Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR089C (ALT1)8.263ON59259231800.0
Smik_12.1488.263ON59259230670.0
Skud_12.1578.263ON59259230200.0
Suva_10.1738.263ON59259229340.0
TDEL0F039008.263ON55956521470.0
NCAS0B050208.263ON56849221300.0
NDAI0B019908.263ON58849921270.0
KNAG0G020408.263ON59149420780.0
ZYRO0C01628g8.263ON53452820640.0
SAKL0H17006g8.263ON53150720250.0
KLLA0F19162g8.263ON52848620240.0
CAGL0L12254g8.263ON57457920150.0
KAFR0B027308.263ON53948919580.0
Kpol_392.58.263ON51249619080.0
NCAS0B038408.263ON49749518410.0
TPHA0J007508.263ON52249618400.0
KNAG0M012108.263ON52152618250.0
Smik_4.3578.263ON50749318050.0
KLTH0G13662g8.263ON51948118020.0
TBLA0E044408.263ON56249217920.0
Skud_4.3728.263ON50748917720.0
YDR111C (ALT2)8.263ON50748917700.0
Kwal_56.237918.263ON51850617710.0
Suva_2.2718.263ON50749317610.0
KAFR0B055308.263ON51448917460.0
Kpol_543.398.263ON49248917270.0
NDAI0J013608.263ON50149717150.0
KAFR0B05520singletonON51049416930.0
Ecym_43078.263ON53452116840.0
TPHA0A018008.263ON49849016660.0
AGR085W8.263ON52149116590.0
TBLA0G01630singletonON50049416280.0
TBLA0F030608.263ON50049416050.0
Kwal_34.160181.472ON3791671375e-08
KLTH0G19646g1.472ON3791511294e-07
Kwal_23.48882.252ON3891241278e-07
SAKL0F02156g3.511ON4981581224e-06
Kpol_1039.222.252ON3861691214e-06
KLLA0F10021g3.511ON4971251198e-06
TPHA0O014501.321ON4431681171e-05
TPHA0D033703.511ON4971581172e-05
KLTH0G09614g2.252ON3891251152e-05
KNAG0B006603.511ON4961251162e-05
NCAS0E006703.511ON4972531152e-05
Kpol_278.23.511ON4981251153e-05
NDAI0B045502.102ON5651681127e-05
Ecym_32902.252ON3861281108e-05
SAKL0E08492g2.252ON3841261109e-05
ZYRO0A01672g2.252ON3861241091e-04
Kpol_1032.398.204ON4531901091e-04
SAKL0D11528g1.472ON3831521091e-04
KLLA0F03509g2.252ON3871701091e-04
NDAI0B037302.252ON3861231081e-04
Ecym_7228na 1ON4881561091e-04
NCAS0G040501.472ON3841641082e-04
NDAI0I028303.511ON5001321072e-04
TPHA0F012602.252ON3921261063e-04
Kwal_47.189823.511ON4961241073e-04
CAGL0G01254g3.511ON5041231063e-04
Suva_6.1361.321ON4441861063e-04
TDEL0D019001.321ON4431681054e-04
TDEL0A016008.204ON4752111054e-04
KAFR0D014203.511ON4921251045e-04
NDAI0G057601.321ON4481831037e-04
Kwal_14.25741.321ON443681038e-04
KLTH0G02002g3.511ON4961241020.001
Kwal_47.17462na 1ON4921281010.001
Smik_7.693.511ON5001251010.001
Skud_10.1561.321ON4601851010.001
Kpol_1035.231.321ON4441681000.001
AGR167Wna 1ON5121581010.001
ZYRO0G20636g1.321ON4533531000.002
Smik_9.532.252ON388127990.002
NCAS0A092001.321ON445139990.002
YJL060W (BNA3)1.321ON444186990.002
ZYRO0C06028g3.511ON496122980.003
YGL202W (ARO8)3.511ON500125980.003
Suva_9.782.252ON386124970.003
Ecym_6319singletonON354298970.003
KNAG0E018502.252ON384122970.003
CAGL0J05126g1.321ON433184960.005
NCAS0B064402.252ON385124960.005
ADL249W2.252ON387176960.005
KLLA0A04906gna 1ON480124950.006
KLTH0E07678gna 1ON492128950.007
KNAG0B053201.321ON433168950.007
KNAG0G005501.472ON387181940.007
YIL116W (HIS5)2.252ON385125940.008
Suva_7.613.511ON500132940.009
SAKL0H21824gna 1ON499125940.010
Smik_10.1801.321ON444168930.012
CAGL0C01243g2.252ON383124920.012
Skud_9.552.252ON385124920.014
Kpol_480.11.472ON380153910.017
Kpol_431.132.475ON443428910.018
TBLA0B009902.102ON54650910.018
KLTH0H10648g1.321ON44372910.020
SAKL0E12188g2.102ON53051910.021
AFR548C3.511ON497127900.024
KLTH0B00176g8.204ON448184900.024
Skud_7.693.511ON500122890.033
TDEL0D057903.511ON49760890.034
TBLA0B080808.204ON444179880.039
TPHA0O015202.102ON50355880.050
Ecym_62921.321ON430132870.050
ZYRO0G05346g2.102ON50450870.053
SAKL0D14630g7.14ON27065860.061
CAGL0G06028g2.102ON537169870.063
TDEL0C040902.252ON383124860.075
CAGL0I06578g8.204ON436177860.075
KAFR0J015802.252ON383124860.076
YHR137W (ARO9)2.102ON513445860.082
KLTH0G19624gsingletonON468185860.083
KLLA0F01617g1.321ON44462860.083
Smik_8.2182.102ON513356860.084
SAKL0D06886g1.321ON447137850.089
Smik_5.3198.204ON443181840.14
Kwal_33.145822.102ON52550820.22
TBLA0A103205.287ON62141820.22
Kwal_26.77682.475ON422143820.22
KAFR0A017101.321ON435184820.24
KAFR0B007905.329ON14148780.24
NCAS0B072202.102ON51050810.28
AEL170C1.321ON45872790.47
KLTH0B06270g2.102ON525132790.51
KLLA0E00969g8.204ON445181780.65
KNAG0H037302.102ON52379780.74
ZYRO0B11088g8.204ON45068770.85
Skud_8.1982.102ON517184770.98
TDEL0A025102.475ON426132751.5
TDEL0F009002.102ON49344742.0
Kwal_8.5858.204ON44644742.0
KNAG0G016808.204ON45234742.3
KLTH0D00836g7.14ON20856722.5
Kwal_26.67957.14ON20856722.6
Suva_5.2818.204ON45033732.9
Suva_15.3342.102ON560141714.9
NCAS0A038308.204ON446351706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR089C
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...  1229   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...  1186   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...  1167   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...  1134   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   831   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   825   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   823   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   805   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   799   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   784   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   784   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   780   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   758   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   739   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   713   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   713   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   707   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   699   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   698   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   694   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   687   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   686   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   686   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   682   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            677   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   669   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   665   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   656   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   653   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   646   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   643   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              631   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   622   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    57   5e-08
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    54   4e-07
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    54   8e-07
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    52   4e-06
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    51   4e-06
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    50   8e-06
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    50   1e-05
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    50   2e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    49   2e-05
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    49   2e-05
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     49   2e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    49   3e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    48   7e-05
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    47   8e-05
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    47   9e-05
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    47   1e-04
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    47   1e-04
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    47   1e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    47   1e-04
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    46   1e-04
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    47   1e-04
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    46   2e-04
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    46   2e-04
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    45   3e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    46   3e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    45   3e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    45   3e-04
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    45   4e-04
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    45   4e-04
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    45   5e-04
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    44   7e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    44   8e-04
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    44   0.001
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    44   0.001
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    44   0.001
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    44   0.001
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    43   0.001
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    44   0.001
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    43   0.002
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    43   0.002
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    43   0.002
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    43   0.002
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    42   0.003
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    42   0.003
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    42   0.003
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    42   0.003
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    42   0.003
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    42   0.005
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    42   0.005
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    42   0.005
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    41   0.006
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    41   0.007
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    41   0.007
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       41   0.007
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    41   0.008
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.009
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    41   0.010
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    40   0.012
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    40   0.012
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    40   0.014
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    40   0.017
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    40   0.018
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    40   0.018
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    40   0.020
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    40   0.021
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    39   0.024
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    39   0.024
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    39   0.033
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    39   0.034
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    39   0.039
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    39   0.050
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    38   0.050
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    38   0.053
SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highl...    38   0.061
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    38   0.063
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    38   0.075
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    38   0.075
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    38   0.076
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    38   0.082
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    38   0.083
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    38   0.083
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    38   0.084
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    37   0.089
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.14 
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    36   0.22 
TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON} Anc_5...    36   0.22 
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    36   0.22 
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    36   0.24 
KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.32...    35   0.24 
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    36   0.28 
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    35   0.47 
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    35   0.51 
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    35   0.65 
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    35   0.74 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    34   0.85 
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    34   0.98 
TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.4...    33   1.5  
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    33   2.0  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   2.0  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.3  
KLTH0D00836g Chr4 complement(79191..79817) [627 bp, 208 aa] {ON}...    32   2.5  
Kwal_26.6795 s26 complement(66701..67327) [627 bp, 208 aa] {ON} ...    32   2.6  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   2.9  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    32   4.9  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     32   6.3  

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score = 1229 bits (3180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/592 (100%), Positives = 592/592 (100%)

Query: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60
           MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV
Sbjct: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60

Query: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120
           LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV
Sbjct: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK
Sbjct: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480

Query: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540
           HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK
Sbjct: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/592 (95%), Positives = 582/592 (98%)

Query: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60
           M  LSAK HFTVSNSI+  IKSYHIRTLTS AEKMPHI+TPF+TSAS+T LKAFRK+RPV
Sbjct: 1   MSYLSAKTHFTVSNSISQAIKSYHIRTLTSRAEKMPHISTPFTTSASNTNLKAFRKIRPV 60

Query: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120
           LQRHSSSWI AQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTL+DVNENV
Sbjct: 61  LQRHSSSWIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKAKYAVRGAIPMRAEELKAQLEKDPQSLPF++IINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLNQNEQQLVDSKLFKLDAIKRAKSLME+IGGSVGAYSSSQGVEGIR+SVAEFITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITK 240

Query: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDE+SGWSTNPEEIETVVKEAI+NEIK TVLVVINPGNPTGAVLSPESIAQIFEVAAK
Sbjct: 301 YYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP+EGEESFESDQAERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSI 480

Query: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540
           HEKLITRAMTLY+TFNSLEGIECQKPQGAMYLFPKIDLPF+AVQEARHLELTPDEFYCKK
Sbjct: 481 HEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE+FHKEFFD YRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score = 1167 bits (3020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/592 (94%), Positives = 574/592 (96%)

Query: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60
           MLSLS KN  T SN IT +IKSYHIRTLT+S +KMP+I  PF T+AS+TKLKAFRKVRPV
Sbjct: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60

Query: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120
           LQRHSSSW+  Q+H RSLSGQSSLNDLRHLNRFPHHTLKT N++FYPAEQLTLEDVNENV
Sbjct: 61  LQRHSSSWVAGQSHSRSLSGQSSLNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFD+IINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RD+GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDE SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTKFHSMKKILR LQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE DQAERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480

Query: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540
           HEKLITRAMTLY+TFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCK 
Sbjct: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE+FHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/592 (92%), Positives = 578/592 (97%)

Query: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60
           MLSLSAKNHFTV+NSITH++KSYHI+TLT+SA+KMPHITT F+T+ASSTKLKAFR+VRPV
Sbjct: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHITTSFTTTASSTKLKAFRQVRPV 60

Query: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120
           LQRHSSSW+ AQ  +RS+SGQSSL DLRHLNRFPHHTLKT+NNEFYPAEQLTL+DVNENV
Sbjct: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKA+YAVRGAIPMRAEELKAQLEKDPQSLPF++IINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLN NEQ+LV SKLFK+DAIKRAKSL++DIGGSVGAYSSSQGVEGIRKSVA+FITK
Sbjct: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240

Query: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RD GE +YPEDIFLTAGASAAV YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ LP
Sbjct: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK
Sbjct: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGT+F+SMKK+LRHLQR+HPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQ+ERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480

Query: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540
           HEKL TRAMTLYETFNSLEGIECQKPQGAMYLFPKID+PFKA+QEA HLELTPDEFYCKK
Sbjct: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPG+EW+KKWE FHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/565 (70%), Positives = 464/565 (82%), Gaps = 24/565 (4%)

Query: 28  LTSSAEKMPHITTPFSTSASSTKLKAFRKVRPVLQRHSSSWIVAQNHRRSLSGQSSLNDL 87
           L S A  MPH  T                    LQ  S       N +R+ S  S+   L
Sbjct: 19  LISRASAMPHTITT------------------TLQGRSGLGRSYMNIKRARSTSSTAAGL 60

Query: 88  RHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQ 147
            H+    +H  K  + +FYPAE LT+ D+NENVLKAKYAVRG+IPMRAEEL+ QL++DP 
Sbjct: 61  HHI----YH--KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPS 114

Query: 148 SLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRA 207
           SLPFD+I+NANIGNPQQL QKPL++YRQVLS+LQYPE+L Q E++L+   +FK DAI+RA
Sbjct: 115 SLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERA 174

Query: 208 KSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLS 267
           K ++ D+GGSVGAYSSSQGV GIRK+VA+FIT+RD GE +YPEDIFLTAGASAAV+YLLS
Sbjct: 175 KRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLS 234

Query: 268 IFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNE 327
           I CRG ETGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTN  EIE VV E+I++ 
Sbjct: 235 ILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESG 294

Query: 328 IKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKI 387
           I+P+VLVVINPGNPTG+VLS E+I +IF+VAAKYG VVIADEVYQENIF G++FHSMKK+
Sbjct: 295 IRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKV 354

Query: 388 LRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLC 447
           LR LQ+EHPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+RQV+LKLASISLC
Sbjct: 355 LRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLC 414

Query: 448 PVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQ 507
           PVVTGQALVDLMV PP  G+ES+E D+ ER  IHE+L  RA  L++TFNSLEGIECQKP+
Sbjct: 415 PVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPR 474

Query: 508 GAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTT 567
           GAMYLFP+I LP+KA+Q A+HLE TPDEFYC+KLLE+TGICTVPGSGFGQEPGTYHLRTT
Sbjct: 475 GAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTT 534

Query: 568 FLAPGLEWIKKWESFHKEFFDQYRD 592
           FLAPG EWIKKWE FHK+F+DQYRD
Sbjct: 535 FLAPGTEWIKKWEDFHKKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/492 (78%), Positives = 441/492 (89%)

Query: 101 SNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIG 160
           ++N F PA+QLTL ++N+NVLKAKYAVRGAIPMRAEELK QL++DP SLPFD I+NANIG
Sbjct: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136

Query: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGA 220
           NPQQL QKPL++YRQVLSLLQYPE+L Q+E +LV S LFK DA++RAK+L+ +IGG+VGA
Sbjct: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           YS+SQGV GIRK+VA FITKRD GE +YPEDIFLTAGASAAV YLLSI C+GPETGVLIP
Sbjct: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256

Query: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
           IPQYPLYTA+LALNNS ALPYYLDE SGWSTNP+EIE VV  A   +I+P+VLVVINPGN
Sbjct: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFD 400
           PTGAVLS +SI  IFE+AAKYG VVIADEVYQEN+F   KFHSMKK+LR+LQ++HPG +D
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460
            VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 461 RPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPF 520
            PP +G+ESFE DQAER  I  +L TRAM LY+ FN+LEGIECQKPQGAMYLFP++DLPF
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 521 KAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE 580
           KAVQ+A+HLE++PDEFYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI+KW+
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 581 SFHKEFFDQYRD 592
            FH++F++ YRD
Sbjct: 557 IFHQDFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/499 (76%), Positives = 437/499 (87%), Gaps = 1/499 (0%)

Query: 95  HHTLKTSNN-EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDR 153
           HH+LK +   +F PAEQLTL D+NENVLKAKYAVRG+IPMRAEELK QLE +P +LPF +
Sbjct: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149

Query: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L +NEQ L+D+K++K DAI RAK L+ +
Sbjct: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209

Query: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273
           IGGSVGAYS+SQGV GIRK+VA FIT+RD GE +YPEDIFLT        YLLSI C+GP
Sbjct: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269

Query: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVL 333
           +TGVLIPIPQYPLYTATLALNNS ALPYYLDE SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329

Query: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQR 393
           VVINPGNPTGAVL+ ESI  IFE+AAKYG VVIADEVYQENI  G KF+SMKK+LR LQ+
Sbjct: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389

Query: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449

Query: 454 ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLF 513
           ALVDLMV PP +G+ S+E DQAER  I  +L  RA  LYETF  LEGIECQKPQGAMYLF
Sbjct: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509

Query: 514 PKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573
           PK+DLPFKAVQEA+HLE+TPDEFYCK LL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569

Query: 574 EWIKKWESFHKEFFDQYRD 592
           EWIKKWE+FHKEF+D YRD
Sbjct: 570 EWIKKWEAFHKEFYDNYRD 588

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/494 (76%), Positives = 439/494 (88%), Gaps = 2/494 (0%)

Query: 101 SNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIG 160
           S+ +F PA Q+ + D+NENVLKAKYAVRG+IPMRAE+L+ QL++DP+SLPFD+IINANIG
Sbjct: 98  SHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIG 157

Query: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           NPQQL QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L+EDIGGSVG
Sbjct: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS+SQGV GIRK+VA+FIT+RD  E +YPEDIFLTAGASAAV+YLLSIFC+G +TGVLI
Sbjct: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTATLALNNS  LPYYLDE SGWSTN +EI++VV +AI   IKP+VLVVINPG
Sbjct: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQREHPGK 398
           NPTGAVLS ++IA+IFE+AAKYG VVIADEVYQENIF    KFHSMKK+LR LQ+EHPGK
Sbjct: 338 NPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGK 397

Query: 399 FDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDL 458
           FD VQLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDL
Sbjct: 398 FDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDL 457

Query: 459 MVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDL 518
           MV PP EGEES+E DQAER+ IH +L  RA  L+ETFN LEGI+CQKPQGAMYLFP+++L
Sbjct: 458 MVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNL 517

Query: 519 PFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKK 578
           PFKAVQ+A+H+E+T DEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EWI  
Sbjct: 518 PFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDL 577

Query: 579 WESFHKEFFDQYRD 592
           WE FHKEF+++YRD
Sbjct: 578 WEKFHKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/528 (72%), Positives = 443/528 (83%), Gaps = 5/528 (0%)

Query: 65  SSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAK 124
           SS   + Q  +R  S Q+  + L H+    H  +       YPAE+L L +VNENVLKAK
Sbjct: 12  SSRRTLLQVAQRYKSAQTEAH-LHHI----HSKVSNVLGAVYPAEKLGLSEVNENVLKAK 66

Query: 125 YAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPE 184
           YAVRGAIPM A EL A+L+KDP SLPFD I++ANIGNPQ L+QKPLT+YRQVLSLLQYP 
Sbjct: 67  YAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPG 126

Query: 185 LLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEG 244
           LL +NEQ L+DSKL++ DAI RA+ L+ DIG SVGAYS+SQG++GIR++VA+FIT+RD G
Sbjct: 127 LLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGG 186

Query: 245 EISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLD 304
           E +Y EDIFLTAGAS+AV+YLLSI C+G ETGVLIPIPQYPLYTA+LALNNS  LPYYLD
Sbjct: 187 EKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLD 246

Query: 305 ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTV 364
           E SGWSTNP EIE VV  AI+  IKP+VLVVINPGNPTGAVLS E I+QIF +AAKYG V
Sbjct: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIV 306

Query: 365 VIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGY 424
           VIADEVYQEN+F G +FHSMKKILR LQ+ +PG FDNVQLASLHSTSKGVSGECGQRGGY
Sbjct: 307 VIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGY 366

Query: 425 MELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKL 484
           ME+TGF++++RQVILKLASISLCPVVTGQALVDLMV PP  G+ES+E DQ ER SIHE L
Sbjct: 367 MEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEAL 426

Query: 485 ITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLES 544
             RA  L+ TFNSLEGIECQKP+GAMYLFP++ LPFKA+Q A H  +TPD FYCKKLLE+
Sbjct: 427 AERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEA 486

Query: 545 TGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI++WE+FHK F+++YRD
Sbjct: 487 TGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD 534

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/507 (73%), Positives = 433/507 (85%), Gaps = 8/507 (1%)

Query: 93  FPHHTL---KTSNN----EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKD 145
            PH TL     S+N    +F PA++L+LED+NENVL+AKYAVRG IP +AEELK QL +D
Sbjct: 26  MPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD 85

Query: 146 PQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIK 205
           P+SLPFDRIINANIGNPQQL QKPLT+YRQVLSLLQ P++L +  ++ + S+++K DAI 
Sbjct: 86  PKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAID 144

Query: 206 RAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYL 265
           RA  L+ +IGGSVGAYS SQGV G RK+VA+FITKRD GE +Y EDIFLTAGASAAV+Y+
Sbjct: 145 RAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYI 204

Query: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQ 325
           LSI CRGP+TGVLIPIPQYPLYTA+LALNNS ALPYYLDE S WSTNPEEIE VV  +I 
Sbjct: 205 LSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIA 264

Query: 326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMK 385
             ++P  LVVINPGNPTGA+LSPESI +IFEVAAKYG VVIADEVYQEN+F G +FHSM+
Sbjct: 265 KGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMR 324

Query: 386 KILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445
           K+L+ LQR+H GKFDN+QLASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASIS
Sbjct: 325 KVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASIS 384

Query: 446 LCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQK 505
           LCPVVTGQALVDLMV PP  G+ S+E DQ ER+ IH+ L  RA  LYETFN LEGIECQK
Sbjct: 385 LCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQK 444

Query: 506 PQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565
           PQGAMYLFP++DL +KAVQ+A HL L+PDEFYC++LLE+TGICTVPGSGFGQ PGTYHLR
Sbjct: 445 PQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLR 504

Query: 566 TTFLAPGLEWIKKWESFHKEFFDQYRD 592
           TTFLAPG +WIK WE FHK+F+++YRD
Sbjct: 505 TTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/486 (74%), Positives = 427/486 (87%), Gaps = 2/486 (0%)

Query: 107 PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQ 166
           PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF +II+ANIGNPQQL 
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 167 QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226
           QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 227 VEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286
           V+GIR++VA+FITKRD+GEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 287 YTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346
           YTA+LALNNS+ LPYYL E   WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 347 SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLAS 406
           S +SI +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR+LQ+ + G++DN+QLAS
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 467 EESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 526
           +ES+E DQ ER  IH+ L  RA  L+ETF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 527 RHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEF 586
           +HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 587 FDQYRD 592
           FD+YRD
Sbjct: 523 FDKYRD 528

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/579 (67%), Positives = 459/579 (79%), Gaps = 17/579 (2%)

Query: 25  IRTLTS-SAEKMPHITTP-----FSTSASSTK--LKAFRKVRPVLQRHSSSWIVAQNHRR 76
           +R+ TS S  KMPH   P      S+S   TK  L      RP L     S   + N R 
Sbjct: 2   LRSTTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLRF 61

Query: 77  SLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAE 136
             S  SS      LN   HH    +N  F PAEQ TL+DVNE VL AKYAVRGAIPMRAE
Sbjct: 62  HSSASSSSLRSSFLNTEIHHH-SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAE 120

Query: 137 ELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNQNEQQL 193
           ELK QL ++P SLPF+ IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L  N Q +
Sbjct: 121 ELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM 180

Query: 194 VDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIF 253
           +     K DAI RAK L++DIGGSVGAYSSSQGV GIRK+VA+FIT RD+G I+YPEDIF
Sbjct: 181 I-----KQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIF 235

Query: 254 LTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNP 313
           LTAGAS+AV+YLLSIFCRG ETGVLIPIPQYPLYTATLAL NS ALPYYL+E +GWST+P
Sbjct: 236 LTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDP 295

Query: 314 EEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQE 373
           EE+E+++ ++I+N IKP+VLVVINPGNPTGAVLS E+I QIF +AAKYG +VIADEVYQE
Sbjct: 296 EELESIILDSIENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQE 355

Query: 374 NIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHE 433
           N+F   KFHSMKK+LR LQ + PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H+
Sbjct: 356 NVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHD 415

Query: 434 MRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYE 493
           +RQV+LKLASISLCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L  RA  L++
Sbjct: 416 IRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHD 475

Query: 494 TFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGS 553
            F  L+GI CQKPQGAMYLFPK++LP+KA+QEA H +++PDEFYCK LLE TGICTVPGS
Sbjct: 476 AFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGS 535

Query: 554 GFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           GFGQEPGTYHLRTTFLAPG +WI+ W  FH+EF++++++
Sbjct: 536 GFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/489 (75%), Positives = 421/489 (86%)

Query: 102 NNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGN 161
           N  F PA QLT+ D+NENVLKAKYAVRG IP RAEELK QL + P SLPFD+IINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK +++DIGGSVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 222 SSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S SQGV GIR++VA FIT+RD GE +YPEDIFLTAGASAAVNYLLSI C+G +TGVLIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATLALNNS ALPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401
           TGAVLS E+I  I E+AAKYG VVIADEVYQENIF G KFHS+K +LR LQRE PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  GEESF  DQA+R +IH +L  RA  L++TFNSL+GIECQKP GAMYLFPK++LP++
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581
           A+QEA+ LEL+PDEFYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EWI  W+ 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 582 FHKEFFDQY 590
           FH EF ++Y
Sbjct: 529 FHIEFMEKY 537

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/496 (69%), Positives = 418/496 (84%), Gaps = 8/496 (1%)

Query: 97  TLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIIN 156
           TL    +  YPA++L ++D+N+NVLKAKYAVRG+IP+RAEELK  LE   Q LPFD +IN
Sbjct: 25  TLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVIN 83

Query: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 216
           ANIGNPQQL+QKPLT+YRQVLS+LQYPELL         S +FK DAI+RA+ L+++IG 
Sbjct: 84  ANIGNPQQLKQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG- 136

Query: 217 SVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           SVG+YSSSQG+  IRK+VA FITKRD+GEIS P DIFLTAGAS+AV+YLLSI C+  ++G
Sbjct: 137 SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196

Query: 277 VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336
           VLIPIPQYPLYTATLALNN+ ALPYYLDE+ GWST+  EIE V+ +++   IKPT LV+I
Sbjct: 197 VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256

Query: 337 NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHP 396
           NPGNPTG++LS ES+ +I EVAA +G V+IADEVYQEN+F   KFHSMKK+LR+LQ+  P
Sbjct: 257 NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP 316

Query: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456
           G++D VQLASLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALV
Sbjct: 317 GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALV 376

Query: 457 DLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKI 516
           DLMV PP +G+ES+E DQ ER++I   L  RA+ L+E FNS+EG+ CQKP+GAMYLFPKI
Sbjct: 377 DLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKI 436

Query: 517 DLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576
           DLPFK +Q+++ L++TPDEFYCK LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EWI
Sbjct: 437 DLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWI 496

Query: 577 KKWESFHKEFFDQYRD 592
            +W  FH EF+D+YRD
Sbjct: 497 DRWNKFHAEFYDKYRD 512

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 407/495 (82%), Gaps = 1/495 (0%)

Query: 98  LKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINA 157
           L   NN+F PA +L+L+D+NENV+ AK+A+RG+I ++AE+L+ QL K+P  LPFD I  A
Sbjct: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63

Query: 158 NIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGS 217
           NIGNPQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L+ DIGGS
Sbjct: 64  NIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGS 122

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277
           VGAYS+SQGV GIRK+ AE+ITKRD GE SYPEDIFLT GA++A +YLLS+ CRGP+TGV
Sbjct: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGV 182

Query: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           LIPIPQYPLYTATLALN S  +PYYLDE S WSTN  EIE +V ++I+  IKP+V+VVIN
Sbjct: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVIN 242

Query: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397
           PGNPTGAVLS  +IA+IF++AAKYG VV+ADEVYQENIF G +FHS KK+LR LQ+++PG
Sbjct: 243 PGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPG 302

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           KFDN+QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VD
Sbjct: 303 KFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVD 362

Query: 458 LMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517
           LM+ PP +G+ S+E D+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + 
Sbjct: 363 LMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLI 422

Query: 518 LPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577
           L  KA+ +A  L LTPDEFYC +LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EWI 
Sbjct: 423 LSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWIN 482

Query: 578 KWESFHKEFFDQYRD 592
           KWE FHK F+++Y+D
Sbjct: 483 KWEKFHKHFYEKYQD 497

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/496 (69%), Positives = 416/496 (83%), Gaps = 1/496 (0%)

Query: 97  TLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIIN 156
           T+   +  F PA++LT+ D+NENVLKAKYAVRG IP RAE LK QL  +P SLPF ++IN
Sbjct: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87

Query: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 216
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L++       + L+K DAI+RAK ++ DIG 
Sbjct: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIGS 146

Query: 217 SVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           SVG+YSSSQGV G+RK+VAE+I++RD GE +Y EDIFLTAGAS+AV+YLL+I C+G E+G
Sbjct: 147 SVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESG 206

Query: 277 VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336
           VLIPIPQYPLYTATLALNN+ ALPYYL+ENSGWSTN EEIE VV  AI+ +I P VLVVI
Sbjct: 207 VLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVI 266

Query: 337 NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHP 396
           NPGNPTGA+LS ESI +IF+VAA +G VVIADEVYQENIFPG +FHSMKK+LR LQR  P
Sbjct: 267 NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP 326

Query: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456
           GK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQALV
Sbjct: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386

Query: 457 DLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKI 516
           DLM  PP +GE S+E DQ ER++IH +L  RA  L++ FN +EG+ CQKPQG+MYLFPKI
Sbjct: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446

Query: 517 DLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576
           D+P KA+++A+ L++TPDE YC +LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  WI
Sbjct: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506

Query: 577 KKWESFHKEFFDQYRD 592
            +W  FH+ F ++YRD
Sbjct: 507 DQWREFHQIFCNKYRD 522

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/526 (64%), Positives = 409/526 (77%), Gaps = 17/526 (3%)

Query: 68  WIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAV 127
           W  + + +R  +G  S                 S   F PA +L  +D+N+N++ A+YAV
Sbjct: 12  WTTSSSKKRQHTGDDS---------------TVSGLAFEPARKLGADDLNKNIIDAEYAV 56

Query: 128 RGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLN 187
           RGAIPM+AEEL+ QL + P  LPF+ I  ANIGNPQQL QKPLT+ RQV+S+LQYP LL+
Sbjct: 57  RGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLD 116

Query: 188 QNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEIS 247
             E+QLV S  +K DA KRA  L+E IGGSVGAYS +QGV GIR+SVA+FIT+RDEGE +
Sbjct: 117 Y-EEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETA 175

Query: 248 YPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENS 307
            P+DIFLT GAS A  YLLSI CR   TG++IPIPQYPLYTA++ + NS  LPYYLDE S
Sbjct: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEES 235

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
           GWST  EEIE  V ++I+  + P V+VVINPGNPTGAVLS ++IAQI  +AAKYG VV+A
Sbjct: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295

Query: 368 DEVYQENIFPGTKFHSMKKILRHLQREHP-GKFDNVQLASLHSTSKGVSGECGQRGGYME 426
           DEVYQ NI+ G KFHSMKK+LR LQR+HP G++DNVQLAS+HSTSKGVSGECGQRGGYME
Sbjct: 296 DEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYME 355

Query: 427 LTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLIT 486
           L GFS+E+RQVILKLASIS+C VVTGQALVDLM+ PP EG++S+E D  ER  IH  + T
Sbjct: 356 LVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKT 415

Query: 487 RAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTG 546
           R   LY+TF  LEGIECQ+PQGAMYLFPK+ L  KA++EA+ L L PDEFYC +LL++TG
Sbjct: 416 RGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTG 475

Query: 547 ICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           ICTVPGSGFGQ+ GTYH+RTTFLAPG +WIK WE+FHK F+D+YRD
Sbjct: 476 ICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/493 (65%), Positives = 401/493 (81%)

Query: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANI 159
           T +  F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L++ P  LPFD IINANI
Sbjct: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L+EDIGGS+G
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS SQGV GIR+SVAEFITKRD+GE + PE+I+LT GAS+A   LLS+ C+  +TG+LI
Sbjct: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLI 194

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPG
Sbjct: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399
           NPTGAVLS ++IA+I  +AAKYG  +I+DEVYQEN+F G KFHSMKK+LR LQR +PGKF
Sbjct: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374

Query: 460 VRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP 519
           V+PP  G+ES++ D +ER  I  ++ TRA  L+ETFN LEGIECQKPQGAMYLFP++ LP
Sbjct: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434

Query: 520 FKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579
            KA++E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W
Sbjct: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494

Query: 580 ESFHKEFFDQYRD 592
           + FH++FF++YRD
Sbjct: 495 KHFHQDFFNKYRD 507

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/481 (69%), Positives = 396/481 (82%), Gaps = 2/481 (0%)

Query: 112 TLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLT 171
           TL DVN+ VL AKYAVRG IP+RAEEL+ +L ++P SLPF++IINANIGNPQQL QKPLT
Sbjct: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100

Query: 172 YYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIR 231
           +YRQVLSLLQ P L+       +  KLFK DA++RAK +++ +GGSVGAYS+SQGV G R
Sbjct: 101 FYRQVLSLLQNPALIESLPTGEL-HKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159

Query: 232 KSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATL 291
           +SVAEFI +RD GE +   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTATL
Sbjct: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218

Query: 292 ALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESI 351
           ALN++ ALPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE+I
Sbjct: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278

Query: 352 AQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTS 411
            +I  VAAKY  VVIADEVYQEN F    F SMKK+LR LQ+  PGK+DNVQLASLHSTS
Sbjct: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338

Query: 412 KGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE 471
           KGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S+E
Sbjct: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398

Query: 472 SDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLEL 531
            D+ ERN+IH  L  ++  LYETF SLEG+ CQKPQGAMYLFPK+DL  KA+++A  L +
Sbjct: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458

Query: 532 TPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYR 591
            PDE+YCK+LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D++R
Sbjct: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518

Query: 592 D 592
           D
Sbjct: 519 D 519

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 411/492 (83%), Gaps = 2/492 (0%)

Query: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANI 159
           TS  + Y AE+L  ED+N NV+KAKYAVRGAIP  A++LK QL K P +LPF+ +IN+NI
Sbjct: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           GNPQQL QKPL++ RQVLS+L+YP LL+ +E+ LVDS  +  D+I+RAK+L+ DIG S+G
Sbjct: 133 GNPQQLGQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS+SQGV GIR++VA+FIT RD+GE++YP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTATL LN++ ALPYYLDE++GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 251 PIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399
           NPTG+VL+ E+I  +F+VAAKYG VVIADEVYQ+NIFPG++FHSMKKILR LQ+E P K+
Sbjct: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430

Query: 460 VRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP 519
             PP +GE S+E DQ ER +I      R+  LYE FNSLEG+ CQKPQGAMY+FP I LP
Sbjct: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490

Query: 520 FKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579
           F A++ A++L++TPDEFYC++LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPG+EW+K+W
Sbjct: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550

Query: 580 ESFHKEFFDQYR 591
           E FH EFF++YR
Sbjct: 551 EKFHIEFFEKYR 562

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 396/489 (80%)

Query: 104 EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQ 163
           +F PA ++T +D+N +V KA+YAVRG+IP RA+ELK +L+K+P  LPFD IINANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L++DIGGSVGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 224 SQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIR++VA+FIT RD GE + PEDI+LT GAS+A   LLS+ C+   TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 284 YPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+ +L N+Q LPYYLDE   WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQ 403
           AVL+ E+IA+I  +AAKYG  VI+DEVYQEN+F   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 464 VEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523
             G+ES+E D+ ER+ I  ++ TRA  LYETFN LEGIECQ PQGAMYLFP++ LP KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 524 QEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFH 583
           +E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W++FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 584 KEFFDQYRD 592
           + FF++YRD
Sbjct: 499 QSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 394/489 (80%)

Query: 104 EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQ 163
           +F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L+K+P+ LPFD IINANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223
           QL QKPLT+ RQVL++L+YPE+L     +L    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 224 SQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIR++VA+FIT+RD GE + PEDI+LT GAS+A   LLS+ C+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 284 YPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+ +L N+Q LPYYLDE S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQ 403
           AVLS E+IA+I  +AAKYG  +I+DEVYQENIF   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 464 VEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523
             G+ES+E D  ER  I  ++ TRA  LYETF  LEGIECQKPQGAMYLFP++ LP KA+
Sbjct: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 524 QEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFH 583
            E+  L + PDEFYC  LLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 584 KEFFDQYRD 592
           ++FF +YR+
Sbjct: 499 QDFFSKYRN 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/506 (65%), Positives = 406/506 (80%), Gaps = 4/506 (0%)

Query: 87  LRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDP 146
           LRHL+  P   L+   ++     + TL+D+NE VL AKYAVRG IP+RAEELK +L ++P
Sbjct: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74

Query: 147 QSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 206
            SLPFD+IINANIGNPQQL QKPLT+YRQVL+LLQ P+L++      +  K FK DA++R
Sbjct: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVER 133

Query: 207 AKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLL 266
           AK +++ +GGSVGAYS+SQGV G R+SVAEFI +RD GE +  +DIFLT GAS AV+Y+L
Sbjct: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192

Query: 267 SIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQN 326
           S+FC GPE G LIPIPQYPLYTA+LALNNS ALPYYLDE SGWS + E+IE VV+++I+ 
Sbjct: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252

Query: 327 EIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386
            I+PT LVVINPGNPTGA+L+ ++I  + +VAAKY  V+IADEVYQEN F   +F SMKK
Sbjct: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312

Query: 387 ILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISL 446
           +LR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASISL
Sbjct: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372

Query: 447 CPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKP 506
           CPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L  R+  LY+ F S+EG+ CQ+P
Sbjct: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432

Query: 507 QGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRT 566
           QGAMYLFPK++L  KA+ +A    L PDE+YCK+LLE+TGICTVPGSGFGQ PGT+HLRT
Sbjct: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492

Query: 567 TFLAPGLEWIKKWESFHKEFFDQYRD 592
           TFLAPG EWI  W+ FH++F + +RD
Sbjct: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/493 (64%), Positives = 395/493 (80%)

Query: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANI 159
           T + +F PA +LT +D+N +V KA+YAVRGAIP RAEELK +L++   SLPF+ IINANI
Sbjct: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L++DIGGSVG
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS SQGV GIR++VA+FIT+RD GE + PEDI+LT GAS+A   LLS+ C+  +TG+L+
Sbjct: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLL 194

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTA+ +L N+Q LPYYLDE + WST  +EIE VV +A++  I+P+VLVVINPG
Sbjct: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399
           NPTGAVL+  +IA+I  +AAKYG  +I+DEVYQENIF   KFHSMKKILR LQ  HPGKF
Sbjct: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374

Query: 460 VRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP 519
           V+PP  G+ES++ D+ ER  I+ +++TRA  LYETFN LEGI+CQKPQGAMYLFPK+ LP
Sbjct: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434

Query: 520 FKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579
            KA++E+  L + PD  YC  LLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +WI+ W
Sbjct: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494

Query: 580 ESFHKEFFDQYRD 592
             FH++FF++YRD
Sbjct: 495 RQFHQDFFNKYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/489 (65%), Positives = 395/489 (80%), Gaps = 4/489 (0%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDRIINANIGNP 162
           F PA+++TL+D+N+NVLK++YAVRG+IP RAEEL+ +L       SL F+ I++ANIGNP
Sbjct: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87

Query: 163 QQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 222
           QQL QKPLT+ RQV+S+LQYPELLNQ    LV + +FK DA++RA++L+  IGGSVGAYS
Sbjct: 88  QQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146

Query: 223 SSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIP 282
           SSQGV GIR++VA +IT RD GE + P+DIFLT GAS A +YLLS+ C+   TGVLIPIP
Sbjct: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIP 206

Query: 283 QYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPT 342
           QYPLYTAT+ L +++ LPYYL+E SGWSTN  EIE VV +AI + +KP+V+VVINPGNPT
Sbjct: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266

Query: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNV 402
           G+VLS + I  I  + AKYG V+IADEVYQENIF G +FHSMKK+LR LQ+++PGK+D V
Sbjct: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325

Query: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462
           QLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV P
Sbjct: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385

Query: 463 PVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKA 522
           P +G+ES+E D  ER +IHE L  RA  LY  F  L+G+ECQKPQGAMYLFPK+  P   
Sbjct: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445

Query: 523 VQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESF 582
           + EA +  ++PDEFYC  LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+ F
Sbjct: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505

Query: 583 HKEFFDQYR 591
           H+EFF +Y+
Sbjct: 506 HEEFFSKYQ 514

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/489 (62%), Positives = 396/489 (80%), Gaps = 3/489 (0%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQ 164
           F PAE+L++ D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPFD+II ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 222
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ +++ IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 223 SSQGVEGIRKSVAEFITKRDEG-EISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           +SQGV G R++VA+FI KRD   +++ P DIFLT GAS+AV+YLLSI C GPE GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATL L+NS A+PYYL E++ WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401
           TGA+LS   +A I  ++AKYG  +IADEVYQENIFPG +FHSM+K+L +LQ E PG +DN
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  G+ S++ DQ ERN I + L+ RA  LY  F SLEG+ECQ+PQGAMYLFPK+ LP K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581
           A+++A  LE+ PDE+YC++LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EWI++W  
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 582 FHKEFFDQY 590
           FH++F++++
Sbjct: 483 FHQQFYERF 491

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 397/497 (79%), Gaps = 2/497 (0%)

Query: 96  HTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRII 155
           HT++T  ++F PA +L+++D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF+ I 
Sbjct: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63

Query: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDI 214
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN+ NE       ++  D+  RA+ L+ +I
Sbjct: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123

Query: 215 GGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           GGSVGAYS+SQGV GIRK++A +IT+RD GE + P DIF+T GA+AA +YLLSI   GP+
Sbjct: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183

Query: 275 TGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIE-TVVKEAIQNEIKPTVL 333
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E SGWS +  EIE T+ K A+   I+P V+
Sbjct: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243

Query: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQR 393
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G KFHS KK+LR LQ+
Sbjct: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303

Query: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
           + P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363

Query: 454 ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLF 513
           A++DLM+ PP +G++S++ D  ER  IH  ++ RA  LY+ F+ +EGI+CQKPQGAMYLF
Sbjct: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423

Query: 514 PKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573
           P++ L  K + EA+  E+ PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483

Query: 574 EWIKKWESFHKEFFDQY 590
           +WI KWE FHK F  +Y
Sbjct: 484 QWINKWEKFHKAFLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/494 (62%), Positives = 395/494 (79%), Gaps = 4/494 (0%)

Query: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDRIINA 157
           ++ ++F PA ++++ D+N+ ++ A+YAVRG+I MRAEEL+ +L  +  P S PF+RII A
Sbjct: 19  SNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYA 78

Query: 158 NIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGS 217
           NIGNPQQL QKPLT+ RQV+S+L+YP LL + +  L+   ++K DA++RA+ L   IG S
Sbjct: 79  NIGNPQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGAS 137

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277
           VGAYS +QGV GIR++ A FI+KRD  E +  +DIFLT GAS AV YL+   C+   TG+
Sbjct: 138 VGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGI 197

Query: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           LIPIPQYPLYTA++ ++N++ LPYYLDE SGWST  EEIE  V  AI+N IKP+ +VVIN
Sbjct: 198 LIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVIN 257

Query: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397
           PGNPTGAVLS + I +I  VAAKYG V+IADEVYQ+NIF G +FHSMKKILR LQ+++PG
Sbjct: 258 PGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPG 316

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           K+DNVQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVD
Sbjct: 317 KYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVD 376

Query: 458 LMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517
           LMV PP  G+ES+E DQ ERN IH  L  RA  LY+TF++LEGIECQKPQGAMYLFP++ 
Sbjct: 377 LMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLI 436

Query: 518 LPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577
           LP +A++EA+ L++  DEFYC KLLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWI 
Sbjct: 437 LPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWID 496

Query: 578 KWESFHKEFFDQYR 591
            W+ FH++F  +Y+
Sbjct: 497 DWKKFHEKFMKEYQ 510

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/521 (60%), Positives = 394/521 (75%), Gaps = 12/521 (2%)

Query: 79  SGQSSLNDLRHLNRFPHHTLK-------TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAI 131
           SG  +  D+ H    PH T+        TS   F P + L LED+N NVL+AKYAVRG I
Sbjct: 19  SGLQATMDVLH--GLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKI 76

Query: 132 PMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQ 191
           P RA EL+ QL +DP SLPF +II ANIGNPQQL QKPL++ R+VLSLL+ P LL    +
Sbjct: 77  PARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME 136

Query: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPED 251
            L  + ++K DA++RAK +M D+  S+GAYS SQGV G RK+VAE+++ RD GE +  ED
Sbjct: 137 VL--NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAED 193

Query: 252 IFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWST 311
           IFLT GAS   + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE SGWS 
Sbjct: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           N +++E ++ E+I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVY
Sbjct: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313

Query: 372 QENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431
           QEN+F G KF+SMKK+LR LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS
Sbjct: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373

Query: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTL 491
            ++R+VILK+ASI LC  V GQALVDLM+  P  G+ES+E D +ER+SI   L  R+ +L
Sbjct: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433

Query: 492 YETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVP 551
           +ETFN+LEG+EC+KPQG+MYLFP++ LP KA++ A  L++ PDEFYC +LL STGICTVP
Sbjct: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493

Query: 552 GSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592
           GSGFGQ P T HLRTTFL PG EWI+ WE FHK F+D+YRD
Sbjct: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/490 (60%), Positives = 387/490 (78%), Gaps = 2/490 (0%)

Query: 104 EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQ 163
           +F P  ++TL+D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPF++IINANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           QL QKPL++ R+VLS+LQYP++L      Q L++ ++++ D ++RA+ L+ +IGGSVGAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 222 SSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S SQGV GI+++VA++ITKRD GE++YPEDIFLT GAS+AV+++L +FC GP TGVLIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTAT+ L  + A+ YYL+E   WS N  E+E  ++E+I++ IKPT +V+INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401
           TG++L+ + IA I  ++AKYG ++IADEVYQEN+F G +FHS+KK+LR LQR++ G ++ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V 
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  G+ES+E DQ ERN+I   LI+R+  L++ F SLEG+EC +PQGAMYLFPK   P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581
            +  A+ L    D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 582 FHKEFFDQYR 591
           FH EF ++YR
Sbjct: 488 FHTEFCERYR 497

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/491 (62%), Positives = 389/491 (79%), Gaps = 3/491 (0%)

Query: 102 NNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGN 161
            + F PAE +TL DVNENV+KAKYAVRG IP RAEEL+ +LE+ P SLPF +II ANIGN
Sbjct: 34  GSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGN 93

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQQL QKPLT+YRQV+SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAY
Sbjct: 94  PQQLGQKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAY 151

Query: 222 SSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S+SQGV+G R++VA+FI +RD G  + P++++LTAGAS+AV+ LLS FC+GPETGVLIPI
Sbjct: 152 SASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210

Query: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTAT+  NN+ ALPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNP
Sbjct: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401
           TG+VLS + +  I  +AAKYG VVIADEVYQ+N+F   KFHSM+K+L++LQ   P  + N
Sbjct: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHS SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV 
Sbjct: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390

Query: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP +G+ S+E    E  SI+ +L  R+  L++TF SLEGIEC  PQGA+YLFPK+ LP K
Sbjct: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450

Query: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581
           A++ A+ L +  DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +WI+ W+ 
Sbjct: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510

Query: 582 FHKEFFDQYRD 592
           FHK+F+D+YRD
Sbjct: 511 FHKKFYDKYRD 521

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/494 (60%), Positives = 381/494 (77%), Gaps = 10/494 (2%)

Query: 107 PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQ 166
           PA + +L D+++++L  +YA+RG IP RA+EL+ QL   P  LPF +II ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 167 QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226
           Q+PLT+ RQVLSL++YP L+N ++  LV++K++  DAIKRA++++  IGGSVGAYSSSQG
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQG 126

Query: 227 VEGIRKSVAEFITKRDEGEISYPE---------DIFLTAGASAAVNYLLSIFCRGPETGV 277
           +  IRK+VA+ I +RD  E+   +         +IFLT GA+ AV+Y+L +F +    GV
Sbjct: 127 ILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGV 186

Query: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           L+PIPQYPLYTA + L NS+ LPYYL+E+  WST+PEEIET++K+AI   IKPT LV+IN
Sbjct: 187 LLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIIN 246

Query: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397
           PGNPTGA+LS ESI QI  +AAKYG V+IADEVYQ NI+   KFHS KKIL  L+ ++P 
Sbjct: 247 PGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPK 306

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           K+DNVQLASLHS SKGV+GECGQRGGY EL GFS E++++ILKLASI +C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVD 366

Query: 458 LMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517
           LM +PP +G+ S++ DQ ERN+I   LI ++ TLY+ F+ L GI CQKPQGAMYLFP++ 
Sbjct: 367 LMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLH 426

Query: 518 LPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577
           L    + EA+   L PDEFYC KLLE+TGICTVPGSGFGQ+ GTYH+RTTFL  G+EWIK
Sbjct: 427 LTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIK 486

Query: 578 KWESFHKEFFDQYR 591
            WE FH EF +QY+
Sbjct: 487 LWEKFHLEFMNQYK 500

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/494 (60%), Positives = 384/494 (77%), Gaps = 8/494 (1%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQ 164
           F PA + +L D+NE++LKA+YA+RG IP RAEEL  QL ++ +SLPF +I+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224
           L Q+PLT+ RQV+SL+Q+P+LL +++  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 225 QGVEGIRKSVAEFITKRD-------EGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277
           QGV  IRK+VA FI KRD       +       ++FLTAGAS AV+++L +F +    GV
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           L+PIPQYPLYTA + L  S+ LPYYL+E++ WST+P++IE +V +AI+  IKPT LVVIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397
           PGNPTGA+L+ +SI  I ++AA+YG V+IADEVYQEN++   +FHS KK+L  L++ +P 
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 458 LMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517
           LMV PP  G+ES+E DQ ER+ IH  LI ++ TLY+ F  L GI CQKPQGAMYLFP++ 
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 518 LPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577
           L   A+  A  L L PDEFYC KLLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EWI 
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 578 KWESFHKEFFDQYR 591
            WE FH EF ++Y+
Sbjct: 487 SWEKFHLEFMEKYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 78/167 (46%), Gaps = 17/167 (10%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y + QG   +RK +AE  +  D       E++ LT GA AA N+L      G     +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDV--TLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN-PG 339
            P Y   ++   +  ++    +L + + +  N  E+E ++K         T  +V+N P 
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIK-------PNTKCIVLNTPN 164

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386
           NP  +V+  E++ +I E+A K+G VV  DEVY         FHS +K
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVYS------PLFHSCEK 205

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 77/151 (50%), Gaps = 9/151 (5%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y S  G   +R  VA+ I   DE +++  +++ +T GA  A N+L+     GP   ++  
Sbjct: 55  YGSIWGTPVLRDLVAK-IHSSDEIQLT-ADNVLITNGAIGA-NFLVHYTAAGPGDHIICV 111

Query: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y   ++  ++  +     +L+   G++ N +++++ V+   +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTK------YIVLNNPNN 165

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           P G+V+S E + +I + A +    ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--ALPYYLDENS 307
           E++ L  G+   ++ L+   C   +  +LI  P Y +Y+    +N+ +   +P  +++NS
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                 + IET     +QN+    ++ + +PGNPTGA++ PE+I ++     + G VV+ 
Sbjct: 148 FQMDTEKVIET-----LQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 78/158 (49%), Gaps = 18/158 (11%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDE--GEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 277
           Y  SQG    +  + EF+ K      +I Y + D+  TAG + A    L +FC   +T  
Sbjct: 106 YGFSQG----QPELMEFVRKHTSLVHDIKYADWDVLATAGNTNAWESTLRVFCNRGDT-- 159

Query: 278 LIPIPQYPLYTATLALNNSQAL---PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLV 334
            I    Y  ++++L    +Q +   P  LDE   +   PE++E+++        KP +L 
Sbjct: 160 -ILAEAYS-FSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLY 214

Query: 335 VINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
            I  G NPTG+ LS +  A+I+ +A K+  ++I DE Y
Sbjct: 215 TIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 79/169 (46%), Gaps = 17/169 (10%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+   ++ L+   CR     +L   P Y +Y+    +N+ + +  P   ++NS
Sbjct: 85  DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                PE + T     ++N+ K  +L + +PGNPTG +++ + I  I E       +V+ 
Sbjct: 145 FQMNVPEVLST-----LKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWT--NGLVVV 197

Query: 368 DEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSG 416
           DE Y +        +SM K++         K+ N+ +    S S G++G
Sbjct: 198 DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSFGLAG 238

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 65/125 (52%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           D+  T G + A   +L IFC   +T   I   Q+  ++++++   +Q +   P  LDE+ 
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                P ++ET++    +   KP +L  +  G NPTG+ LS +   +I+ +A K+  ++I
Sbjct: 190 ---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 367 ADEVY 371
            DE Y
Sbjct: 247 EDEPY 251

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   + KS+ +  +   +  +  PE++ +T GA+  +   L+ I  +  E  
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEGILACLMGILNQNDEVI 142

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + L   + + + W+ + E+ E V+        
Sbjct: 143 VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN------ 196

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E + +I ++  K+  ++I+DEVY    F
Sbjct: 197 KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 79/158 (50%), Gaps = 18/158 (11%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDE--GEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 277
           Y ++QG    +  + EF+ + ++   E +Y + D  LT G +      L IFC     G 
Sbjct: 103 YGATQG----QPEILEFLREHNKLVHEFNYSDWDSILTTGNTNGWESTLRIFCN---KGD 155

Query: 278 LIPIPQYPLYTATLALNNSQAL---PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLV 334
           +I + +   ++++LA   +Q +   P  +D +      PE++E+++        KP +L 
Sbjct: 156 VI-LAEAHSFSSSLASAEAQGVITFPVPIDSDG---IIPEKLESILDNWTPGSPKPKLLY 211

Query: 335 VINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
            I  G NPTG+ LS E    I+++A K+  ++I DE Y
Sbjct: 212 TIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 66/125 (52%), Gaps = 11/125 (8%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+  +++ L+   C   +  +LI  P Y +Y+    +N+ + +  P  +++NS
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                 + IET     +Q +    +  V +PGNPTGA++    IA I ++ +++ + ++A
Sbjct: 148 FQMNTDKVIET-----LQGDSNIKIAFVTSPGNPTGALI---DIASIEKILSQWQSGIVA 199

Query: 368 -DEVY 371
            DE Y
Sbjct: 200 IDEAY 204

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           D+  T G + A    L +FC   + G +I + +   +++ LA   +Q +   P  +DE+ 
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++E ++    +   KP +L  I  G NPTG+ LS +   +I++VA K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 109/253 (43%), Gaps = 36/253 (14%)

Query: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVG-AYSSSQGVEGIRKSVAEFITKRDE--GEISY 248
           +L + ++ K+D  K  K    DI  +    Y  SQG    +  + EFI + ++   ++ Y
Sbjct: 74  ELSNDEVCKVDLKKDVKVHEGDIPLARSLQYGFSQG----QPELLEFIREHNKLIHDMQY 129

Query: 249 PE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLD 304
            + D+  TAG + A    L +FC     G +I + +   +++ LA   +Q +   P  +D
Sbjct: 130 EDWDVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPVPID 185

Query: 305 ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGT 363
           +       P ++E ++        KP +L  I  G NPTG  L+ E   +IF +A K+  
Sbjct: 186 DKG---IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDF 242

Query: 364 VVIADEVYQENIFPGTKFHSMKKILRHLQ-----REHPGKFDNVQLASLHSTSKGVSGEC 418
           ++I D  Y         F  M K  R LQ     R  P +     LASL  T   V  + 
Sbjct: 243 LIIEDAPYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTD- 293

Query: 419 GQRGGYMELTGFS 431
              G  + L  FS
Sbjct: 294 ---GRVIRLDSFS 303

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           DI LT G +      L +FC     G +I + +   ++++LA   +Q +   P  +DE+ 
Sbjct: 132 DIILTTGNTNGWESTLRVFCN---KGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++E ++        KP +L  I  G NPTG  L+ E   +I+ +A K+  ++I
Sbjct: 188 ---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 78/168 (46%), Gaps = 14/168 (8%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDE----GEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           YS +QG++ +   +  FITK +      E  Y  DI L  G+S ++  +    C    T 
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLCDESTTV 194

Query: 277 VLIPIPQYPLYTATLALNNSQALPYYLDEN-SGWSTNPEEIETVV-----KEAIQNEIKP 330
           ++      P+ +  +A   ++ +P  L+ N      + E +E ++     K   ++  KP
Sbjct: 195 LMEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 331 TVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
            +L  I+ G NP G  LS E   +I+ +A ++  +++ D+ Y    FP
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPYCYLTFP 301

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 10/128 (7%)

Query: 246 ISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYL 303
           ISY ++I L  G+   V+ L+   C      VL+  P Y +Y+    +N+++ +  P   
Sbjct: 85  ISY-KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 304 DENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGT 363
           ++NS       +++ V+ E + N+    +L +  PGNPTGA +S + I  +    +    
Sbjct: 144 EDNSF----DMDLDNVL-ETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWS--AG 196

Query: 364 VVIADEVY 371
           +V+ DE Y
Sbjct: 197 IVVVDEAY 204

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           E+I L  G+  +++ L+ + C   +  ++I  P Y +Y+    +N+   +  P   ++NS
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTV--LVVINPGNPTGAVLSPESIAQIFEVAAKYGTVV 365
                 + +ET+ ++       PT+  + + +PGNPT A++    I ++       G +V
Sbjct: 148 FQMDTSKVLETLAQD-------PTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLV 198

Query: 366 IADEVY 371
           + DE Y
Sbjct: 199 VVDEAY 204

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P    +NS
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
             +   E I+T      QN+    ++ + +PGNPTGA +    I +I +   +   +V+ 
Sbjct: 147 FQANTDEVIKTA-----QNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR--GMVVV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 80/190 (42%), Gaps = 41/190 (21%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDEGEISYPEDIFLTAGASAAVNYLLSIFCRG-- 272
           Y S++G   +R ++ EF+ +      RD+   S PE + LT+GAS  V   L+I  +   
Sbjct: 51  YGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQATL 107

Query: 273 PETGV----LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVK--EAIQ- 325
           P TGV     I  P Y L                +DE    S + E +E  +K  E+I  
Sbjct: 108 PHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDP 167

Query: 326 ---NEIKPTVLVVINP--------------------GNPTGAVLSPESIAQIFEVAAKYG 362
              NE    + ++ NP                     NP+G   + E+  ++ E+A KY 
Sbjct: 168 NPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYD 227

Query: 363 TVVIADEVYQ 372
            ++I D+VY 
Sbjct: 228 MLIITDDVYD 237

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 71/152 (46%), Gaps = 9/152 (5%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y + +G + +R  VA   + +   E+   +D  L    +   N+L+S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDK---EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y   ++   +  ++     L+  + +  +  ++++++K   +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           P G+V+   ++ +I  +A K    VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--ALPYYLDENS 307
           +++ L  G+  +++ L+   C   +  +LI    Y +YT    +N+ +   +P  L E  
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGT-VVI 366
            +  + E+I     E +QN+    ++ + +PGNPTG  +    I +I    +++ T +V+
Sbjct: 148 KFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKIL---SQWQTGLVV 200

Query: 367 ADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSG 416
            DE Y +    G+   S+  +          K++N+ +    S S G++G
Sbjct: 201 VDEAYID-FVEGSDKGSLAPL--------ATKYENIAVLQTLSKSFGLAG 241

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDENSG 308
           E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +    L +N+ 
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNS 148

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           +  + E + TV    +QN+    +L + +PGNPTGA +  E I  + +       +V+ D
Sbjct: 149 FQMDTESVLTV----LQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD--GLVVVD 202

Query: 369 EVY 371
           E Y
Sbjct: 203 EAY 205

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 74/156 (47%), Gaps = 11/156 (7%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           Y +S+G   +   + E I K  +  I Y + D+ +TAG++ A +  L +FC  P   VL+
Sbjct: 100 YGNSRGQRELVSFLKEHIVKFHQ--IPYSDWDVLITAGSTQAWDASLRLFCN-PGDSVLL 156

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQ---NEIKPTVLVVI 336
              +   Y++++    +Q +     E  G    PE++E +++           P +L VI
Sbjct: 157 ---ESWTYSSSVEAAEAQGMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVI 213

Query: 337 NPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
             G NP G  L+ E    I+ +  KY  V+I D+ Y
Sbjct: 214 PTGQNPMGVTLADERKPLIYNIIQKYDMVLIEDDPY 249

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 74/164 (45%), Gaps = 18/164 (10%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y S +G + +R  +A        G     +++ +T GA AA N+L+     GP   V+  
Sbjct: 55  YGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICV 108

Query: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y    +   +  ++     L +  G+  N E ++ ++K   +      ++++ NP N
Sbjct: 109 DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNN 162

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSM 384
           P G+ +S E++  I ++  +    +  DEVY+        FHSM
Sbjct: 163 PLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 64/132 (48%), Gaps = 12/132 (9%)

Query: 245 EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---P 300
           +I Y + DI  TAG + A    L +FC     G +I + +   +++ LA   +Q +   P
Sbjct: 126 DIKYQDWDIIATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFP 181

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAA 359
             +D+N      PE++E ++        KP +L  I  G NPTG  L    + +I+ +A 
Sbjct: 182 IPIDDNG---IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQ 238

Query: 360 KYGTVVIADEVY 371
           K+  +++ D  Y
Sbjct: 239 KHDFLIVEDAPY 250

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 63/126 (50%), Gaps = 9/126 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+   ++ L+   C+     +++  P Y +Y+    +N+   +  P  +++NS
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                   +ET+ K+ +       +L + +PGNPTG +++ + I  + E   K G VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 368 DEVYQE 373
           DE Y +
Sbjct: 198 DEAYVD 203

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNS--QALPYYLDENSG 308
           ++  T G + +    L IFC   +T   I   QY   ++  A         P  LD +  
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDADG- 190

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIA 367
               PE +E ++     +  KP +L  I  G NPTG+ LS +   +I+ +A K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 368 DEVY 371
           DE Y
Sbjct: 249 DEPY 252

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 251 DIFLTAGASAAVNYLLSIFC-RGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGW 309
           D+  T G + A    L +FC RG      + + +   ++++LA   +Q +  +       
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGD-----VILAEAHSFSSSLASAEAQGIITFPVPIDAH 186

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
              PE++E ++    +   KP +L  I  G NPTG+ L+ E   +I+ +A K+  ++I D
Sbjct: 187 GIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIED 246

Query: 369 EVY 371
           E Y
Sbjct: 247 EPY 249

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 88/186 (47%), Gaps = 24/186 (12%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +  T     E+   E++ +T GA+  +
Sbjct: 72  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGI 128

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDENSG----WST 311
            + L+ +   G E  V++  P +  Y   + L   + +      P  LD+ +     W+ 
Sbjct: 129 LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEV 370
           + E+ E    +AI ++ K    V+IN P NP G V + + +  +  +  K+  V+I+DEV
Sbjct: 187 DFEQFE----KAITSKTKA---VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEV 239

Query: 371 YQENIF 376
           Y+   F
Sbjct: 240 YEHLYF 245

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   + +S+ +  +     E+   E++ +T GA+  + + L+ I   G E  
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + +   + + + W+ + E+    + +      
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E + +I E+  K   V+I+DEVY+   F
Sbjct: 197 KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYF 244

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 83/211 (39%), Gaps = 40/211 (18%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDEGEISYPEDIFLTAGASAAVNYLLSIFCRG-- 272
           Y S +G   +R+++  F         RD+   S PE + L++GAS  V   LSI  +   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGV---LSILLQATL 107

Query: 273 PETG----VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKE------ 322
             TG      I  P Y L           +    +DE+   S +   +E  ++E      
Sbjct: 108 AHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFT 167

Query: 323 ----------------AIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVV 365
                           A+  +I   V+  I    NPTG   S E+  ++ E+A KY  ++
Sbjct: 168 EEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLI 227

Query: 366 IADEVYQENIF--PGTKFHSMKKILRHLQRE 394
           IAD+VY    F  P       KK   HL RE
Sbjct: 228 IADDVYDMLDFSPPFDNLPQPKKRFVHLDRE 258

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           ++ +TAG ++A    L IFC   +T     + +   ++++L+   +Q +   P  +D+  
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++  ++        KP +L  I  G NPTG+ L  E  +Q++++A K+  +++
Sbjct: 188 ---IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIV 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 86/183 (46%), Gaps = 26/183 (14%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +  +     E+   E+I +T GA+  +
Sbjct: 76  AIKEAQKALEI--PLVNQYSPTRGRASLLNSLIKLYSPFYGKELK-QENITITTGANEGI 132

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLD----ENSGWST 311
            + L+ +   G E  V++  P +  Y + + L   + +      P  LD    E + W  
Sbjct: 133 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEW-- 188

Query: 312 NPEEIETVVKEAIQNEIKP-TVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADE 369
                 T+  E  +N I P T  V++N P NP G V + E + ++ E+  +   ++I+DE
Sbjct: 189 ------TIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDE 242

Query: 370 VYQ 372
           VY+
Sbjct: 243 VYE 245

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           W+ N +E+E  +        K   L++  P NP G V + E + +I E+  K+  V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 369 EVYQENIF 376
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLAL--NNSQALPYYLDENSG 308
           D+  T G + +    L IFC   +T   I   +Y   ++  A         P  LD +  
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDADG- 190

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIA 367
               PE +E ++        KP +L  I  G NPTG+ LS +   +I+ +A K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 368 DEVY 371
           DE Y
Sbjct: 249 DEPY 252

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 14/128 (10%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           DI  T G++   +  L IFC   +T +L    +Y  Y++++   ++Q L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184

Query: 308 GWSTNPEEIETVV---KEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGT 363
           G    PE++E ++    +   +   P +L  I  G NPTG  LS      I+ +A KY  
Sbjct: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 364 VVIADEVY 371
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           D+F TAG + A    L +FC     G +I + +   ++++LA   +Q +   P  +D + 
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++  ++     N  KP +L  I  G NPTG  ++      I+++A K+  +++
Sbjct: 190 ---IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIV 246

Query: 367 ADEVY 371
            DE Y
Sbjct: 247 EDEPY 251

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 84/185 (45%), Gaps = 22/185 (11%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +  +   + ++   E++ +T GA+  +
Sbjct: 88  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIKLYSPIYDTDLR-AENVTVTTGANEGI 144

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDENSG----WST 311
            + L+ +   G E  V++  P +  Y   + L   + +      P  LD+ +     W+ 
Sbjct: 145 LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTI 202

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           + E+ E  +        K   +++  P NP G V + E +  +  +  K+  V+I+DEVY
Sbjct: 203 DFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 256

Query: 372 QENIF 376
           +   F
Sbjct: 257 EHLFF 261

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   +  S+ +  +   + +++ PE++ +T GA+  + + L+ I   G E  
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIINPGDEVI 143

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + L   + + + W+ + +E    +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP------ 197

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E + ++  +  +   ++IADEVY+   F
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYF 245

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 74/158 (46%), Gaps = 15/158 (9%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEG--EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 277
           Y +S+G    +  + EF+ +  E   ++ Y + D+ +TAG++ A +  + +FC   ++ V
Sbjct: 98  YGNSRG----QSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVV 153

Query: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAI---QNEIKPTVLV 334
           +        Y++++    +Q L     E       PE +  ++ E         +P VL 
Sbjct: 154 MEAFT----YSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVLY 209

Query: 335 VINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
            I  G NP G+ L     AQI+ +A +Y  +++ D+ Y
Sbjct: 210 TIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/353 (19%), Positives = 132/353 (37%), Gaps = 46/353 (13%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   +  S+ +  +     E+   E++ +T GA+  + + L+ I   G E  
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + +   + E   W+ + EE+            
Sbjct: 151 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTS------ 204

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKIL 388
           K   L++  P NP G V + E + +I  +  +   V+I+DEVY+   F  +         
Sbjct: 205 KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDSY-------- 256

Query: 389 RHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCP 448
                         ++A+L      ++   G  G     TG+       ++ L    L  
Sbjct: 257 -------------TRIATLSPEIGQLTLTVGSAGKTFAATGWRIGW---VISLNPELLSY 300

Query: 449 VVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSL---EGIECQK 505
           V  G   +      P++   +   + A +    E + T  +  +E F S+    G+    
Sbjct: 301 VSKGHTRICFSSPSPIQEAVANSIEDALKGDYFEAMRTDYIRKFEIFTSVFKEMGLPYTI 360

Query: 506 PQGAMYL---FPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGF 555
           P+G  ++   F K+++P         L+   D      L+   G+  +P + F
Sbjct: 361 PEGTYFILVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINELGVVAIPPTEF 413

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 63/127 (49%), Gaps = 11/127 (8%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + +NS
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGT-VVI 366
            +  N E + T+    + N+    ++   +PGNPTGA +       I EV  K+   +V+
Sbjct: 148 -FQMNTEAVLTI----LNNDPLIKIMFATSPGNPTGAKI---KTCLIEEVLQKWDNGIVV 199

Query: 367 ADEVYQE 373
            DE Y +
Sbjct: 200 VDEAYVD 206

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 68/139 (48%), Gaps = 21/139 (15%)

Query: 250 EDIFLTAGASAAV-NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYY 302
           E++ +T GA+  + + L+ +   G E  V++  P +  Y + + L   + +      P  
Sbjct: 117 ENVTITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKE 174

Query: 303 LD----ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEV 357
           LD    E + W+ + E+     K AI ++ K    V+IN P NP G V + E + QI  +
Sbjct: 175 LDQRVTEGTEWTVDMEQF----KNAITSKTKA---VIINTPHNPIGKVFTREELLQIGNI 227

Query: 358 AAKYGTVVIADEVYQENIF 376
             +   ++I+DEVY+   F
Sbjct: 228 CVEKNVIIISDEVYEHLYF 246

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 89/186 (47%), Gaps = 24/186 (12%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV 262
           AIK A+  + DI   V  YS ++G   +  S+ +  +     E+   E++ +T GA+  +
Sbjct: 72  AIKEAQKAL-DIP-MVNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGI 128

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDENSG----WST 311
            + L+ +   G E  V++  P +  Y   + L   + +      P  LD+ +     W+ 
Sbjct: 129 LSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEV 370
           + E+ E    +AI ++ K    V+IN P NP G V + E +  +  +  K+  V+I+DEV
Sbjct: 187 DFEQFE----KAITSKTKA---VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEV 239

Query: 371 YQENIF 376
           Y+   F
Sbjct: 240 YEHLYF 245

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWS 310
           ++  + G + A    L IFC   + G ++   +Y  +++ LA   +Q +         + 
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFG 186

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADE 369
             PE++E ++     N  KP +L  I  G NPTG  L  +    I+ +A K+  +++ DE
Sbjct: 187 IVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDE 246

Query: 370 VY 371
            Y
Sbjct: 247 PY 248

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           D+  TAG + A    L +FC     G +I +  +  ++++LA   +Q +   P  +D + 
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHS-FSSSLASAEAQGVITFPVPIDADG 189

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++  V++       KP +L  I  G NPTG  ++      I+++A KY  +++
Sbjct: 190 ---IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIV 246

Query: 367 ADEVY 371
            DE Y
Sbjct: 247 EDEPY 251

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 65/124 (52%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + +NS
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  + E + T+    ++N+    ++ V +PGNPTGA +    I Q+ +   + G VV+ 
Sbjct: 148 -FQMDVEAVLTI----LENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 117/298 (39%), Gaps = 69/298 (23%)

Query: 249 PEDIFLTAGASAAV-NYLLSIFCRGPETGVLIPIPQYPLYTATL--------ALNNSQAL 299
           PE+I +T GA+  +   L+S+   G E  VL P     +Y   +         L   + L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 300 PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAA 359
                + S W+ + ++  + + E      K   +++ +P NPTG V + E +  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 360 KYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECG 419
           +    +I+DEVY+   F                       + V+LASL      ++   G
Sbjct: 213 EKNVYIISDEVYENLYFTP---------------------ECVKLASLSPEISNITLTIG 251

Query: 420 QRGGYMELTGF------SHEMRQVILKLAS---ISLC------PVVTGQALVDLMVRPPV 464
             G    +TG+      S  +   +LKLAS   I +C      P +     +D+      
Sbjct: 252 SAGKIFAVTGWRIGWIISENVE--LLKLASSAHIKICFSSPSPPQLACAHAIDI------ 303

Query: 465 EGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYL---FPKIDLP 519
               +  SD  +R  + +  I +   L   F  L G+    P+G+ ++   F K+ +P
Sbjct: 304 ----ALNSDYFDR--MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDENSGW 309
           +I L  G+  +++ ++   C      +L+  P Y +Y+    +N+ + +    + E++ +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADE 369
             + ++    V + + N+ +  +L + +PGNPTGA +    I ++ +   +   +V+ DE
Sbjct: 149 QMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR--GLVVVDE 202

Query: 370 VY 371
            Y
Sbjct: 203 AY 204

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 85/184 (46%), Gaps = 20/184 (10%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV 262
           AI  AKS ++     V  YS ++G   + KS+ E + K   G+    +++ +T GA+  +
Sbjct: 61  AINAAKSALD--VPLVNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGI 117

Query: 263 -NYLLSIFCRGPETGVLIP-----IPQYPLYTATL---ALNNSQALPYYLDENSGWSTNP 313
            + L+ I   G E  V  P     IP   L    +    ++  + +         W  + 
Sbjct: 118 LSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDW 177

Query: 314 EEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           + +E    +   N+ K    V+IN P NP G V + + + ++ ++  ++ TVVI+DEVY+
Sbjct: 178 DALE----KTFNNKTKA---VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYE 230

Query: 373 ENIF 376
              F
Sbjct: 231 HLYF 234

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P   ++NS
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  N +++  ++K    N+    ++ + +PGNPTG  +  + I ++ +       +V+ 
Sbjct: 148 -FQLNSDKVLDILK----NDPLIKLVFITSPGNPTGVKIETKRIEKVLQNWD--NGLVVV 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 21/176 (11%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGW 309
           ++I L  G+  +++ ++   C   E  V++  P Y +Y     +N+      Y++     
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG----YVEVPLIS 143

Query: 310 STNPEEI-ETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           S N  +I E  + E +  +    V+ + +PGNPTGA +    + ++         +V+ D
Sbjct: 144 SDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR--NWTAGIVVVD 201

Query: 369 EVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGY 424
           E Y +       F + K  L  L  +HP       L  L + SK  SG  G R G+
Sbjct: 202 EAYID-------FSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWS 310
           D+  TAG++ A +  L +FC   ET   + + +Y  Y+++L    +Q L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 311 TNPEEIETVVKE---AIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
              +++  ++++   A+Q      +  + N  NPTG  L  E   ++  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 368 DEVY 371
           D+ Y
Sbjct: 244 DDPY 247

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 14/128 (10%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           DI  T G++   +  L IFC   +T +L    +   Y++++   ++Q L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLD--- 184

Query: 308 GWSTNPEEIETVVKE--AIQNEI-KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGT 363
           G    P ++E ++    ++  E+  P +L  I  G NPTG  LS      I+ +A +Y  
Sbjct: 185 GEGIVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDI 244

Query: 364 VVIADEVY 371
           ++I D+ Y
Sbjct: 245 IIIEDDPY 252

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 81/168 (48%), Gaps = 22/168 (13%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETGVLI 279
           YS ++G   + K++A+  T     ++S  ++I +  GA+ A+ + L+ +  +G E  V++
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVL------ 333
             P +  Y + + L  +  +  Y+  N      P E++  V    + EI   +L      
Sbjct: 134 FEPFFDQYISNIEL--AGGVVRYVPINP-----PRELDDRVTRGTEWEIDWDILEKTINS 186

Query: 334 ----VVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
               V+IN P NP G V + E + ++ ++      V+I+DEVY+   F
Sbjct: 187 RTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 73/181 (40%), Gaps = 24/181 (13%)

Query: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPED 251
           QL + K F+LD   R              Y + +G + +R  +A          + +  D
Sbjct: 39  QLSNDKPFQLDPDMRL------------TYGAIKGSKDLRTLIAGLYG------VQFSAD 80

Query: 252 IFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWST 311
             L    +   N+LL     G    V+   P Y    +   +  ++     L E   +  
Sbjct: 81  NVLVTNGAIGANFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSFLP 140

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           N + +    K+AI++  K  ++++ NP NP G V+S E +  I E+  +    +  DEVY
Sbjct: 141 NLDTL----KKAIKSNTK--LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVY 194

Query: 372 Q 372
           +
Sbjct: 195 R 195

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 62/125 (49%), Gaps = 7/125 (5%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSG- 308
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +   L  + G 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           +  + E + T++K    N+    ++ V +PGNPTGA +    I ++ +       +V+ D
Sbjct: 148 FQMDTEAVLTILK----NDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQNWDN--GLVVVD 201

Query: 369 EVYQE 373
           E Y +
Sbjct: 202 EAYVD 206

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 64/132 (48%), Gaps = 12/132 (9%)

Query: 245 EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ---ALP 300
           +I Y + D+  TAG + A    L +FC     G +I + +   ++++LA   +Q   A P
Sbjct: 127 DIKYKDWDVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFP 182

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAA 359
             +D +      PE++  ++        KP +L  I  G NPTG  ++      I+++A 
Sbjct: 183 VPIDADG---IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQ 239

Query: 360 KYGTVVIADEVY 371
           K+  +++ DE Y
Sbjct: 240 KHDFLIVEDEPY 251

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307
           DI  T G++ A +  L IFC   +T +L    +   Y++++   ++Q L   P  +D   
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                 EE+ +   +       P +L  I  G NPTG  LS      I+ +A KY  +++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 367 ADEVY 371
            D+ Y
Sbjct: 249 EDDPY 253

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 80/168 (47%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   +  S+ +  +     +++  E++ +T GA+  + + L+ +   G E  
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNKDLT-TENVTVTTGANEGILSCLMGLLNAGDE-- 141

Query: 277 VLIPIPQYPLYTATLALNNSQAL------PYYLDENSGWSTNPEEIETVVKEAIQNEIKP 330
           V++  P +  Y + + L   + +      P  LD  +   T  EE  T+  E  +  I P
Sbjct: 142 VIVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRN---TRGEEW-TIDFEQFEKAITP 197

Query: 331 -TVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
            T  V+IN P NP G V + E +  +  +  K+  ++I+DEVY+   F
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYF 245

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+  +++ ++   C   +  +L   P Y +Y+    +N+ + L  P   ++NS
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
               + + I  +  + +   IK  ++ + +PGNPTGA +    I +I E  +  G  V+ 
Sbjct: 147 FQPDSQKVISILSSDPL---IK--LVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + +NS
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  + E   T++K    N+    ++ V +PGNPTGA +    I +I +   + G VV+ 
Sbjct: 148 -FQMDTEAALTILK----NDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 70/153 (45%), Gaps = 12/153 (7%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           +Y + +G + +R S+A        G     +DI LT GA  A N+L      G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
             P Y    +   +  ++     L +   +  N + +++++K   +      ++++ NP 
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPN 161

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           NP G+V+  + + QI ++  +    + +DEVY+
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 92/428 (21%), Positives = 164/428 (38%), Gaps = 48/428 (11%)

Query: 159 IGNPQQLQQKPLTYYRQVLSLL-QYPELLNQNEQQLV-------DSKLFKLDAIKRAKSL 210
           I N   L Q PL    +VL L  Q+ +  N N+  L          K+  L AI +A+ +
Sbjct: 22  IRNVSTLTQIPLAPPDRVLGLTEQFVKDKNTNKVNLTVGIYKDGHGKVSTLPAITKAQEI 81

Query: 211 --MEDIGGSVGAYSSSQGVEGIRKSVAEFITKRD----------EGEISYPEDIFLTAGA 258
             ++D      +Y    G    R +V  F+ +            +  +S+ + +  T GA
Sbjct: 82  IDLDDALNKNLSYLPISGCPNYRDNVLNFLFRDSVPKYGDKLIADNRVSFIQSLSGT-GA 140

Query: 259 SAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIET 318
            A  + LLS F       V IP P +P +     +N  + L YY   N G  T    +E+
Sbjct: 141 IAVASKLLSSFI---SDTVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLES 197

Query: 319 VVKEAIQNEIKPTVLVVINPG--NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
              E   +  K    ++++    NPTG   + +   +I +   +   + I D  YQ    
Sbjct: 198 TETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQG--L 255

Query: 377 PGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELT-------- 428
                +    +LRH   E   K     L    S +K + G  G+R G + +         
Sbjct: 256 ESGSLYDDAYLLRHCLDESRYKGWKHGLFLCQSFAKNM-GLYGERVGSLSIVVPPNLEKA 314

Query: 429 --GFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLIT 486
                 ++++++  + S    P   G  + +L++  P E    +  D    +SI  +L  
Sbjct: 315 KLSIDSQLKKIVRGIYS---SPPGYGCRIANLVLSQP-ELRNQWHQDV---HSIVGRLTN 367

Query: 487 RAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP-FKAVQEARHLELTPDEFYCKKLLEST 545
               +Y+      G+     Q  M+ F ++D+   + +++   + LT D       +  +
Sbjct: 368 VRKQMYDKL-GWSGLVDSSQQHGMFYFTRLDIDQVQLLKDKYSIYLTSDGRLSLSGINDS 426

Query: 546 GICTVPGS 553
            I  V GS
Sbjct: 427 NIDYVCGS 434

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           +P++L  I+ G NPTG  +S E+ A+I+++A KY  +++ D+ Y    +P
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPYSYMSYP 274

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 305 ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTV 364
           E + W+ + +E+   +        K   L++  P NP G V + E + QI ++  +   V
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 365 VIADEVYQENIF 376
           +I+DEVY+   F
Sbjct: 233 IISDEVYEHLYF 244

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPG 378
           KP VL  I  G NPTG  LSPE    I+E+A  +  +++ D+ Y    FP 
Sbjct: 245 KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPYGYLKFPA 295

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLAL--NNSQALPYYLDENSG 308
           D+  T G ++A    L +FC   +T   I   +Y   ++ +A      +A P  LDEN  
Sbjct: 132 DVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVPLDENG- 187

Query: 309 WSTNPEEIETVVK--EAIQNEI-KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTV 364
               PE +  ++   E   + + +P +L  +  G NPTG  LS +    ++ +A ++  +
Sbjct: 188 --MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLL 245

Query: 365 VIADEVY 371
           ++ DE Y
Sbjct: 246 IVEDEPY 252

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 75/184 (40%), Gaps = 33/184 (17%)

Query: 221 YSSSQGVEGIRKSVAEFITKR-----DEGEISYPEDIFLTAGASAAVNYLLSIFCRGPET 275
           Y S  G   +R  +AEF  K           + P+ + LT+GAS  +  +L +    P T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 276 G----VLIPIPQYPLY-------------TATLALNNSQALPYY-----LDENSGWS--- 310
           G      I  P Y L              TA     +   L +      L ENS      
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 311 -TNPEEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
               E ++ +  +  Q ++   V+ ++    NPTGA+ S  S  ++ E+A KY  ++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 369 EVYQ 372
           +VY 
Sbjct: 228 DVYD 231

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWS 310
           D+  TAG +      L +FC     G +I + +   ++++LA   +Q +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADE 369
             PE++  ++        KP +L  I  G NPTG  ++      I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 370 VY 371
            Y
Sbjct: 250 PY 251

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           PE++E ++ E      +P +L  I  G NPTG  L+ +   +I+ +A K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 69/179 (38%), Gaps = 30/179 (16%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG-- 276
            Y S +G   +R+ V   I +      S PE I LT+GAS  + N LL      P TG  
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTL--PHTGYT 107

Query: 277 --VLIPIPQYPL---------------------YTATLALNNSQALPYYLDENSGWSTNP 313
               I  P Y L                     YT+       + L Y+  E      N 
Sbjct: 108 KQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNS 167

Query: 314 EEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
            +I    K  +Q +I   V   I    NP+G     E+  Q+ ++A KY  ++I D+VY
Sbjct: 168 TDI-IQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 324 IQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
            +++ KP +L  I  G NPTG  LS E   +I+E+  K+  +++ D+ Y   +FP
Sbjct: 203 FKDKPKPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFP 257

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 250 EDIFLTAGA-SAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLA--------LNNSQALP 300
           E+I +T GA  A +  L+++   G E  V+ P     ++   +A        L N     
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
             + E + W  + E +     +      K  ++++ NP NP G V + + + ++  +   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 361 YGTVVIADEVYQ 372
            G  +IADEVY+
Sbjct: 213 NGAYIIADEVYE 224

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           KP  L  +  G NPTG  LSP    +I+E+A K+  +++ D+ Y    FP
Sbjct: 207 KPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFP 256

>SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highly
           similar to uniprot|Q08873 Saccharomyces cerevisiae
           YOR367W SCP1
          Length = 270

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 9/65 (13%)

Query: 349 ESIAQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRHLQREHPGKFDNV- 402
           E I+Q  E A KYG  V  DE++Q     E+  P   + S+K + R+  ++HP KF  + 
Sbjct: 161 EQISQFLEFARKYG--VPDDELFQTLDLYEDKDPAIVYQSLKSLSRYANKKHPDKFPVIG 218

Query: 403 -QLAS 406
            QLA+
Sbjct: 219 PQLAT 223

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           Y+   G+  IR      + K ++   S  + D+ L++G+  ++      FC    T ++ 
Sbjct: 125 YNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLME 184

Query: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVK-------EAIQNEIKPTV 332
                P+ +   A   ++ +P  ++     ST   +++ + +          ++  KP +
Sbjct: 185 EFTFTPVISHVKA-TGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRI 243

Query: 333 LVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTK 380
           L  I  G NPTG  +  E+  +I+E+A K+  +++ D+ Y    FP  K
Sbjct: 244 LYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPSYK 292

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           E++ L  G+  +++ ++   C   +  ++   P Y +Y+   ++N+ + +  P    +NS
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                   ++T+ K+ +   IK  ++ + +PGNPTGA +    I +I +   +   +++ 
Sbjct: 145 FQVDTEAVLDTLKKDPL---IK--LVFITSPGNPTGAKIETSRIEKILQNWDQ--GILVV 197

Query: 368 DEVY 371
           DE Y
Sbjct: 198 DEAY 201

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 71/177 (40%), Gaps = 26/177 (14%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG--- 276
            Y   +G   +R+ + +F   R  G  S PE + L++G+S     +L +    P T    
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGCLSVL-LHTTLPHTNFTR 109

Query: 277 -VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKE------------- 322
              I  P Y L           +    +DE    S N E++ + ++              
Sbjct: 110 QAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVS 169

Query: 323 AIQNEIKPT-------VLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
            IQN  KPT       +  V    NP+G   S E+  ++ E+A +Y  ++I D+VY 
Sbjct: 170 IIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDENS 307
           E+  L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+   +  P   ++NS
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  +  EI  +    + N+    ++ + +PGNPTGA +  + I  + +   +   +VI 
Sbjct: 147 -FQIDATEILNI----LANDPLIKLVFITSPGNPTGAKIEIDRIEYLLKNWDQ--GLVIV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 97/445 (21%), Positives = 170/445 (38%), Gaps = 108/445 (24%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           Y+ ++G+  +   V +F+++       DE E ++  D+ L+ G++ ++  +    C    
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 275 TGVLIPIPQYPLYTATLALNNSQA-----LPYYLD-----ENSG------------WSTN 312
           T V+I       +T T A++N +A     +P  ++     E+ G            WST 
Sbjct: 159 TTVMIE-----EFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTG 213

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           P           ++  KP VL  I  G NPTG  +      +I+++A ++  +++ D+ Y
Sbjct: 214 P----------YKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPY 263

Query: 372 QENIFPG--------TKFHS----MKKILRHLQREHPGKFD-NVQLASLHSTSKGVSGEC 418
               FP           +HS     ++ L     +     D + ++  L + SK  +   
Sbjct: 264 GYLYFPSYNPQEPLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--P 321

Query: 419 GQRGGYMELTGFSHEMRQVILKLASISL-CPVVTGQALVDLMVRPPVEGEESFESDQAER 477
           G R  ++    F   + Q IL LA I+   P  T QA+V   ++     E +  S  + +
Sbjct: 322 GLRLSFIVANKF---LLQKILDLADITTRAPSGTSQAIVYSTIK--AMAESNLSSSLSMK 376

Query: 478 NSIHEKLITRAM---------------TLYETFNSLEG-IECQKPQGAMYLFPKI----- 516
            ++ E  I   M                LYET +   G     +P   M++  KI     
Sbjct: 377 EAMFEGWIRWIMQIASKYNHRKNLTLKALYETESYQAGQFTVMEPSAGMFIIIKINWGNF 436

Query: 517 DLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576
           D P    Q+   L+         K L   G+  V G      P      + FL   + + 
Sbjct: 437 DRPDDLPQQMDILD---------KFLLKNGVKVVLGYKMAVCPNYSKQNSDFLRLTIAYA 487

Query: 577 ----------KKWESFHKEFFDQYR 591
                     K+  S  KEFFD Y+
Sbjct: 488 RDDDQLIEASKRIGSGIKEFFDNYK 512

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 74/185 (40%), Gaps = 35/185 (18%)

Query: 221 YSSSQGVEGIRKSVAEFITKR-----DEGEISYPEDIFLTAGASAAV-NYLLSIFCRGPE 274
           Y S  G   +R  +AEF  +           + PE + LT+GAS  + N LL      P 
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTL--PH 105

Query: 275 TG----VLIPIPQYPLY-------------TATLALNNSQALPYYLD-----ENSGWSTN 312
           TG      I  P Y L              TA     +   L +        ENS    +
Sbjct: 106 TGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGES 165

Query: 313 PEEIETVVK-----EAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            ++ E  ++     +  +   +  + +V    NPTGA+ S  S  ++ E+A KY  ++I+
Sbjct: 166 GQKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIIS 225

Query: 368 DEVYQ 372
           D+VY 
Sbjct: 226 DDVYD 230

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 331 TVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILR 389
           T  +++N P NP G V + E + Q+ ++  K    +I+DEVY E+++ G +F  +  I +
Sbjct: 199 TKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISK 257

Query: 390 HL 391
            +
Sbjct: 258 EI 259

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 82/356 (23%), Positives = 140/356 (39%), Gaps = 84/356 (23%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           Y+ ++G+  +   V + + +       DE E ++  D+ L+ G++ ++  +    C    
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 275 TGVLIPIPQYPLYTATLALNNSQA-----LPYYLD-----ENSG------------WSTN 312
           T V+I       +T T A++N +A     +P  +D     E  G            WST 
Sbjct: 159 TTVMIE-----EFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTG 213

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           P           ++  KP VL  I  G NPTG  +      +I+++A K+  +++ D+ Y
Sbjct: 214 P----------YKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPY 263

Query: 372 QENIFPGTKFH---------SMKKILRHLQREHPGKF----DNVQLASLHSTSKGVSGEC 418
               FP              S   I R+L       F     + ++  L + SK  +   
Sbjct: 264 GYMYFPSYNPQNPLENPYDSSDLTIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP-- 321

Query: 419 GQRGGYMELTGFSHEMRQVILKLASISL-CPVVTGQALVDLMVRPPVEGEESFESDQAER 477
           G R  ++    F   + Q IL LA I+   P  T QA+V   ++   E E S  S  + R
Sbjct: 322 GLRLSFIVANKF---LLQKILDLADITTRAPSGTSQAIVYSTIKAMAESEMS--SSVSFR 376

Query: 478 NSIHEKLITRAM---------------TLYETFNSLEG-IECQKPQGAMYLFPKID 517
           +++ E  I   M                LYET +   G     +P   M++  K+D
Sbjct: 377 DAMFESWIKWIMQIASKYNHRKNVTLKALYETESYQAGHFTVMEPSAGMFIIIKLD 432

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 15/137 (10%)

Query: 249 PEDIFLTAGASAAV-NYLLSIFCRGPETGVLIPI-PQY------PLYTAT-LALNNSQAL 299
           P ++ +T GA+ A+ + L+ +  +G E  V  P   QY      P    T + L+  + L
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 300 PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAA 359
              +   + W+ + +E+   +        K   L++  P NP G V + E + +I  +  
Sbjct: 178 ENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICV 231

Query: 360 KYGTVVIADEVYQENIF 376
           +   V+I+DEVY+   F
Sbjct: 232 ENNVVIISDEVYEHLYF 248

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 75/181 (41%), Gaps = 31/181 (17%)

Query: 221 YSSSQGVEGIRKSVAEFIT----KRDEGEISYP--EDIFLTAGAS-AAVNYLLSIFCRGP 273
           Y S +G   +R+ +  F+     K D+G  +    + + L +GAS   +N LL      P
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTL--P 107

Query: 274 ETG----VLIPIPQYPLYTATL----------ALN-------NSQALPYYLDENSGWSTN 312
             G      I  P Y L               A+N       + ++L   LD + G S  
Sbjct: 108 HNGYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQP 167

Query: 313 PEEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
               E +   A+  +I   VL  I    NP+G   S E+  ++ ++A KY  +VI+D+VY
Sbjct: 168 DSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

Query: 372 Q 372
            
Sbjct: 228 D 228

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           +P +L  I  G NPTG  LS E   QI+++A K+  +++ D+ Y    FP
Sbjct: 239 RPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPYGYLKFP 288

>TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON}
           Anc_5.287 YHR045W
          Length = 621

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 383 SMKKILRHLQREHPGKFDNVQL--ASLHSTSKGVSGECGQR 421
           +MKKI+ H+Q+ H   FDN +L  A+L   S G+  +CG+R
Sbjct: 403 NMKKIIDHIQKSHTNIFDNFRLNWATLL-FSYGIFSKCGER 442

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 58/143 (40%), Gaps = 5/143 (3%)

Query: 231 RKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTAT 290
           R S     T  D+  IS+ + +  T GA A  + LLS+F       V IP P +P +   
Sbjct: 98  RDSCPRGATFLDQNRISFVQTLSGT-GALAVASKLLSLFM---SRSVWIPNPSWPNHANV 153

Query: 291 LALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVV-INPGNPTGAVLSPE 349
              N  + + YY     G       I+ + K A +    P  +V+     NPTG   S E
Sbjct: 154 FQNNGFKEINYYSYYKDGSLDIEGWIQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKE 213

Query: 350 SIAQIFEVAAKYGTVVIADEVYQ 372
              +I +   +   + I D  YQ
Sbjct: 214 QWQRILDKIHELNLIPIIDMAYQ 236

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 76/184 (41%), Gaps = 20/184 (10%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +F T     ++        T    A  
Sbjct: 63  AIKEAQRALEI--PLVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 263 NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLD----ENSGWSTN 312
           + L+ +   G E  V++  P +  Y   + L+  + +      P  LD    +   W  +
Sbjct: 121 SILIGLLNPGDE--VIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQID 178

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
            + ++  +        K   +++  P NP G V +   + ++ ++  K   V+I+DEVY+
Sbjct: 179 WDSLQAAMNS------KTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYE 232

Query: 373 ENIF 376
              F
Sbjct: 233 HLYF 236

>KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.329
           YDR308C
          Length = 141

 Score = 34.7 bits (78), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 2/48 (4%)

Query: 186 LNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKS 233
           +N  +Q+LVD +  KL+AIK+ +SL++D+ G +  + S  G+   RKS
Sbjct: 94  INSLQQKLVDVEEQKLEAIKKKESLLKDVNGLIETFVS--GIAESRKS 139

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           KP +L  I+ G NP G  LS E   +I+++A ++  +++ D+ Y    FP
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFP 272

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 305 ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTV 364
           E + W  + + +   + E      K   +++ +P NP G V + E + ++  +  + G  
Sbjct: 194 EGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIY 247

Query: 365 VIADEVYQENIF 376
           +I+DEVY+   F
Sbjct: 248 IISDEVYEHLYF 259

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQA---LPYYLDENS 307
           D+ L  G+S A   ++   C   ++ V + + ++  ++ TLA+  +     +P  LD  +
Sbjct: 155 DVTLANGSSDATFKIIETLC---DSSVTVLVEEF-TFSPTLAIITAAGGTTVPLKLDITA 210

Query: 308 G---WSTNPEEIETVVKEAIQNE----IKPTVLVVINPG-NPTGAVLSPESIAQIFEVAA 359
                  N E +  ++    Q       KP +L  I  G NPTG  LS E   QI+ +A 
Sbjct: 211 DPDVQGINVEYLTDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQIYALAE 270

Query: 360 KYGTVVIADEVY 371
           K+  ++I D+ Y
Sbjct: 271 KHDFIIIEDDPY 282

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 74/181 (40%), Gaps = 34/181 (18%)

Query: 221 YSSSQGVEGIRKSVAEFITKR----DEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           Y   +G + +R ++A F         E   + PE I LTAGAS  V  +L      P TG
Sbjct: 52  YGPDEGSKWVRTAIAAFSNDCFQLPSEEMKTKPEHINLTAGASYGVMNILEQTTL-PHTG 110

Query: 277 ----VLIPIPQYPLYTATL----------ALNN-----------SQALPYYLDENSGWST 311
                 I  P Y L   T           A++             Q L Y+   +S  + 
Sbjct: 111 YTRQAFIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYF---DSISND 167

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEV 370
           N  E++ +       ++   V+ ++    NP G   S E+  ++ E+A K+  ++++D+V
Sbjct: 168 NSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDV 227

Query: 371 Y 371
           Y
Sbjct: 228 Y 228

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 15/79 (18%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKI 387
           KPT++  +  G NPTG  LS E   QI+ +A ++  +++ D+ Y     P          
Sbjct: 241 KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPYGYLRLP---------- 290

Query: 388 LRHLQREHP--GKFDNVQL 404
             H  RE P   K+D + +
Sbjct: 291 --HFNRETPSENKYDGITV 307

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILR--HLQR---E 394
           NP+G   + E+  ++ E+A KY  +++AD+VY    +      S + I R  HL R   E
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVYDMLDYEQNVDKSPQPIKRFVHLDRETNE 264

Query: 395 HPGKFDNV 402
            P  F N 
Sbjct: 265 DPNSFGNT 272

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 43/184 (23%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDE----GEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           Y+ S+G   + + V + +++ +      E+    D+ L+ G++ ++  +    C    T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 277 VLIPIPQYPLYTATLALNNSQA---------LPYYLDENS-------------GWSTNPE 314
           VLI       +T T A++N +A         +   LD +S              WST P 
Sbjct: 161 VLIE-----EFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGP- 214

Query: 315 EIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQE 373
                     ++  KP VL  I  G NPTG  +      +I+ +A K+  +++ D+ Y  
Sbjct: 215 ---------YKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGY 265

Query: 374 NIFP 377
             FP
Sbjct: 266 LYFP 269

>TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.475
           YKL106W
          Length = 426

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 5/132 (3%)

Query: 242 DEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY 301
           +EG +S+ + +  T GA A  + LL++F       V I  P +P +      N    L  
Sbjct: 109 EEGRVSFAQTLSGT-GALAVASKLLALFL---SRTVWISEPSWPNHQNIFRSNGFTDLRT 164

Query: 302 YLDENSGWSTNPEEIETVVKEAIQN-EIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           Y    +G     E +E +  E  ++ E + ++++     NPTG   + E   +I +   +
Sbjct: 165 YPYYQNGRLVVDEWLEKLKTEVRKDPETRHSIILHACCHNPTGLDPTREEWVRILDTVHE 224

Query: 361 YGTVVIADEVYQ 372
            G + I D  YQ
Sbjct: 225 LGMIPILDMAYQ 236

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
           Anc_2.102 YHR137W
          Length = 493

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           KP ++  I  G NPTG  LS E   QI+ +A K+  +++ D+ Y
Sbjct: 204 KPKMIYTIATGQNPTGMTLSMEKRRQIYALAQKHDLLILEDDPY 247

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHS 383
           NP+GA  S E   ++ ++A +Y  ++I+D+VY    F G +  S
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 339 GNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
            NP+G   S E+  ++ ++A KY  ++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>KLTH0D00836g Chr4 complement(79191..79817) [627 bp, 208 aa] {ON}
           similar to uniprot|Q08873 Saccharomyces cerevisiae
           YOR367W
          Length = 208

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 349 ESIAQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRHLQREHPGKF 399
           E I+Q    A +YG  V  DE++Q     E   P T + ++K + R+  ++HP +F
Sbjct: 99  EQISQFLSFARQYG--VPEDELFQTVDLYEEKDPATVYQALKSLSRYANKKHPHQF 152

>Kwal_26.6795 s26 complement(66701..67327) [627 bp, 208 aa] {ON}
           YOR367W (SCP1) - Calponin homolog [contig 44] FULL
          Length = 208

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 349 ESIAQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRHLQREHPGKF 399
           E I+Q    A +YG  V  DE++Q     E   P   + S+K + R+  ++HP KF
Sbjct: 99  EQISQFLAFARQYG--VPEDELFQTIDLYEEQDPAIVYQSLKSLSRYANKKHPQKF 152

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           NP+G   S E+  ++ E+A KY  +VI D+VY 
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVYD 235

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 67/141 (47%), Gaps = 21/141 (14%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQA-----LPYYLDE 305
           D+ L+ G++ ++  +   FC    T V+I       +T T A++N +A     +P  ++ 
Sbjct: 184 DVILSGGSNDSMYKVFETFC-DESTTVMIE-----EFTFTPAVSNVEATGATVVPIKINL 237

Query: 306 NSGWSTNPEEIETVVKEAIQNEI--------KPTVLVVINPG-NPTGAVLSPESIAQIFE 356
           ++   T   +++  + + ++N          KP VL  I  G NPTG  +      +I+E
Sbjct: 238 SADRETQSVDVD-YLSQLLENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYE 296

Query: 357 VAAKYGTVVIADEVYQENIFP 377
           +A ++  +++ D+ Y    FP
Sbjct: 297 LAQRHDFLIVEDDPYGYLYFP 317

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 74/351 (21%), Positives = 134/351 (38%), Gaps = 59/351 (16%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRD-EGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG- 276
            Y S  G   +R+ +A F  ++      + PE + LT+GAS  + N LL      P TG 
Sbjct: 52  TYGSDLGALWVREQIARFNNEKIFHVNHTKPEFLNLTSGASYGILNVLLQTSL--PHTGY 109

Query: 277 ---VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTN-------------------PE 314
                I  P Y L                +DE  G   +                    E
Sbjct: 110 TKQAFIVTPTYFLINDCFIDAGFGGKLTAIDETMGDEYDLNLELLETNLKSFAEEEDEKE 169

Query: 315 EIETVVKEAIQNEIKPTVLVVI----NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEV 370
            I  + ++ I  E K     V+       NP+G   S ++  ++ E+A +Y  ++I+D+V
Sbjct: 170 SISCIQRDKIGVENKKIYRFVMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDV 229

Query: 371 YQENIFPGTKF-----HSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYM 425
           Y  ++    +F     H  K+ + HL RE     +N    +L + +       G R GY 
Sbjct: 230 Y--DLLDYEQFLDVLPHVPKRFV-HLDRETSTHPENSFGNTLSNATFSKIIAPGLRFGYT 286

Query: 426 ELTGFSHEMRQVILKLA-----SISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480
           E         +++L+L+     +    P      +V  M++  +        D+   N +
Sbjct: 287 ESIS-----NKLVLQLSRGGANTSGGTPSQLNSMIVGTMLKNGL-------VDKVLHN-L 333

Query: 481 HEKLITRAMTLYETFNSL--EGIECQKPQGAMYLFPKIDLPFKAVQEARHL 529
            +    R++ +YE+         +CQ  +G  + +  + L + AV+  + L
Sbjct: 334 RQTYKERSVVMYESIKRWLPRKTQCQLQKGGYFTWITLPLGYDAVEIGKML 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,582,993
Number of extensions: 2727050
Number of successful extensions: 8878
Number of sequences better than 10.0: 155
Number of HSP's gapped: 9143
Number of HSP's successfully gapped: 155
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)