Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR088W (GAA1)8.261ON61461431700.0
Smik_12.1478.261ON61361428880.0
Skud_12.1568.261ON61261528270.0
Suva_10.1728.261ON61461527640.0
SAKL0H17050g8.261ON58461419250.0
TDEL0F038808.261ON57961418930.0
ZYRO0C01672g8.261ON56961718820.0
TBLA0F030808.261ON58360918360.0
NCAS0B038608.261ON58360318270.0
CAGL0L12232g8.261ON59161418230.0
Kpol_543.378.261ON57861318150.0
AGR087C8.261ON57761317850.0
Ecym_43098.261ON57761317800.0
NDAI0J013908.261ON58360817680.0
Kwal_56.238048.261ON57861717530.0
KLTH0G13706g8.261ON58460117420.0
KLLA0F19118g8.261ON57861517380.0
KNAG0H032508.261ON58562017210.0
KAFR0B055508.261ON55558517070.0
TPHA0A018208.261ON58161616130.0
Kpol_397.68.366ON58582780.84
TPHA0E014205.301ON111873751.8
Kwal_26.71547.86ON121344752.2
ZYRO0D08492g6.329ON584117715.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR088W
         (614 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...  1225   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...  1117   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...  1093   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...  1069   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   746   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   733   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   729   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   711   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   708   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   706   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   703   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   692   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   690   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   685   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   679   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   675   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   674   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   667   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   662   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   625   0.0  
Kpol_397.6 s397 (19242..20999) [1758 bp, 585 aa] {ON} (19242..20...    35   0.84 
TPHA0E01420 Chr5 complement(287481..290837) [3357 bp, 1118 aa] {...    33   1.8  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    33   2.2  
ZYRO0D08492g Chr4 complement(733481..735235) [1755 bp, 584 aa] {...    32   5.8  

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score = 1225 bits (3170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/614 (97%), Positives = 601/614 (97%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF
Sbjct: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXXX 540
           PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATP             
Sbjct: 481 PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVLL 540

Query: 541 ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF 600
           ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF
Sbjct: 541 ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF 600

Query: 601 ESKSVVVRSKEKQS 614
           ESKSVVVRSKEKQS
Sbjct: 601 ESKSVVVRSKEKQS 614

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/614 (87%), Positives = 573/614 (93%), Gaps = 1/614 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIA LPV+SM+CALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYRSQI+EMVNMTSMERNN+MGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLAVPWFNSDD+FN+GGAALGVSLARFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P AALRSWVEAYHTSLDLTGGSIEAAVV+DYSS EDFFEYVEISYDGLNGELPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLP DQLT NN+WSRLK+LCLGIRDWAL+GVK PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AVALS+AFAISSLNAFINN YA+IS+FSEYNLVALLVWF+SLVISFVVSQ FLL+PS+GL
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LM ISM SCFLPLILS+K+HISEPLSYRLKNVAFLYFSLV TSLLMINFAMALLIGTLAF
Sbjct: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXXX 540
           PMT VKTI+ESS EHEV+ +    IKTEPK+E EL+EN+ D  P                
Sbjct: 481 PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGK-SQQRQELKNLLLL 539

Query: 541 ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF 600
           +LTNPFISIT+FG FFDDEF GFD+INKLVSAWLDLKCWSWFVLCIGWLPCWLL+LASSF
Sbjct: 540 VLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599

Query: 601 ESKSVVVRSKEKQS 614
           ESK V+++SKEKQS
Sbjct: 600 ESKRVMLKSKEKQS 613

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/615 (86%), Positives = 569/615 (92%), Gaps = 4/615 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIALLPVIS LCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWN+LRGYRSQI+EM NMTS ERNN MGSWLQEFGTKTAIYE++QYGETL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNSDDEFN+GGAALGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSS EDFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLP DQL NN+FWSRLKIL LGIRDWALSGVK PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AVA S+AFAISSLNAFINNAYA+ISLFSEYNLVALLVWF+SLV+SF++SQ FLL+PS GL
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LMTIS+A+CFLPL+LS K+HISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIG+LAF
Sbjct: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480

Query: 481 PMTFVKTI-VESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXX 539
           PMTF++TI V  S+EHE+ T+S   +KTE +D  +L E+H DT                 
Sbjct: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRD--DLFEHHGDTV-LEKAKKRQQLKNLLL 537

Query: 540 XILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599
            +LTNPFISITLF L FD+EFHGFDI+NKL+SAWLDLKCW+WFVLCIGWLPCWLLILASS
Sbjct: 538 LVLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASS 597

Query: 600 FESKSVVVRSKEKQS 614
           FES+SVVV+SKEKQS
Sbjct: 598 FESRSVVVKSKEKQS 612

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/615 (84%), Positives = 564/615 (91%), Gaps = 2/615 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRR+VDMGLVPR+IALLPVIS LCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQI+E VNMTS ERNNLMGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNS+ EFN+GGA+LGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P AALRSWVEAYHTSLDLTGGSIEAAVVLDYSS EDFFEYVE+SYDGLNGELPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AISI EHEGMKVSLHGLP +QL +N+F+SRLKILCLGIRDWALSGVK PHGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AVALS+AFA+SSLNAFINN YA+ISLFSEYNLVA+LVWF+++V+SFV+SQ FL +  +GL
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LMTIS+A CFLP+ LS K+HISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF
Sbjct: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFVKTI-VESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXX 539
           PMTF+KTI VE  +E E  T+S+  IKTEP DE +L +++ + T                
Sbjct: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGT-LEKNQQRQKLKNLLL 539

Query: 540 XILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599
            ILTNPFISIT+FGL FDDEF GFDIINKLVSAW+DLKCWSWF+LC+GWLPCWLLILASS
Sbjct: 540 LILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILASS 599

Query: 600 FESKSVVVRSKEKQS 614
           FESKSVVV+SKEKQS
Sbjct: 600 FESKSVVVKSKEKQS 614

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/614 (59%), Positives = 464/614 (75%), Gaps = 41/614 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MAL+EKLHRR +DMGL+P+ IALLP +S+ CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWN+LRGYR+QI+     ++ ERN  + SWLQ+FG KTAIY NE+YGET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LYG++HAPRGDGTEAMVLA PW+NS++++N GG AL VSL+RFFSRWPVWSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239
           +P+AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299
           +A+ ITEHEGMKVSLHG+  ++L  N+F+SR+K + LG+++ ALSG+KK HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418
           P+AVALS++FA++SLN  +NN Y ++ L S YN+ ALL + V+L +SF+ +QAFL  P  
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+++++    +P+I +R + I  P SYRLK+ A+LYFS+V TSLL++NF++A  +G L
Sbjct: 421 ELLLSLNVLLLLMPIIFTR-VKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFPMT V+T             +S  ++   K+ + L                       
Sbjct: 480 AFPMTLVRT-------------TSGNLRARLKNCVLL----------------------- 503

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
             +++NPFI+I LF +  D E  G  +   L SAW DL CW+WFV+CIGWLP WLL+  S
Sbjct: 504 --LISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYS 561

Query: 599 SFESKSVVVRSKEK 612
             +S S+VV   EK
Sbjct: 562 GIDSVSIVVPQDEK 575

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/614 (57%), Positives = 466/614 (75%), Gaps = 38/614 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+L+ KLHRR++D+GLVP+I+A LP++SML A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWN LRGYR+QI+ + N TS ERN  +  WL+EFG KTAIY++E++G+TL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV+HA RGDGTEA++LA PW N+D   N+ G ++G++L RFFSRWPVWSKNIIVV SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P+ ++RSWVEAYHTSLDLTGGSIEAAVVLDY    D+F++VEI YDGLNGE PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AISITEHEGMKVSLHG+  D++++N+FWSRL I+  GI++ ALSG++K +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419
            AV LSI+FA++SL+A INN Y  + L S YNL++L +W +SL+  F ++Q FL   +  
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 LLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479
           +L++ S    FLPL+L +K  I+EPL+YRLK+VAFL+FSLV TSLLM+NF +A  +G  A
Sbjct: 421 ILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 480 FPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXX 539
           FPMT V+T          ++ ++  ++ + K+ I L                        
Sbjct: 479 FPMTLVRT----------SSLNNYSLRIKLKNSILL------------------------ 504

Query: 540 XILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599
            +L+NPFI+  +F   F+ +  GF +  +  +AW +L CW+WFV+CIGWLP WL++  S+
Sbjct: 505 -LLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALST 563

Query: 600 FESKSVVVRSKEKQ 613
             ++   +  ++K+
Sbjct: 564 LNTQPAQLDDRKKK 577

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/617 (58%), Positives = 455/617 (73%), Gaps = 52/617 (8%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E+L RR+V+MGLVP+IIALLP++SM+CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYRSQI+    +++ ERN  M  WLQEFG KT+IY NE+YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG++HA RGDGTEA++LAVPW+N++ + N+GGA+LG+SL+RFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+VLDY  T D+F+Y EISY GLNGELPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           A+SITEHEG+ VSLHG+  + + + ++WSRLKIL  GI   A +G++   GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSG--HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           QSVT+KAHG  G  +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418
           P+ V L+  FA++SLN+ + N Y+N+S +S YNL ALL W VS+++SFV SQ FL +PS+
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+   +    LPL   R   I+EPLS+RL+  AFLY SLV TSL+M+NF +A ++G L
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFPMT             V TQ S   K                                
Sbjct: 481 AFPMT------------AVGTQRSLTFKK-----------------------------YA 499

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
             I++NP +S      FF  + H   ++ KL+SAW DL CW+WFVLC+GWLP W LI  S
Sbjct: 500 LLIISNPLVS------FFIVKPHP-QLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALS 552

Query: 599 SFESKSV--VVRSKEKQ 613
           +  S ++  V  SK++Q
Sbjct: 553 ACSSTNLDPVATSKKEQ 569

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/609 (58%), Positives = 454/609 (74%), Gaps = 39/609 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALL  +HRR++DMGLVP+I+  LP++S+  A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYR++I    +M S +RN +M  WL+EFGTKT++Y N++YG+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLA+PW+N+D EFN GGAALG++L+RFFSRWP+WSKNIIVVFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVEI Y G+NGELPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AI ITEHEGM+VSLHGLP + L  NN++SRL+ L LG +D  LSG+K  HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTLKAH---GNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           Q++TLKA     N+ HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPS 417
           LPSAV  S+AFAISSL+++INN+Y+ + +FSEYNL+A L++ +S+  SF V++  LL   
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 SGLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
             LL+  S+    LP +L  +  I EPLSYRLK++AFLY SLV TSLL++NF++A  IG 
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXX 537
           L F MT VKTI         T  SS  ++         V N M                 
Sbjct: 481 LGFAMTAVKTI---------TIHSSMRVR---------VRNTMH---------------- 506

Query: 538 XXXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILA 597
              +L+NPF S+ LF   FD + +G  I  + + +W  L CW+WF++C+GWLP W+L+  
Sbjct: 507 --LLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSI 564

Query: 598 SSFESKSVV 606
           SS ++ +V+
Sbjct: 565 SSIQTNTVM 573

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/603 (58%), Positives = 452/603 (74%), Gaps = 35/603 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E++ R+++  GL+P++I+LLP+IS LC + G + I ILP +GQYR TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNI+RGYRSQI E+ N +++ERN +M  WLQ+FGTKT IY+N + G+TL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV HAPRGDGTE+MVLA+PWFN+D EFN+ GAALGV+LAR+FSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P+AALRSWVEAYHTSLDLTGGSIEAA+VLD++   D F+Y+EI YDGLNGELPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
            +   EHEGMKVSLHG P D++  +  +SRLKIL   I++ ALSGVKK +GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+A G +G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419
           S VA+SI FA++SLN++ NN Y  +  FS Y L+++L WFVSLV++F+VS  F+  P   
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 LLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479
           +L+ +++  C  P IL     + + LSYRL++ AFL+ SL+ TSLLM+NF +A  +G L+
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 480 FPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXX 539
           FPMT VKTI         T+ +    +T  K+ + L                        
Sbjct: 481 FPMTQVKTI---------TSDTPTISRTRVKNSVLL------------------------ 507

Query: 540 XILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599
            +++NPFI+  LF L  D+EF G D+  +LVSA  +L CW+W VLC+GW   WLL+  S+
Sbjct: 508 -LVSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISA 566

Query: 600 FES 602
            ++
Sbjct: 567 LDT 569

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/614 (57%), Positives = 468/614 (76%), Gaps = 37/614 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP +S L  +   + +AILP+DGQYRRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQI+ + + +  +RN ++  WLQE G KTA+YE+E++G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV+HA RGDGTEAMVLA+PW N DD+FN+GGAALGVSL++FF RWPVWSKNIIVVFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAAVVLDY S  DFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP +++ N ++++RLKI+ +GI++WALSGVK+ HGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+AHGN G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419
           SAV +S+AFA+ SL++ INN Y +I   S   LV  ++   S+ +SF++S+  +++P   
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 420 LLMTISMASCFLPLILSRK-IH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
            L+  S+A  FLPL++S+K IH I++ ++YRLK++  +Y+SL+ TSLLM+NFA+  +IG 
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXX 537
           LAFP+T +  I            S+  I  E +  I  ++N                   
Sbjct: 481 LAFPLTKLAVI------------STKTIADESRKSI--LKNTF----------------- 509

Query: 538 XXXILTNPFISITLFGLFFDDEFHG-FDII-NKLVSAWLDLKCWSWFVLCIGWLPCWLLI 595
               +TNPFIS+ LF    D +F+G F +I N+++++W  L CW+WF++C+GWLP WL+ 
Sbjct: 510 -ILFITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWLIS 568

Query: 596 LASSFESKSVVVRS 609
           + SS  S+ +V R+
Sbjct: 569 VISSIPSQPIVERT 582

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/613 (54%), Positives = 447/613 (72%), Gaps = 37/613 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M++LE L RR++D GL+P+ +A LP +SML      + +  LPMDGQ+RRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYR +I+ + + +S+ERN +M SWL+EFG KT++Y+N++YG++L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLAVPW+N++DEFN+ GAALGVSLARF SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           PR ALRSWVEAYHTSLDLTGGSIEAAVVLDY    D+FEY+E+ Y+G NG LPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  D++ N ++WSRLK++ LG ++ AL+GV++ +GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G++ HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AV LSI+FA++S+++F+NN Y ++   S YNL++ + W VS+++ F +  +F   P   L
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           L+  ++    +PL   + + ISEPL+YRLK ++F+Y SLV TSLL++NF +A  +G  A+
Sbjct: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480

Query: 481 PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXXX 540
           PMT             V   +++ ++ + ++ I L                         
Sbjct: 481 PMTL------------VMLNNTDNLRLKTRNSILLA------------------------ 504

Query: 541 ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF 600
            ++NPFI+  LF    + +  G + I  LV AW  L  W+WF+ CIGW P W+L+  S+ 
Sbjct: 505 -ISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISAL 563

Query: 601 ESKSVVVRSKEKQ 613
           + + V      K+
Sbjct: 564 KVEQVQTEPNSKK 576

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/613 (54%), Positives = 443/613 (72%), Gaps = 40/613 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHR++VDMGLVP+II  L  IS +  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRESEWNILRGYRS+I  M  +T+ ERN ++ SW++E+G K A+Y ++++GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LY V+HA RGDGTEAMVLA PW   + ++N GG AL V++ R+FSRWPVWSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV+AYHT LDLTGGSIEAA+VLDY  T D+F++VEISY+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299
           +A+ ITEHEGMKV+LHG P ++L  + ++SR+++L  GI+D ALSG+K+  GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418
           P+AV LSI+FA+ + ++ +NN +A++ L S YN+ ALL + V+L++S + ++ F  +P+ 
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+  ++   F+P  L  K  I +P S+R K  A+LYFS V +SLL++NF +A ++G L
Sbjct: 421 ALLLAFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFPMTFV+T V +S   ++                                         
Sbjct: 480 AFPMTFVRTTVHASVRQKMKNSLLL----------------------------------- 504

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
             +L+NPFISI +F   F+ E  GF +   L+ AW DL CW+W+VLC+GW P W+++  S
Sbjct: 505 --LLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYS 562

Query: 599 SFESKSVVVRSKE 611
           S +S  +   +K+
Sbjct: 563 SIDSVPIAAPAKK 575

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/613 (54%), Positives = 441/613 (71%), Gaps = 40/613 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHRRIVDMGLVPRIIA LP IS+ CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRESEWNILRGYR +++ + ++   ERN ++ SW++E+G KT+I  N QYGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LYG++H  RGDGTEAMVLA PW  +D  +N GGAAL +SLAR+F+RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239
           +P+A+LR+WV+AYHT LDLTGGSIE+AVVLDY  T D+F+Y+EI Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299
            A+ I+EHEGMKVSLHG+P  +L+ + +  RLK L  GI+D  L+G+K   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418
           P+A+ALS +FAI+S ++ +NN Y+ + L S YN+ AL  + V+L+ISFV ++AF  +P  
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+  ++A  F+   +  K  I +P SYR K  A LYFS+V TSLL++NFA+AL +G L
Sbjct: 421 SLLLAFNVALSFISFTVI-KYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFPM+  KT   ++ + ++            ++ + L+                      
Sbjct: 480 AFPMSLTKTTTNATMQQKL------------RNSLLLMS--------------------- 506

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
               +NPFI+  +    F+ +  G  + + L+ AW  L CW+W+VLCIGW P W+L+  S
Sbjct: 507 ----SNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYS 562

Query: 599 SFESKSVVVRSKE 611
           S +S  +V  SK+
Sbjct: 563 SIDSIPIVTTSKK 575

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/608 (57%), Positives = 438/608 (72%), Gaps = 42/608 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M LLE++ R IV  GL+P+I+A LP IS++      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNI+RGYR+++  M N TS ERN +M SWL EFG KT IYEN    E L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV HAPRGDGTEA+VLAVPWFN D EFN  GAA+GV+LAR+FSRWPVWSKNIIVVFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P +ALRSWVEAY+TSLDLTGGSIEAA+VLD     D+F+Y+E+ YDGLNGELPNLDLVNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
            I I EHEGM+VSLHG P DQ+  NN+W+RLKIL   I+  A SG+ K HGNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  GNSG  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419
           SAV LS+AF I+ ++++INN    +  FS Y L+  +VW V+LV  F+++Q FL++P   
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 420 LLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479
           LL+ I++      +I+  K      +S RL++ AFL+ SL+ TSLLM+NF ++ +IG +A
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 480 FPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXXX 539
           FPMT V++I  +               T P+ ++E +                       
Sbjct: 480 FPMTKVRSITAN---------------TAPQIKLENI---------------------IL 503

Query: 540 XILTNPFISITLFGLFFDDE----FHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLI 595
            +++NPFI++ ++     +       G  +IN+L+SAW D++CW+WFVLC+GWLP W+++
Sbjct: 504 LMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMV 563

Query: 596 LASSFESK 603
             S  E++
Sbjct: 564 AISVIENE 571

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/617 (55%), Positives = 444/617 (71%), Gaps = 43/617 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFG-FISIAILPMDGQYRRTYISENALM 59
           MAL+E+L R+++D+GL+PRI+  LP +S+LC + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWNILRGYR+QI+ + N +S+ERN ++GSWLQEFG KTA+YE+E  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LYGV+HAPRGDGTEAMVL+ PWFN D EFN GG AL V+LAR+FSRWPVWSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239
           +P+A+LRSWV+AYHTSLDLTGGSIE+AVVLDY    DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299
           +AI +TEHEGMKVSL+G+P D++ N ++++R+K + +GI+  ALSGV++ +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ+V L+A G+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418
           P+AVA S++F +++L+  +    +        N+ A++ + V+L+ SF VS  F      
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            +L++ S+ +   P++L+R + I    ++RLK VA+LY S+V TSLL++NFA+A  IG L
Sbjct: 421 VILISWSVMTALAPILLNR-VRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLL 479

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFP+  VK                                   TTP              
Sbjct: 480 AFPLILVKN---------------------------------STTPRL------LFKNSL 500

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
             +L+NPFIS  LF  FF+    G  I+ +LV AW +  CW+W V+CIGWLP WLLI  S
Sbjct: 501 LLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYS 560

Query: 599 SFESK-SVVVRSKEKQS 614
           S  +  S ++ S EK+S
Sbjct: 561 SMITDVSTLLNSAEKKS 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/601 (55%), Positives = 432/601 (71%), Gaps = 42/601 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAIL-PMDGQYRRTYISENALM 59
           MAL+EKL RRI+D+GL+PRI+  LP +S+LC + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWNILRGYR+QI+ +   +S ERN ++ SW QEFG KTA YE++ +G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           +YGV+HAPRGDGTEAMVLA PW+N D E+NIGGAAL  +L+RFFSRWPVWSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV AYHTSLDLTGGSIE+AVVLDY  + DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299
           +A+ ITEHEGMKVSL+G+  +++   N++S++K + +G++  ALSGV+  +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418
           P+AVA S++F +++L+  + +  +N   FS +NL A++ + V+L++SF +S  F     S
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL++ +     LP I  R+  I    SY+ K+VAFLY S+V TSLL+INFA+A  IG L
Sbjct: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFP+  VK  + S              +   K+ I L                       
Sbjct: 480 AFPLILVKAPMTS--------------RQRVKNTILL----------------------- 502

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
             IL+NPFIS  LF   F+ +  G  + ++LV AW  L CW+W V+CIGWLP WLL+  S
Sbjct: 503 --ILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560

Query: 599 S 599
            
Sbjct: 561 G 561

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/615 (53%), Positives = 437/615 (71%), Gaps = 40/615 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIA-ILPMDGQYRRTYISENALM 59
           MAL+EKLHRRI+ +GL+P+ I+ L  +S+LC + G   +  +LP DGQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNM-TSMERNNLMGSWLQEFGTKTAIYENEQYGE 118
           PSQAYSYFRESEWNILRGYR+Q+     + T+ + N  +  WLQEFG KTAIY++EQYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFS 178
           TLYG+ HAPRGDGTEAMV+A PW+N + E+N GGAAL +SL RFFSRWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLV 238
           E+P+A+LRSWV AYHTSLDLTGGSIE+A+VLDY  T D F+Y+EI YDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGW 298
           N+A+ I EHEG+KVSLHGLP  +L  N++ SRLK + LGI+D  LSG+K  +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPS 417
           L +AVA+S+AF  ++LN  +NN Y  + L S YN+ ++L + +SLV +F  SQ F+  P 
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 SGLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
             +L+ +S     LPL+   ++ I EP SYR K  A++Y ++V TSLL++NF++A+++G 
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXX 537
           LAFPMT   TI+ES+            ++   K+ + L                      
Sbjct: 481 LAFPMTRTTTIIESN------------LRLSIKNLVLL---------------------- 506

Query: 538 XXXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILA 597
              I++NPFI+      F +    GF +   L+ A   L CW+W+++C+GW P WLL+  
Sbjct: 507 ---IISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTY 563

Query: 598 SSFESKSVVVRSKEK 612
           +S ++  V    K++
Sbjct: 564 ASIDAIEVQTPIKKE 578

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/620 (55%), Positives = 445/620 (71%), Gaps = 42/620 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E L R+ V +GL+P+++A LP++S L A+   + I I+PM+GQYR TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVN---MTSMERNNLMGSWLQEFGTKTAIYENEQYG 117
           SQAYSYFRE+EWNILRGYR++I E++N   +++ +R +++  WL EFG KTA+Y NE+ G
Sbjct: 61  SQAYSYFRETEWNILRGYRTEI-EVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 118 ETLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVF 177
           +TLYGV+HAPRGDGTEAMVL  PW NS+ EFNIGG+AL ++L+R+FSRWPVWSKNIIVVF
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 178 SENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDL 237
           S+NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDY S  D+F Y EI ++GLNGELPNLDL
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 238 VNIAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSG 297
           VN+A+ IT+HEGMKVSLHGLP  +L  NN+WSRLK+L LG++D  L+G+KK HGNE FSG
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 298 WRIQSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           WRIQ+VTLKA G    DITTFGRIPEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSY
Sbjct: 300 WRIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSY 359

Query: 358 LPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPS 417
           LPSAV LSI FAI++++A +NNAYA+ +L   Y L+A L   +SL++SF+V+  FL   +
Sbjct: 360 LPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYSTT 418

Query: 418 SGLLMTI-SMASCFLPLILSRKIH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLI 475
           S L + + S+     PL++SR  + + EP+ YR++ + ++Y+SL+ TSLLM+NF +A  I
Sbjct: 419 SPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSI 478

Query: 476 GTLAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXX 535
           G   +PMT VK                 P+    K ++ L                    
Sbjct: 479 GLFGYPMTLVK-----------------PLNIYSKSQMSL-----------------KLR 504

Query: 536 XXXXXILTNPFISITLFGLFFDD-EFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLL 594
                +++NPF++  L     ++ EF   D+   L SAW DL CW+WFVLC+GWLP WLL
Sbjct: 505 NSVLLVISNPFVATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLL 564

Query: 595 ILASSFESKSVVVRSKEKQS 614
           +  SSF S      + EK+S
Sbjct: 565 VTFSSFTSIPAAETTIEKKS 584

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/585 (58%), Positives = 426/585 (72%), Gaps = 44/585 (7%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L+E++ R++  MGLVP++   LP+ S + AL   ISIAILP+DGQYR TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYR+Q++ MV++   ERN++M +WL + G KT  + N     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG+ H+PRGDGTEA+VLA+PW NS+ +FN GGAALGVSLARFF RWP+WSKNIIVVFSE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
             A+LRSWVEAYHTSLDLTGGSIEAAV+LDY+S  DFF+YVEI YDGLNGELPNLDLVNI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP ++L   + WSR K+L   I+D +L+G+KKPHGNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G  G DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AV LS+AFA SSL  F+N+   +I   S Y L A++VWF+S+  SF  +  +L      +
Sbjct: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416

Query: 421 LMTISMASCFLPLILSRKIHISE---PLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
           LM I +   F+PLI SR + ++E    +++R+K  AF YFSLV TSLLMINF +AL IG 
Sbjct: 417 LMFICILFSFIPLI-SRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXX 537
           LAFPMT VK               SN + T      + ++N M                 
Sbjct: 476 LAFPMTLVKI--------------SNTLPTSS----QALKNSM----------------- 500

Query: 538 XXXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWF 582
              +++NP+ISI  F   FD E  G   +++L+ AW D+ CW+WF
Sbjct: 501 -LLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/616 (50%), Positives = 428/616 (69%), Gaps = 38/616 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E LHRR   +GL+P++I  L ++S +  L     I  LP+DGQYRRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYR+ I+ +++  +  RN ++ SWL +FG K A+Y+N   G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV ++ RGDGTEA+VLAVPW+N+D+E NIGGAALG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240
           P  A++SWV+AYH SLDLTGGS+EAA+VLD+ S  ++FE+VE+ ++G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300
           AIS+ EHEG+KVSL GL   ++  +++++RLK L  G+++ ALSG +K +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420
           AV LSI+F IS+ +++INN Y  + L    +++AL+++F S+ ISF+  Q         L
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 421 LMTISMASCFLPL--ILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
           ++   +   FLPL  I    I I   LSYRLK+ AF+Y SLV TSLL++NFA+A  +G L
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPXXXXXXXXXXX 538
           AFP+TF K      S  E+ T  S  I                                 
Sbjct: 481 AFPLTFTK------SCSEMITFKSKVINC------------------------------F 504

Query: 539 XXILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598
              ++NPFI+I +F   F+D+   F++ + L+S++  +  W+W + CIGW   W ++  +
Sbjct: 505 YLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIA 564

Query: 599 SFESKSVVVRSKEKQS 614
           + ++    +    K++
Sbjct: 565 NLDTPRSALDGDTKKN 580

>Kpol_397.6 s397 (19242..20999) [1758 bp, 585 aa] {ON}
           (19242..20999) [1758 nt, 586 aa]
          Length = 585

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 450 KNVAFLYFSLVSTSLLMINFAMALLIGTLAFP---MTFVKTIVESSS-----EHEVTTQS 501
           K VA+    L + S L++NF +  L+G L F        ++ VE SS     EH+    +
Sbjct: 140 KGVAYSCIFLTAQSFLLMNFGLWRLVG-LDFKNAKKNDTESTVEDSSTSSEAEHKFVPST 198

Query: 502 SNPIKTEPKDEIELVENHMDTT 523
             PI+++ K+   L ENHM+ T
Sbjct: 199 QVPIQSKSKNNDYLGENHMEHT 220

>TPHA0E01420 Chr5 complement(287481..290837) [3357 bp, 1118 aa] {ON}
           Anc_5.301 YDR291W
          Length = 1118

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 44  MDGQYRR--TYISENALMPSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWL 101
           +DG  ++  T ISEN   P+  YS+F      +       +K+M+N   +  NN +  ++
Sbjct: 147 IDGNMKKNWTTISENLNDPNNKYSHFNNYAKKVFHYSSEDLKKMINKRELHFNNRLIDFI 206

Query: 102 QEFGTKTAIYENE 114
            +   K    ENE
Sbjct: 207 NKCTEKNLNPENE 219

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 207  VVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNIAISITEHEGM 250
            ++LD+   +D++ Y+E +  G +G +   DL+ +   +TEHE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>ZYRO0D08492g Chr4 complement(733481..735235) [1755 bp, 584 aa] {ON}
           similar to gnl|GLV|CAGL0K09218g Candida glabrata
           CAGL0K09218g and some similarites with YCR061W
           uniprot|P25639 Saccharomyces cerevisiae YCR061W Protein
           of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 584

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 10/117 (8%)

Query: 129 GDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARF--FSRWPVWSKNIIVVFSENPRAALR 186
           G G     L   W      F +G     VSLAR+    +   W+ N I+V  +  R+   
Sbjct: 296 GKGARIFNLLAHWIKGGVFFVLGL----VSLARYCGVGKGHGWAWNKIIVKRDPLRSRSS 351

Query: 187 SWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNIAIS 243
           +W   +     +T   IE+ ++  Y ST  F E++     G  G     DL +++I+
Sbjct: 352 AWKRFFSPRGTITMEGIESFLIFFYGSTNVFLEHLA----GAGGAWTAKDLQHVSIA 404

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,928,586
Number of extensions: 2599850
Number of successful extensions: 7211
Number of sequences better than 10.0: 34
Number of HSP's gapped: 7344
Number of HSP's successfully gapped: 47
Length of query: 614
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 498
Effective length of database: 40,180,143
Effective search space: 20009711214
Effective search space used: 20009711214
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)