   F E+  AYE LSDPEK+
Sbjct: 23 YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPEKR 79

Query: 71 SHYDLY 76
            YD Y
Sbjct: 80 RIYDQY 85

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 97/231 (41%), Gaps = 30/231 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE-CESCAGKGSKERLKRFGPGLVA 202
           Y G  ++F L     C  C  +G +  +       VE C  C+ +G   ++ R   G + 
Sbjct: 145 YHGTAVEFTLSLNDHCDHCGATGSQDGK-------VERCTQCSVRGVIVQVGR--QGFMT 195

Query: 203 SQWV-VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
            Q+  VC +  G       PK     C  C G   + K +   V V PG    D + V+ 
Sbjct: 196 QQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAP-RDFVAVQQ 249

Query: 262 MADEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
              E++     GD+   + E  ++N+  ++          G +L+ +  +SL EAL G  
Sbjct: 250 GEAEKVPDMDPGDIYVKVFENTRDNMGYRR---------QGANLFRTEVLSLKEALHGDW 300

Query: 321 KFLTKTFD-DRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYV 370
           K   +  D  + +  S K G+ V+ G+  ++   G P+ D+     GDLYV
Sbjct: 301 KRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDS--AGFGDLYV 349

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV  DAT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP  +
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQA---KFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLGVT +AT  +IK AYRK A++ HPDK+ D    +    KF+ +  AY++LSDP  +
Sbjct: 8  YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQS---KFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDQF 70

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V R AT  EIK AYRKLA+K HPDK     + E     FK I  A+E+LS+ EK
Sbjct: 22 FYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +S YD
Sbjct: 78 RSIYD 82

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV +DA+ ++IK+AYR+++ K HPDK    D       KF EI  AYE+LSD EK+
Sbjct: 21 YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEA---HHKFIEIGEAYEVLSDSEKR 77

Query: 71 SHYDLY 76
          + YD +
Sbjct: 78 ATYDRF 83

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 87/219 (39%), Gaps = 44/219 (20%)

Query: 180 ECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTK-------------------- 219
           +CE C G G+++           +Q+  CE C G+G   +                    
Sbjct: 160 DCEHCHGSGAED-----------NQFATCETCQGRGVIIQVIQMGFMTQQIQQVCGACQG 208

Query: 220 RPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHL 279
           + K  K+ C  C G  ++   +   ++V  G   N  +   G A E++     GDL F  
Sbjct: 209 KGKTIKHVCKICRGARVVKTPKTFEISVPAGAQRNYNVVKSGQA-EKVPDMQSGDLVFVF 267

Query: 280 TE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKP 338
            E   ENL  ++          G+ LY +  +   EAL G  +     FDD+   +  + 
Sbjct: 268 EENSHENLGYRR---------RGDHLYRTEVLHWKEALLGGWERRIAFFDDQKQVVVKRD 318

Query: 339 GRVV-RPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEF 376
             VV  PG+  ++ N G P L N  G+  + Y  + IE+
Sbjct: 319 KNVVTAPGEIERVPNLGMPKL-NSKGKSTNAYGDLFIEY 356

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ +DA+ +EIK++YR+L+ K HPDK       E    KF EI  AYE+LSDPEK+
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDK---NPGDEEAHHKFIEIGEAYEVLSDPEKR 79

Query: 71 SHYDLY 76
            +D Y
Sbjct: 80 KIFDQY 85

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 99/238 (41%), Gaps = 30/238 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  L+F L    IC  C G+G    +        +C  C G+G   ++ R G   + +
Sbjct: 150 YTGATLEFTLALNDICDHCDGTGSADGKV------AKCSDCQGRGVVIQVIRMG---MMT 200

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  +C +C GKG   K      N C  C G  ++ K++   V V PG   +   T  G
Sbjct: 201 QQIQQMCGRCGGKGSVIK------NHCKTCHGSKVVKKQKPFHVEVPPGAARHYTETRSG 254

Query: 262 MADEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
            +D+  D    GD+     EK   NL  ++          G  LY +  +S  EAL G  
Sbjct: 255 ESDKGAD-FDAGDVFIEFNEKTTNNLGYRR---------RGPHLYRTEVLSAREALKGDW 304

Query: 321 KFLTKTFDD-RLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           +   +  D+ + + ++     VV  G+  +I   G P  +  H   GDL++   +  P
Sbjct: 305 QREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHA-FGDLFIEYVVVMP 361

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV++DA+ +EIK+AYR+L+ K+HPDK       E    KF E+  AYE+LSD +K+
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDK---NPGDETAHHKFIEVGEAYEVLSDDQKR 82

Query: 71 SHYDLY 76
            Y+ Y
Sbjct: 83 QIYNQY 88

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 94/229 (41%), Gaps = 28/229 (12%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  L F L     C  C G+G +  +         C  C G+G   ++ R GP +   
Sbjct: 154 YQGTSLDFTLNLNDFCDNCKGTGSQDGKT------TRCSDCQGQGVVIQIIRMGP-ITQQ 206

Query: 204 QWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMA 263
              +C  C GKG+        KN C  C G  +  K +   V+V  G   + V    G A
Sbjct: 207 IQQMCGACQGKGQII------KNKCKQCHGAKVERKTKHFHVDVPAGAPRDFVDVKNGEA 260

Query: 264 DEEIDKTTCGDLKFHLTE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKF 322
           D+  D    GD+    +E  ++N+  ++          G  L+ +  ++L EAL G  K 
Sbjct: 261 DKGPD-FDAGDVYIKFSESSRDNMGYRR---------RGVHLHRTEVLTLKEALQGGWKR 310

Query: 323 LTKTFDD-RLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYV 370
             +  D  + + L    G  VR G+T ++   G P  D  H   GDL+V
Sbjct: 311 EIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP-KDGRH--FGDLFV 356

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 103/234 (44%), Gaps = 36/234 (15%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  + F L     C  CHGSG +  +        +C  C G+G   ++ R G   + +
Sbjct: 164 YNGGSISFSLLLNDNCDHCHGSGSEDGKV------KKCPDCGGRGVVIQVIRMG---IVT 214

Query: 204 QWVV--CEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q V   C +C G G+        +N C  C+G  +  K++ I+V+   G   N +   +G
Sbjct: 215 QQVQQRCNRCAGSGEII------QNKCKVCSGAKVQKKEKDISVSFDSGIERNHISVQQG 268

Query: 262 MADEEIDKTTCGDLKFHLTEKQE-NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTG-- 318
            A E+      GDL     E  E N+  ++          G+DL+ +  ++L EA+ G  
Sbjct: 269 EA-EKGPGIEPGDLIVEFFEVPEANMGYRR---------RGKDLFRTEVLTLQEAINGDW 318

Query: 319 --FEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYV 370
               +FL  T   + L L   P  +V  G+  KI   G PIL +  G+ GDLY+
Sbjct: 319 SRDIQFLDPT---KKLQLKRSPMDIVMNGEVEKIPGFGMPILGS-KGKFGDLYI 368

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          Y +LG++++   +EIK+AYR+L+ K HPDK   D+D+      KF EI  AYE+LSDPEK
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDAHN----KFIEIGEAYEVLSDPEK 80

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 81 RRMYDQF 87

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           YDVLG++ +AT  EIK AYRK+A+  HPDK+ D    +    KF+ +  AY++L+DP  
Sbjct: 7  FYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQA---KFQAVGEAYQVLNDPAL 63

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 64 RKQYDEF 70

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  DAT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V R AT  +IK AYRKLA+K HPDK     + E     FK I  A+E+LS+ EK
Sbjct: 22 FYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +S YD
Sbjct: 78 RSIYD 82

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV  +AT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP  +
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQS---KFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
          Ashbya gossypii AER346W
          Length = 374

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          Y +LGV R A+ ++IK+AYR+L+ K+HPDK   D+D+      +F E+  AYE LSDPEK
Sbjct: 23 YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDAHN----RFIEVGEAYEALSDPEK 78

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 79 RKIYDQF 85

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 105/238 (44%), Gaps = 31/238 (13%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE-CESCAGKGSKERLKRFGPGLVA 202
           Y G  ++F +     C  C GSG +  +       VE C  C G+G   ++ R   G + 
Sbjct: 152 YHGTSIEFTMSLNDFCDACDGSGSQDGK-------VEKCGQCGGRGMVVQVIR--QGFIT 202

Query: 203 SQ-WVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
            Q   +C+KC G+G+  K      N C  C G  ++ K +   V+V  G   + V  ++G
Sbjct: 203 QQIQQMCQKCEGRGEVIK------NKCKTCHGSKVVKKNKSFHVDVPAGAPRDFVAVIRG 256

Query: 262 MADEEIDKTTCGDLKFHLTEKQ-ENLEQKQIFLKNFDDGAGEDLYTSITISLSEALT-GF 319
            A++  D T  GD+   + E   +N+  ++          G DL+ +  +SL+EAL  G+
Sbjct: 257 EAEKSPD-TEPGDIYVKVVESPVQNMGYRR---------RGPDLFRTEVLSLTEALKGGW 306

Query: 320 EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
            + L      + + LS   G  V+ G+   I   G P+      + GDLYV   I  P
Sbjct: 307 VRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLESGT--KYGDLYVDYVIVMP 362

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  DA+  +IK AYRK A+  HPDK+ D    +    KF+ I  AY++LSDP+ +
Sbjct: 8  YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQA---KFQAIGEAYQVLSDPDLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L V+ DA+ QEIK +YRKLA+K HPDK  D    +    KF+E+  AY++L D + +
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQT---KFQELAKAYQVLIDDDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KKYDQF 70

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V + AT  EIK AYRKLA+K HPDK     + E     FK I  A+E+LS+ EK
Sbjct: 22 FYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEA----FKVINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +S YD
Sbjct: 78 RSIYD 82

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L +  DAT +EIK AYR   L  HPDK     +  VN +   +I  AY+ILS+ +K+
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L V  DA+  ++K AYR+ AL++HPDK  D + +E   I F EI AAYE+LSDP+++
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPD-NVEEATTI-FAEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  +AT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL++HPDK  + D+ E    KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDK--NPDNVEEATQKFAVIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y+VL + R+A+  EIK AYRKLA+K HPDK     + E     FK I  A+E+LSD +K
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQK 78

Query: 70 KSHYD 74
          +  +D
Sbjct: 79 RRIFD 83

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           YD+L V + A   EIK +YRKLA+K HPDK     + E     FK I  A+E+LSD EK
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGEA----FKVINRAFEVLSDDEK 80

Query: 70 KSHYD 74
          +S +D
Sbjct: 81 RSVFD 85

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L + + A+ +EIK+AYR+L+ K HPDK  +  S+E ++ KF E+  AY++LSDPEKK
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 103/242 (42%), Gaps = 40/242 (16%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVAS 203
           Y G  ++F L     C  CHGSG    +        +C  C G+G   ++ R G   + +
Sbjct: 152 YSGSSIEFTLSLNDECDVCHGSGSADGKL------AQCPDCQGRGVIIQVLRMG---IMT 202

Query: 204 QWV--VCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKG 261
           Q +  +C +C G G+        KN C  C G  +  + +   V+V PG   N + T  G
Sbjct: 203 QQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVDVPPGAPRNYMDTRAG 256

Query: 262 MADEEIDKTTCGDLKFHLTEK-QENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFE 320
            A++  D    GDL     EK  EN+  ++          G++LY +  +S+ EAL G  
Sbjct: 257 EAEKGPD-FDAGDLVIEFKEKDSENMGYRR---------RGDNLYRTEVLSIEEALYGGW 306

Query: 321 KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN---PHG--RCGDLYVFVHIE 375
           +   +  D+       KP ++ RP   + ++N    ++     P G    GDLY+   + 
Sbjct: 307 ERTIEFLDEN------KPVKLSRPA-YVGVSNGEIEVMKGFGMPKGGKGYGDLYIDYVVI 359

Query: 376 FP 377
            P
Sbjct: 360 MP 361

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  +AT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDQF 70

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          YD LG++ DAT  EIK AYRK A+  HPDK+  D D+    + KF+ +  AY++LSDP  
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDA----QAKFQAVGQAYQVLSDPGL 63

Query: 70 KSHYDLY 76
          +S YD +
Sbjct: 64 RSRYDEF 70

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL++HPDK  D + +E  E KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y+VL + R A+  EIK +YRKLA+K HPDK     + E     FK I  A+E+LSD EK
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASEA----FKVINRAFEVLSDEEK 80

Query: 70 KSHYD 74
          +  YD
Sbjct: 81 RRLYD 85

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLGV+  A+  EIK AYRK A++ HPDK+ D    +    KF+ +  AY++LSD E +
Sbjct: 8  YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQA---KFQRVGEAYQVLSDEELR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KRYDEF 70

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   AT  E+K AYRK AL+ HPDK  D + +E  EI F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLG+   AT  EIK AYR+ A++ HPDK+ D  +      +F+++  AY++LSDP+ +
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KQYDEF 70

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 5/70 (7%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIK----FKEITAAYEILSD 66
           Y++LGVT  +T +EIK AYR L+LK HPDK +D++  E   +     F +I+ AYE L++
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDK-LDRNLSEKERLSMEEIFVQISKAYEALTN 181

Query: 67  PEKKSHYDLY 76
           P  K +Y LY
Sbjct: 182 PATKENYLLY 191

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 99/239 (41%), Gaps = 32/239 (13%)

Query: 144 YMGKKLKFDLKRQVICIKCHGSGWKP-KRKIHVTHDVECESCAGKGSKERLKRFGPGLVA 202
           Y G   +F L     C  CHG+G +  K K+       C  C G G   ++ R G   + 
Sbjct: 163 YQGFDFQFALNLHDDCDHCHGTGSEDGKTKV-------CPDCKGSGIIIQIIRMG---MM 212

Query: 203 SQWVV--CEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVK 260
           +Q +   C +C G+G   K      NFC  C G  +  K +   V V PG   N V    
Sbjct: 213 TQQIQQPCGRCRGQGHLIK------NFCKVCNGAKVQQKLKDFKVYVPPGSPRNHVEVKA 266

Query: 261 GMADEEIDKTTCGDLKFHLTE-KQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTG- 318
           G A++  +    GD+     E   +NL  ++          G +L+ +  ISL+EAL G 
Sbjct: 267 GQAEKNPNYEP-GDVIIEFNELPLDNLGYRR---------RGNNLFRTEYISLNEALYGN 316

Query: 319 FEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377
           +E+ L      + + L   P   +  G+   +   G PI  N   + GDLY+   +  P
Sbjct: 317 WERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPI-PNKKNKFGDLYIDYKVIIP 374

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 7  GDRLYDVLGVTRDATVQ-EIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILS 65
           D  Y +LG+ ++   + EIK+AYRKL+ K+HPDK  +    + N IK  E   AY++L 
Sbjct: 22 ADDYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIKVGE---AYDVLG 78

Query: 66 DPEKKSHYD 74
          DP+KK  YD
Sbjct: 79 DPDKKRQYD 87

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   AT  E+K AYRK AL+ HPDK  D +  E  EI F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPD-NVDEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           Y+ LGV +DA+  +IK AY KLA + HPD  +++D  E  E KF ++  AYEILSD  K+
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPD--INKD--EGAEKKFHDLQNAYEILSDENKR 98

Query: 71  SHYDLY 76
             YD +
Sbjct: 99  RQYDQF 104

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG++  AT  EIK AYRK ++K HPDK  +  S      +F+ I+ AY++LSD + +
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 71 SHYDLY 76
          S+YD Y
Sbjct: 65 SNYDKY 70

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV  +AT  E+K AYR+ AL+ HPDK  + D+ E     F  + AAYE+L+DP+++
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDK--NPDNVEETTAIFASVRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V R +T  EIK AYRKLA++ HPDK     + E     FK I  A+E+LSD EK
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASEA----FKIINRAFEVLSDNEK 77

Query: 70 KSHYD 74
          +  +D
Sbjct: 78 RRIFD 82

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L V  DAT  ++K AYRK AL +HPDK  + + +E  E+ F +I AAYE+LSD +++
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRN-NIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y +L V + AT  EIK AYRKLA+K HPDK     + E     FK I  A+E+LS+ EK
Sbjct: 22 FYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEA----FKIINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +  YD
Sbjct: 78 RGLYD 82

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L V+  A+  E+K AYRK AL++HPDK  ++++ E     F EI AAYE+LSDP+++
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDK--NRENPEEATAIFSEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV  +AT  EIK AYR+ A++ HPDK+ +  + +    KF+ +  AY++LSD E +
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNAQA---KFQAVGEAYQVLSDDELR 64

Query: 71 SHYD 74
            YD
Sbjct: 65 KRYD 68

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68
          + Y++L V R A   EIK +YRKLA++ HPDK     + E     FK I  A+E+L D E
Sbjct: 22 QFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEA----FKLINRAFEVLGDSE 77

Query: 69 KKSHYD 74
          K+S YD
Sbjct: 78 KRSLYD 83

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           YD+LGV+  A+ +EIK+AYRKL+LK HPDK    + ++ K   E  + +I+ AYE L+D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 68  EKKSHYDLY 76
             K +Y +Y
Sbjct: 182 LVKQNYLMY 190

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDK--YVDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +LG++++AT ++I+ AY +L  ++HPDK  ++ +  ++ N  K  EI  AYE LSD  
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 69  KKSHYD 74
           KKS YD
Sbjct: 621 KKSEYD 626

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKY-VDQDSKEVNEIKFKEITAAYEILSDPEK 69
          YD+LG+T  AT  EIK AYRK ++K HPDK   D  + E    +F++I+ AY++LSD   
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE----RFQQISEAYQVLSDEHL 63

Query: 70 KSHYDLY 76
          +++YD +
Sbjct: 64 RNNYDQF 70

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V + A   EIK AYRKLA+K HPDK     + E     FK I  A+E+LSD EK
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASEA----FKIINRAFEVLSDVEK 78

Query: 70 KSHYD 74
          +  YD
Sbjct: 79 RQLYD 83

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGVT  AT  EIK AYRK +++ HPDK  ++D     E +F+ I+ AY++LSD + +
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDK--NRDDPMATE-RFQAISEAYQVLSDEDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 GKYDRF 70

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L +  DAT +EIK AYR   L  HPDK   + S +VN +    I  AY++LS+ + +
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV+RDA+  +IK AY KLA K+HPD   +  + +     F  +  AYEILSD +KK
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKT----FHNLQNAYEILSDEKKK 105

Query: 71  SHYDLY 76
             YD Y
Sbjct: 106 LQYDQY 111

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV+  A   E+K A+R+ AL++HPDK  ++D+ E     F +I AAYE+L+DP+++
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDK--NRDNVEEATETFAQIRAAYEVLNDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  +AT  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSD   +
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDQGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           YD+L V R ++  +IK AYRKLA+K HPDK     + E     FK I  A+E+LSD +K
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEA----FKLINRAFEVLSDSQK 77

Query: 70 KSHYD 74
          +  YD
Sbjct: 78 RQIYD 82

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 4/61 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y+VL V + A+  EIK AYRKLA+K HPDK     + E     FK I  A+E+LSD +K
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQK 78

Query: 70 K 70
          +
Sbjct: 79 R 79

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+  AT  EIK AYRK +++ HPDK  + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPN-DPKATE--RFQAISEAYQVLGDDELR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 AKYDKY 70

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL+ HPDK  D +  E  E  F  I AAYE+LSDP+++
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPD-NVDEATE-NFATIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL++HPDK  D + +E  E KF  I AAYE+LSD +++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVEEATE-KFAIIRAAYEVLSDSQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL++HPDK  + D+ E    KF  I AAYE+LSD +++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK--NPDNVEEATQKFAIIRAAYEVLSDSQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V + A+  EIK AYRKLA++ HPDK     + E     FK I  A+E+LSD  K
Sbjct: 25 FYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEA----FKRINRAFEVLSDVGK 80

Query: 70 KSHYD 74
          +  +D
Sbjct: 81 RRMFD 85

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y+VL V R A+  EIK AYR+LA+K HPDK     S E     FK I  A+E+L D +K
Sbjct: 24 FYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEA----FKVINRAFEVLGDEDK 79

Query: 70 KSHYD 74
          +  +D
Sbjct: 80 RRLFD 84

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  ++K AYRK AL +HPDK  ++D+ E     F  I AAYE+L+DP+++
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDK--NRDNVEEATAIFATIRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  DA   E++ AYR+  L+ HPDK    D   V  I+      AY +LSDP ++
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQ-----QAYRVLSDPTQR 60

Query: 71 SHYD 74
          S YD
Sbjct: 61 SAYD 64

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD LG++  AT  EIK AYR+ A++ HPDK+ D    E    KF+ +  AY++LSD   +
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAEN---KFQAVGEAYQVLSDESLR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 ARYDEY 70

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY--VDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +LGV + AT ++++ +Y +L  K HPDK   ++ + ++ NE K  EI  AYEILSD +
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 69  KKSHYD 74
           K++ YD
Sbjct: 590 KRTKYD 595

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  A+ ++IK+AYRKL++K HPDK    +  D K+V E  + +IT AYE L+D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+   AT  EIK AYRK A++ HPDK+ D    +    KF+ +  AY++LSD + +
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQS---KFQSVGEAYQVLSDDDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KRYDEF 70

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL++HPDK   +  +E  EI F  I  AYE+LSDP+++
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTK-VEEATEI-FATIRTAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y+VL V R +   EIK +YRKLA+K HPDK     + E     FK I  A+E+LSD EK
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASEA----FKVINRAFEVLSDNEK 78

Query: 70 KSHYD 74
          +  +D
Sbjct: 79 REIFD 83

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  A+ ++IK+AYRKL++K HPDK    +  D K V E  + +IT AYE L+D 
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  ++K AYR+ AL++HPDK +  + ++  EI F  I AAYE+LSD +++
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIG-NVQQATEI-FASIRAAYEVLSDAQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  A+ ++IK+AYRKL++K HPDK    +  D K V E  + +IT AYE L+D 
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK ALK+HPDK  + ++ E     F  I  AYE+LSDP+++
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDK--NPNNVEEATQAFATIRLAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LGV+  A+ ++IK+AYRKL++K HPDK    +  D K V E  + +IT AYE L+D 
Sbjct: 127 YEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  ++K AYR+ AL++HPDK  + D+ E     F  I +AYE+L+DP+++
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDK--NPDNVEEATTVFATIRSAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           YD+L V + A   EIK +YRKLA+K HPDK     + E     FK I  A+E+L D +K
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASEA----FKRINRAFEVLGDEKK 80

Query: 70 KSHYD 74
          +  +D
Sbjct: 81 RVLFD 85

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L V   A   E+K AYR+ AL++HPDK   ++ +E  EI F  I AAYE+LSDP+++
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNP-ENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDK--YVDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +LGV +++ ++EI+ +Y  L  K+HPDK   + ++ +E N  K ++I  AYE LSD  
Sbjct: 606 YKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSDES 665

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 666 KRKEYDL 672

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 11/73 (15%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEI-------KFKEITAAYEI 63
           Y++LGVT  +T +EIK+AYRKL++K HPDK     SK++NEI       +F  I  AY+ 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKL----SKDLNEIERTAMEEQFVMINKAYKA 168

Query: 64  LSDPEKKSHYDLY 76
           L+D   K +Y  Y
Sbjct: 169 LTDEITKENYRKY 181

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQ------DSKEVNEIKFKEITAAYEIL 64
          Y+VL +  DAT+QEIK AY++  L  HPDK   Q       + ++  +   +I  AY+IL
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 65 SDPEKKSHYD 74
          S+   +  YD
Sbjct: 71 SNESTREQYD 80

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 7   GDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEI--KFKEITAAYEIL 64
           G   Y VLG+++ A+ +EI+ AY  L  K+HPDK      KE  +I  K  ++  AYEIL
Sbjct: 520 GKDYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEIL 579

Query: 65  SDPEKKSHYD 74
           SD  KK  YD
Sbjct: 580 SDEGKKRDYD 589

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L V   A+  ++K AYR+ AL++HPDK ++ + KE  +I F  I  AYEILSDP+++
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNIN-NIKEATDI-FANIRTAYEILSDPQER 63

Query: 71 SHYD 74
            YD
Sbjct: 64 VWYD 67

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDK--YVDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +LGV +++  + I+ AY  L  K+HPDK   + Q  +E N  K  EI  AYEIL D  
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 69  KKSHYD 74
           KK  YD
Sbjct: 616 KKKEYD 621

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ DA   EIK AYRK +++ HPDK  + D K     +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPN-DPKATE--RFQAISEAYQVLSSDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L + ++A+  ++K AYRKLA+K HPDK     + E     FK+I  A+E+LSD  K
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEA----FKKINRAFEVLSDENK 80

Query: 70 KSHYD 74
          +  YD
Sbjct: 81 RKVYD 85

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY--VDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +L V ++A  ++I+ AY +L  K+HPDK   + ++ +  NE K   I  AYEILSD  
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 569 KRKEYDL 575

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V + A+  +IK AYRKLA+K HPDK     + E     FK+I  A+E+LSD  K
Sbjct: 23 FYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEA----FKKINRAFEVLSDDSK 78

Query: 70 KSHYD 74
          +  +D
Sbjct: 79 RRIFD 83

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEI--KFKEITAAYEILSDPE 68
           Y +L V++DA  ++I+ +Y  L  K HPDK      KE  +I  K  EI  AYE+LSD  
Sbjct: 529 YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSDET 588

Query: 69  KKSHYDL 75
           K++ YDL
Sbjct: 589 KRNEYDL 595

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           YD+LG++  A+ +EIK+AYRKL++K HPDK    + +  +   E  + +IT AYE L+D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 68  EKKSHYDLY 76
             + ++  Y
Sbjct: 181 LTRQNFLKY 189

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+  A+  EIK AYRK +++ HPDK  + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPN-DPKATE--RFQAISEAYQVLGDNELR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 VKYDKY 70

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V R A   EIK AYRKLA+K HPDK     + E     FK I  A+E+L + EK
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAEA----FKLINRAFEVLGNSEK 78

Query: 70 KSHYD 74
          +  ++
Sbjct: 79 REIFN 83

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDK--YVDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y VLGV + AT ++I+ +Y  +  K+HPDK   + +  K  N+ K  EI  AYEILSD  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 69  KKSHYD 74
           K+  YD
Sbjct: 567 KRKEYD 572

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L +  DAT +EIK AYR   L  HPDK        ++ +   +I  AY ILSD   +
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 CEYD 73

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+   AT  EIK AYRK ++K HPDK  + +  +  E +F+ I+ AY++LSD   +
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDK--NPNDPQATE-RFQAISEAYQVLSDESLR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 LKYDKY 70

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON}
          Anc_1.185 YJL162C
          Length = 586

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+T  A+V EI+ +Y KLA   HPDK     S+E+    FK ++ A+ IL DPE K
Sbjct: 16 YSVLGLTSKASVSEIRKSYMKLAKSLHPDKSKSNASEEL----FKIVSNAHSILIDPELK 71

Query: 71 SHYD 74
            YD
Sbjct: 72 LDYD 75

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+  A+  EIK AYRK +++ HPDK  + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPN-DLKATE--RFQAISEAYQVLGDDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 87/206 (42%), Gaps = 31/206 (15%)

Query: 159 CIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYT 218
           C  C G+G KP      TH V C +C G G+   + R G  ++++    C  CNG+G   
Sbjct: 230 CSTCSGTGMKPN-----THKVSCSTCHGTGTTVHI-RGGFQMMST----CPTCNGEGTM- 278

Query: 219 KRPKNPKNFCPDCAGLGL-LSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF 277
              K P++ C  C G G+ +++ + ITV++  G    DV+ + G      D     DLK 
Sbjct: 279 ---KRPQDNCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYP-DIAVEADLKD 334

Query: 278 HLTEKQENLEQKQIFLK-------NFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDR 330
            +      L +  I ++       NF      D++    I ++ A  G       T + +
Sbjct: 335 SV-----KLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTAALG-GTVTIPTVEGQ 388

Query: 331 LLTLSVKPGRVVRPGDTIKIANEGWP 356
            + + V PG   +    I I N G P
Sbjct: 389 KIRIKVAPG--TQYNQVISIPNMGVP 412

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           YD LG+ + AT  EIK AY KLA K+HPD   + D+    E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSDETKR 118

Query: 71  SHYD 74
             YD
Sbjct: 119 QQYD 122

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  A+ ++IK+AYRKL+LK HPDK    + +  +E  E ++ +IT AYE L+D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 183 LIRFNYLTY 191

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  A+ ++IK+AYRKL++K HPDK    + Q+ +   E K+ +IT AYE L+D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 68  EKKSHYDLY 76
             K ++  Y
Sbjct: 183 VIKENFLKY 191

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 44/65 (67%), Gaps = 5/65 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          YD+LG+T +AT  EIK AYRK +++ HPDK   D  + E    +F+ I+ AY++LS+ E 
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE----RFQAISEAYQVLSNDEL 63

Query: 70 KSHYD 74
          ++ YD
Sbjct: 64 RAKYD 68

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   +TV EIK AY++  L  HPDK     + E   +  +EI  AY++L +P  K
Sbjct: 8  YEILGVDTKSTVAEIKKAYKEKLLCTHPDK---NRTVEAQNVSIEEIKEAYQVLVNPSGK 64

Query: 71 SHYD 74
           +YD
Sbjct: 65 ENYD 68

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKE---VNEIKFKEITAAYEILSDP 67
           YD+LG++  A+ ++IK+AYR+L+LK HPDK   + S E     E  + +I+ A+E L+DP
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 IVRENYLKY 195

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQ-DSKEVNEIKFKEITAAYEILSDPEK 69
          YD+LGV  ++T  EIK AYRK ++K HPDK  +  D+ +    KF+ I+ AY++LSD   
Sbjct: 8  YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATK----KFQAISEAYQVLSDKNL 63

Query: 70 KSHYDLY 76
          +S+YD +
Sbjct: 64 RSNYDKF 70

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 87/206 (42%), Gaps = 31/206 (15%)

Query: 159 CIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYT 218
           C  C G+G KP      TH V C +C G G+   + R G  ++++    C  CNG+G   
Sbjct: 229 CSTCSGTGMKPN-----THKVNCSTCHGTGTTVHI-RGGFQMMST----CPTCNGEGTM- 277

Query: 219 KRPKNPKNFCPDCAGLGL-LSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF 277
              K P++ C  C G G+ +++ + ITV++  G    DV+ + G      D     DLK 
Sbjct: 278 ---KRPQDSCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYP-DIAVEADLKD 333

Query: 278 HLTEKQENLEQKQIFLK-------NFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDR 330
            +      L +  I ++       NF      D++    I ++ A  G       T + +
Sbjct: 334 TV-----KLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTAALG-GTVTIPTVEGQ 387

Query: 331 LLTLSVKPGRVVRPGDTIKIANEGWP 356
            + + V PG   +    I I N G P
Sbjct: 388 KIRIKVAPG--TQYNQVISIPNMGVP 411

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVN-EIKFKEITAAYEILSDPEK 69
           YD LG+ + AT  EIK AY KLA K+HPD      +KEV+ E KF ++  AYEILSD  K
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI-----NKEVDAEKKFHDLQNAYEILSDENK 117

Query: 70  KSHYD 74
           +  YD
Sbjct: 118 RQQYD 122

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLGV   A+  EIK AY KLA ++HPD  +++++    E KF ++  AYEILSD  K+
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPD--INKEAGA--EKKFHDLQNAYEILSDESKR 92

Query: 71 SHYD 74
            +D
Sbjct: 93 KQFD 96

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LGV+  A  +EIK+AYRKL++K HPDK    +  +++   E  + +IT AYE L+D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 68  EKKSHYDLY 76
             K +Y  Y
Sbjct: 184 NVKENYLRY 192

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKY----VDQDSKEVNEIKFKEITAAYEILSD 66
          Y+VLGV  DA+  EIK  YRK+ L  HPDK     +D   K  + +   +I  AY +LS+
Sbjct: 12 YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 67 PEKKSHYD 74
           + ++ Y+
Sbjct: 72 DQLRAAYN 79

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV  DA   +IK AYRK ++K HPDK  D  +      +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEELR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 MKYDKF 70

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%), Gaps = 4/65 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+T  A++ +IK +Y+KLA + HPDK    +S E+    FK +  AY ILSD +++
Sbjct: 9  YSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSEL----FKIVVDAYSILSDVKER 64

Query: 71 SHYDL 75
            Y++
Sbjct: 65 EEYNI 69

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y+VL V  DA++ EIK AYR   L  HPDK  D++   +N +    I  AY +LSD + +
Sbjct: 5  YEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDENKPALN-VSVNAIQEAYRVLSDEKLR 63

Query: 71 SHYD 74
            YD
Sbjct: 64 REYD 67

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ +A   EIK AYRK +++ HPDK  +  S      +F+ I+ AY++LS+ E +
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNEELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 TKYDKF 70

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDK--YVDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y VL VT  AT ++I+ +Y  +  K+HPDK   + +  K  N+ +  EI  AYEILSD  
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 69  KKSHYD 74
           K+  YD
Sbjct: 565 KRKEYD 570

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69
           Y++L V   A+  +IK AYRK+A+K HPDK     + E     FK++  A+E+LSD +K
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSDEKK 80

Query: 70 KSHYD 74
          +  YD
Sbjct: 81 RRVYD 85

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKY-VDQDSKEVNEIKFKEITAAYEILSDPEK 69
          YD+LGV+  A+  EIK AYRK +++ HPDK   D  + E    +F+ I+ AY++L D + 
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE----RFQAISEAYQVLGDDDL 63

Query: 70 KSHYDLY 76
          ++ YD Y
Sbjct: 64 RAKYDKY 70

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEI--KFKEITAAYEILSDPE 68
           Y +LG+  DA  ++I+ AY  L  K+HPDK  +    E  ++  K   I  AYE+LSD  
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 69  KKSHYDL 75
           K+  YD+
Sbjct: 571 KRKEYDM 577

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQD--SKEVNEIKFKEITAAYEILSDPE 68
          Y+VL V   A++ +IK AYR+  L  HPDK   Q   S+   +   ++I  AY +L+DP 
Sbjct: 6  YEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPT 65

Query: 69 KKSHYD 74
          ++  YD
Sbjct: 66 RREQYD 71

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 43/64 (67%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV   AT  EIK AYRK ++  HPDK  ++D     E +F+ I+ AY++LS+ + +
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDK--NRDDPAATE-RFQSISEAYQVLSNKDLR 64

Query: 71 SHYD 74
          ++YD
Sbjct: 65 ANYD 68

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          YD+LG+   AT  EIK AYRK +++ HPDK   D  + E    +F+ I+ AY++LS  E 
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE----RFQAISEAYQVLSSEEL 63

Query: 70 KSHYDLY 76
          ++ YD +
Sbjct: 64 RAKYDKF 70

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (65%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIKFKEITAAYEILSDPEK 69
          Y++LG+   AT  EIK AYRK +++ HPDK   D  + E    +F+ I+ AY++LSD + 
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE----RFQAISEAYQVLSDSDL 63

Query: 70 KSHYDLY 76
          +++YD +
Sbjct: 64 RANYDKF 70

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 2   SGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYV--DQDSKEVNEIKFKEITA 59
           S  D     Y  LGVT  AT +EI+ AY  L  K+HPDK      D KE       +I  
Sbjct: 531 SSYDPKKDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINE 590

Query: 60  AYEILSDPEKKSHYDL 75
           AYE LSD  K+  YDL
Sbjct: 591 AYEALSDDNKRKEYDL 606

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 88/206 (42%), Gaps = 31/206 (15%)

Query: 159 CIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYT 218
           C  C G+G KP      TH V C +C G G+   + R G  ++++    C  CNG+G   
Sbjct: 235 CGTCSGTGMKPN-----THKVNCGTCHGTGTTVHI-RGGFQMMST----CPTCNGEGTM- 283

Query: 219 KRPKNPKNFCPDCAGLGL-LSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF 277
              K P++ C  C G G+ +++ + ITV++  G    DV+ + G      D     DLK 
Sbjct: 284 ---KRPQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYP-DIAVEEDLKD 339

Query: 278 HLTEKQENLEQKQIFLK-------NFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDR 330
            +      L +  I ++       NF      D++ +  I ++ A  G       T + +
Sbjct: 340 SV-----KLSRGDILVRIRVDKDPNFSIKNKYDIWYNKEIPITTAALG-GTVTIPTVEGQ 393

Query: 331 LLTLSVKPGRVVRPGDTIKIANEGWP 356
            + + V PG   +    I I N G P
Sbjct: 394 KIRIKVAPG--TQYNQVISIPNMGVP 417

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           YD LG+ + AT  EIK AY KLA K+HPD   + D+    E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSDESKR 118

Query: 71  SHYDLY 76
             YD +
Sbjct: 119 QQYDQF 124

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 86/206 (41%), Gaps = 31/206 (15%)

Query: 159 CIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYT 218
           C  C G+G KP      TH V C +C G GS   + R G  ++++    C  CNG+G   
Sbjct: 234 CGTCSGTGMKPN-----THKVSCTTCHGSGSTVHV-RGGFQMMST----CPTCNGEGTM- 282

Query: 219 KRPKNPKNFCPDCAGLGLLSKK-EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF 277
              K P++ C  C G G+ + + + ITV++  G    DV+ + G      D     DL+ 
Sbjct: 283 ---KRPQDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYP-DIAVEADLQD 338

Query: 278 HLTEKQENLEQKQIFLK-------NFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDR 330
            +      L +  I ++       +F      D++    I ++ A  G       T D +
Sbjct: 339 SI-----KLSRGDILVRIRVDKDPSFSIRNKYDIWYDKEIPITTAALG-GTITIPTVDGQ 392

Query: 331 LLTLSVKPGRVVRPGDTIKIANEGWP 356
            + + V PG   +    I I N G P
Sbjct: 393 KIRIKVAPG--TQYNQVISIPNMGVP 416

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           YD LG+ + AT  EIK AY KLA K+HPD   + D+    E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSDDTKR 118

Query: 71  SHYD 74
             +D
Sbjct: 119 QQFD 122

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGVT  A  ++   AYR  A++ HPD      +      KF+E++ AY++LSDP+ K
Sbjct: 8  YDILGVTPSAFAEQNNKAYRMKAIQTHPDM---NPTHPYAHAKFQEVSKAYKVLSDPDLK 64

Query: 71 SHY 73
          + Y
Sbjct: 65 NRY 67

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L +  DAT  EIK AYR   L  HPDK        V+ +   +I  AY+ILS+ + +
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 REYD 73

>TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON}
          Anc_1.113 YJR097W
          Length = 168

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y+VLGVT D+T+ +IK AY++  L  HPDK   Q  K  N     +I  AY +L++   +
Sbjct: 11 YEVLGVTTDSTLMDIKRAYKEKLLNVHPDKNKGQAPKS-NTYSVNQIQEAYGVLAEQTLR 69

Query: 71 SHYD 74
          + YD
Sbjct: 70 TQYD 73

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
           Y+ LGV+RDA+  +IK AY KLA K+HPD  +++D  E  E KF ++  AYEILSD  K+
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPD--INKD--EGAEKKFHDLQNAYEILSDESKR 108

Query: 71  SHYDLY 76
           S YD +
Sbjct: 109 SQYDQF 114

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 78/200 (39%), Gaps = 39/200 (19%)

Query: 180 ECESCAGKGSKERLKRFGPGL---VASQWVV---------CEKCNGKGKYTKRPKNPKNF 227
           +C +CAG G K   KR    +     +Q  V         C +CNG+G   +R       
Sbjct: 218 QCGTCAGSGLKSGAKRSSCSICHGTGTQMHVRAGFQMASTCTQCNGEGSSIRRSDQ---- 273

Query: 228 CPDCAGLGLL-SKKEIITVNVAPGHHFNDVITVKGMA-------DEEID---KTTCGDLK 276
           C  C G G++ ++++ I V++  G    DV+ V           D E+    +T  GDL 
Sbjct: 274 CSSCRGEGVVFNRQKEIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLL 333

Query: 277 FHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSV 336
             +  +++   Q      N+D       YT      + AL G       T D   L L +
Sbjct: 334 IQIRVERDPRFQ---IRNNYD-----IWYTQDIPITTAALGGVVNI--PTVDGEQLRLKI 383

Query: 337 KPGRVVRPGDTIKIANEGWP 356
            PG   +    + + N+G P
Sbjct: 384 APG--TQHEQVVSVPNKGVP 401

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 2   SGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYV--DQDSKEVNEIKFKEITA 59
           S  D     Y +LGV+ +A  +EI+ AY  L  K+HPDK      D KE       +I  
Sbjct: 535 SSYDPKKDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINE 594

Query: 60  AYEILSDPEKKSHYDL 75
           AYE LSD +K+  YDL
Sbjct: 595 AYETLSDEDKRKEYDL 610

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV--DQDSKEVNEIKFKEITAAYEILSDPE 68
           Y VLGV   AT +EI+ AY  L  K+HPDK      D +E       +I  AYE LSD +
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 597 KRKEYDL 603

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LG++  AT  EIK AYRK +++ HPDK  + +     E +F+ I+ AY++LSD   +
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSDDTLR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 LKYDKY 70

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 7/76 (9%)

Query: 7   GDRLYDVLGVTR----DATVQEIKTAYRKLALKHHPDKYVD--QDSKEVNEIKFKEITAA 60
           G  LYDVLG+      + TV+E+K  Y+KL L++HPDK V   +D+  V   +F  + +A
Sbjct: 80  GVDLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVAS-RFHSLRSA 138

Query: 61  YEILSDPEKKSHYDLY 76
           ++IL D   ++ YD +
Sbjct: 139 FQILCDSSLRTQYDQW 154

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y +LGV   AT +E+++AYRKL++K HPDK    + Q+ +   E ++  IT AY+ L+D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 68  EKKSHY 73
             K +Y
Sbjct: 178 ITKENY 183

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  A+ ++IK+AYRKL++K HPDK    + +  +   E  + +IT AYE L+D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 68  EKKSHYDLY 76
             + ++  Y
Sbjct: 191 AMRENFLKY 199

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 7/71 (9%)

Query: 7  GDRLYDVL----GVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYE 62
          G  LY+ L     +TR  ++QEIK  YR LALK+HPDK+ + DS  ++  KF EI+ A  
Sbjct: 12 GKDLYEDLEITDALTRRISIQEIKRQYRTLALKYHPDKHPN-DSNLIH--KFHEISIATN 68

Query: 63 ILSDPEKKSHY 73
          IL+D +    Y
Sbjct: 69 ILTDEKLSEEY 79

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 6   RGDR-LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEI--KFKEITAAYE 62
           R DR  Y +LG+ + AT ++I+ AY     K+HPDK      KE ++I  K  +I  AYE
Sbjct: 490 RTDRDYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYE 549

Query: 63  ILSDPEKKSHYD 74
            LSD  ++  YD
Sbjct: 550 TLSDDTRRKEYD 561

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ DA   +IK AYRK +++ HPDK  + D K     +F+ I+ AY++L   E +
Sbjct: 8  YDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPN-DPKATE--RFQAISEAYQVLGSDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDS---KEVNEIKFKEI 57
           ++ S      Y +LG+  +A+ +EI+ AY  L  K+HPDK   Q S   ++ N+ K  EI
Sbjct: 533 LTDSQTAKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEI 592

Query: 58  TAAYEILSDPEKKSHYD 74
             AYE+L+D EK+  YD
Sbjct: 593 NEAYEVLNDEEKRKEYD 609

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L +   AT  EIK AYRK ++K HPDK  + +     E +F+ I+ AY++LSD   +
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQAISEAYQVLSDKNLR 64

Query: 71 SHYDLY 76
          ++YD +
Sbjct: 65 ANYDKF 70

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-DQDSKEVNEIK--FKEITAAYEILSDP 67
           Y +LGV+  AT ++IK+AYRKL++K HPDK   D   +E   I+  + +I+ AYE L+D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 68  EKKSHYDLY 76
             K++Y  Y
Sbjct: 185 ITKANYLTY 193

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+T DAT  +IK AYRK+A+  HPDK     + E+    FK ++ A  +L D E++
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAEL----FKLVSHAQSVLIDKEQR 69

Query: 71 SHYD 74
            Y+
Sbjct: 70 QSYN 73

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+T +AT  EI+ +Y  LA K HPDK   + + E+    FK +  A+ IL+D EKK
Sbjct: 15 YSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGEL----FKLVVHAHSILTDVEKK 70

Query: 71 SHYD 74
            YD
Sbjct: 71 RAYD 74

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV  DAT +EI  +YRKLA+K HPDK      +E+    FK +  A+ +L++ E++
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEEL----FKLVVHAHSVLTNGEER 66

Query: 71 SHYD 74
          + Y+
Sbjct: 67 AKYN 70

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV--DQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +LGV+  A+ +EI+ AY  L  K+HPDK      D +E       +I  AYE LSD +
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 600 KRKEYDL 606

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY--VDQDSKEVNEIKFKEITAAYEILSDPE 68
           Y +L + ++A  +EI+ AY      +HPDK   + ++ ++ N+ K  EI  AYE LSD  
Sbjct: 477 YKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSDEG 536

Query: 69  KKSHYDL 75
           K+  YD+
Sbjct: 537 KRREYDM 543

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           Y +L ++  +T +EI++AYRKL++K HPDK    +  D + V E ++  IT AY+ L+D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 177 ITRENYLRY 185

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ DA   +IK AYRK +++ HPDK  + +     E +F+ I+ AY++LS  + +
Sbjct: 8  YDLLGVSPDAKSIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKDDLR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 6/65 (9%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSK-EVNEIKFKEITAAYEILSDPEK 69
          Y+ LG+  D +++EIK AY++  L  HPDK  D+ S  EVN+I+      AY++L D   
Sbjct: 6  YETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDESSSVEVNKIQ-----EAYKVLCDVNL 60

Query: 70 KSHYD 74
          +  YD
Sbjct: 61 REKYD 65

>KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa]
          {ON} some similarities with uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 653

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 9/79 (11%)

Query: 1  MSGSDRGDRL-----YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFK 55
          MSGSD+  +L     Y VL +   AT  +I+ AY KLA + HPDK   +++ E+    FK
Sbjct: 1  MSGSDKTYQLDETTLYSVLNLKYGATEVQIRKAYMKLARELHPDKSKSEEAGEL----FK 56

Query: 56 EITAAYEILSDPEKKSHYD 74
          ++  A+ IL+D ++K  YD
Sbjct: 57 KVAHAHFILTDKKEKMKYD 75

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YDV+GV    + +++K +Y++L  K HPDK     +KE     F  +  AY+ LS+ +K+
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQKR 80

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 81 AMYDKY 86

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKY---VDQDSKEVNEIKFKEITAAYEILSDP 67
           YD+LG++  ++ ++IK+AYRKL++K HPDK    +  D + V E K+ +IT AYE L+D 
Sbjct: 124 YDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 184 TVRENYLKY 192

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+T +AT  E+  +Y KLA   HPDK     S+E+    FK +  A+ IL+D ++K
Sbjct: 15 YSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEEL----FKAVVHAHSILTDEDQK 70

Query: 71 SHYD 74
            YD
Sbjct: 71 LRYD 74

>Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar to
          Ashbya gossypii AEL112C
          Length = 543

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+  D T   I+ +Y +LA + HPDK     SKE  E+ FK +  A+ IL+D EKK
Sbjct: 14 YSVLGLPFDTTEMHIRKSYMRLARELHPDK---SKSKEAAEL-FKIVAHAHSILTDKEKK 69

Query: 71 SHYD 74
            YD
Sbjct: 70 LKYD 73

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 39/68 (57%), Gaps = 6/68 (8%)

Query: 10 LYDVLGVTRD---ATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSD 66
          LYD+LG   +    T  EIK  YR LALK+HPDK    D   V   KF +IT A  IL++
Sbjct: 15 LYDILGFHNNNSTITSNEIKKRYRSLALKYHPDK-TPNDLTLVE--KFHKITIALNILTN 71

Query: 67 PEKKSHYD 74
           + K+ YD
Sbjct: 72 NQLKTEYD 79

>ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 433

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 14/73 (19%)

Query: 10  LYDVLGVTR---DATVQEIKTAYRKLALKHHPDKY-----VDQDSKEVNEIKFKEITAAY 61
           LY  +G+++    AT ++I  ++RK  LKHHPDK      +DQD        FK I  AY
Sbjct: 98  LYAAMGLSKLRYRATPEQIIKSHRKQVLKHHPDKKSAHGGLDQDG------FFKIIQKAY 151

Query: 62  EILSDPEKKSHYD 74
           E L DP KK+ YD
Sbjct: 152 ETLIDPTKKAQYD 164

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV   A   +IK AYRK +++ HPDK  + +     E +F+ I+ AY++LS  + +
Sbjct: 9  YDLLGVDPSAKAIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKEDLR 65

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 66 AKYDKY 71

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV  DAT  EIK AYRK AL   P+K+        NE KF+ I  AY++L   E +
Sbjct: 8  YELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIG--ANE-KFQAIAEAYQVLHSKELR 64

Query: 71 SHYD 74
            YD
Sbjct: 65 EKYD 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,478,661
Number of extensions: 2128831
Number of successful extensions: 7975
Number of sequences better than 10.0: 383
Number of HSP's gapped: 7573
Number of HSP's successfully gapped: 488
Length of query: 459
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 346
Effective length of database: 40,524,141
Effective search space: 14021352786
Effective search space used: 14021352786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)