Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR087C (CSF1)8.260ON29582958153770.0
Smik_12.1468.260ON29582958144710.0
Skud_12.1558.260ON29592959141960.0
Suva_10.1718.260ON29582959139760.0
NCAS0B050108.260ON2952297091360.0
NDAI0B019808.260ON2959296787810.0
KAFR0B027208.260ON2982300384620.0
CAGL0L12210g8.260ON2981300183410.0
KNAG0G020308.260ON2998301080550.0
TDEL0F038708.260ON2942298578330.0
ZYRO0C01694g8.260ON3006304471590.0
Kpol_392.78.260ON2995302270180.0
TBLA0E044208.260ON3148257862270.0
TPHA0J007308.260ON3046288857860.0
SAKL0H17072g8.260ON2997304257690.0
KLTH0G13728g8.260ON2966301650440.0
Kwal_YGOB_56.238088.260ON2941300649440.0
Kwal_56.23810singletonOFF2763279845390.0
Ecym_43108.260ON2943304941280.0
AGR088W8.260ON2887152121090.0
KLLA0F19096g8.260ON2923158821100.0
Kwal_56.23808singletonOFF62601583e-12
TBLA0D004207.418ON287580769.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR087C
         (2958 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  5927   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  5578   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  5472   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  5388   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3523   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3387   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3264   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  3217   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3107   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  3021   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2762   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2707   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2403   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2233   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2226   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1947   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1909   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1753   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  1594   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   816   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   817   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    65   3e-12
TBLA0D00420 Chr4 complement(96949..105576) [8628 bp, 2875 aa] {O...    34   9.0  

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 5927 bits (15377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2881/2958 (97%), Positives = 2881/2958 (97%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
            KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240

Query: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300
            FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI
Sbjct: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300

Query: 301  DRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360
            DRGKVSKLWKTFVRVFQI            SAGTSDDNFYHKWKGLSLYKASAGDAKASD
Sbjct: 301  DRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360

Query: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480

Query: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540
            IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF
Sbjct: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540

Query: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL
Sbjct: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960
            SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020
            DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020

Query: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY
Sbjct: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYG                 
Sbjct: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200
                YIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA
Sbjct: 1141 DTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200

Query: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN
Sbjct: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320
            LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320

Query: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620
            VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK
Sbjct: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620

Query: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740
            IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL
Sbjct: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740

Query: 1741 VTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800
            VTAITEIRESLMMI             SQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH
Sbjct: 1741 VTAITEIRESLMMIKERIKFKPKSKKKSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860
            EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI 1920

Query: 1921 NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980
            NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI
Sbjct: 1921 NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980

Query: 1981 KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
            KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD
Sbjct: 1981 KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040

Query: 2041 LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM 2100
            LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM
Sbjct: 2041 LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM 2100

Query: 2101 LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160
            LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK
Sbjct: 2101 LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160

Query: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNX 2220
            RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDN 
Sbjct: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNS 2220

Query: 2221 XXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN 2280
                          PFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN
Sbjct: 2221 YASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN 2280

Query: 2281 CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340
            CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK
Sbjct: 2281 CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340

Query: 2341 PSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQ 2400
            PSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQ
Sbjct: 2341 PSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQ 2400

Query: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFN 2460
            PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFN
Sbjct: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFN 2460

Query: 2461 VKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTN 2520
            VKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTN
Sbjct: 2461 VKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTN 2520

Query: 2521 VSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580
            VSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANAS
Sbjct: 2521 VSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580

Query: 2581 WLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGV 2640
            WLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGV
Sbjct: 2581 WLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGV 2640

Query: 2641 LPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPI 2700
            LPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPI
Sbjct: 2641 LPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPI 2700

Query: 2701 LYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTD 2760
            LYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTD
Sbjct: 2701 LYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTD 2760

Query: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820
            LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE
Sbjct: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820

Query: 2821 KTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXX 2880
            KTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQT     
Sbjct: 2821 KTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELE 2880

Query: 2881 XXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQ 2940
                       FNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQ
Sbjct: 2881 ESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQ 2940

Query: 2941 KLVYLAEKQYVKILDDTH 2958
            KLVYLAEKQYVKILDDTH
Sbjct: 2941 KLVYLAEKQYVKILDDTH 2958

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5578 bits (14471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2667/2958 (90%), Positives = 2794/2958 (94%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILT+V CLTM+FYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
            K+KINVETLRVSLLGGRIHFK+LSVIHKDYTIS+LEGS+TWKYWLLNCRKAELI+NNKS 
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120

Query: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            S    KLPCK  +ECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASI+NDRDYQETDIGKHP+ L FLPIEL FSRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240

Query: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300
            FTPSVMILSYESG+GI+DVLPPKER+DLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK+
Sbjct: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360
            D GKVSKLWK F+RV Q+            +  +S+D+FY KWKGLSLYKA++G+AKA+D
Sbjct: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360

Query: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDD+EFDLTNHEYAKFTSILKCPKVTI+YDVDVPGVVPHGAHPTI DIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRR+YTLFRMNIS
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480

Query: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540
            I EDTTWRIPTRE+SKD EFL+HYKET+EEYRPFGWMDLRFCKDTYANFNISVCPTV+GF
Sbjct: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540

Query: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            QNNFHVHF+ETEIRSSVNHDILLKSKVF+IDGDIGYPLGWNSKAIWIINMKSEQLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDKL+IDVTVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFTIKG+YLLYSELDIDNVDTLVIEC S STVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAR+VGDVTTKSSV DLASTVDSGYQNSS+KN SE KGPMKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVW+GALILPETIYSFDPCIALHF+ELVVDFRSCNYYMDIMAVL+GTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900

Query: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960
            SKQINEVFDFIRRNNGADEQEHG LSDLTIHGHRMYGLPPTEPTYFCQWDINLGDL IDS
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020
            D+EFIKGFF+SFYKIGFGYNDLENILLYDTETI+DMTSLTVH E+IRI L+DPVMKSQSV
Sbjct: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020

Query: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            ISAESILFTLIDFENE YSQRIDVK+PKL ISLNCVMGDGVD SFLKFETKLRFTNFEQY
Sbjct: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQR+YIT HDSPYHRC FLLPLFYQDSDTYQ LYG                 
Sbjct: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200
                +IIEDIVGEYATLLE  NPFK+ FAETPST+EPS+ASF+EDDNDEEA  S FKP A
Sbjct: 1141 DTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200

Query: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTED + E+DNYVVDVSYILLD+DPLLF+F KSLLEQLYSENMVQVLDDIEIGIVKRLSN
Sbjct: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320
            LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQM EKSLEKNRT KLLEVAAL
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320

Query: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            A+VKTVRVTVNQKKNPDLSEDRPPALSLG+EGFE+WSSTE RQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLF+YCSDQ NL+QEV TSF+SIQ+TR++SKTELIS+LTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ+NID+VLKE+KYTSA DAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF+ +NEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620
            VADANLVVDLTPPVTSL  NREETIEITGR+GSVKGKFSDRLLKLQDLIPL+AAVGEDDK
Sbjct: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620

Query: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SDPK ELSKQF+MNTVLLVDKSELQLVMD+TKLMSRTVGGRVSLLWENLKDSTSQAGS+V
Sbjct: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680

Query: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740
            IFSQKSEVWLKH S+ILGEAQLRDFS+LATTEAWSHKPTILINNQCADLHFRAMSSTEQ 
Sbjct: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740

Query: 1741 VTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800
            VTAITEIRES + I             SQFV QKINTVL+CYFSNVSSE+MPLSPFYIRH
Sbjct: 1741 VTAITEIRESALKIKERIKFKPKSKKKSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860
            EAKQLDIYFNKFGSNEIL+SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG+S+EGYSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLL SLK LFFSSN+PKKEKQ P++MI
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQVPALMI 1920

Query: 1921 NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980
            NWTLDTSI+YFG+L+PVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI
Sbjct: 1921 NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980

Query: 1981 KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
            KERSLPIGLSK+LDFSIKVSTLQRT+DTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD
Sbjct: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040

Query: 2041 LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM 2100
            L HYY++ HAPNIWN KMFTGKSDK KE+P+NFRSIHILSYKFCIGW+FQYG GS+PGLM
Sbjct: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM 2100

Query: 2101 LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160
            LGYNRLFSAYE+DFGKFTVVD+FFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK
Sbjct: 2101 LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160

Query: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNX 2220
            RCGELKDWFFRFHGEALDVNFVPSFMDVI+STLQSMRAFQELK+NILDVSE+  +E+ N 
Sbjct: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI 2220

Query: 2221 XXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN 2280
                          PFL+NIRSVNSNFKYDGGVFRVYTYEDIE KSEPSFEIKSPVVTIN
Sbjct: 2221 YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN 2280

Query: 2281 CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340
            CTYKHDEDKV+PHK RTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK
Sbjct: 2281 CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340

Query: 2341 PSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQ 2400
            PS QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFS+ TNEFDSE 
Sbjct: 2341 PSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEH 2400

Query: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFN 2460
            PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLT+LFTHPDVISMYG GLVSDL+VFFN
Sbjct: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFN 2460

Query: 2461 VKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTN 2520
            VKQLQNLYLFLDIWRFSSILHTRP QR+VNK I+M SLTST++ D GTEIPWCFTLIFTN
Sbjct: 2461 VKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTN 2520

Query: 2521 VSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580
            VSGDVDLGPSLG+ISLRTQRTWLATDHY+EKRQLLHAFTDGISLTSEGRLSGLFEVANAS
Sbjct: 2521 VSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580

Query: 2581 WLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGV 2640
            WLSEVKW PEK KNTHPLVSTSLNIDD+A+KAAFDYHMFLIGTI+NIHF LHNEKDAKGV
Sbjct: 2581 WLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGV 2640

Query: 2641 LPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPI 2700
            LPDLLQVSFSSDEIILSSTALV ANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP+
Sbjct: 2641 LPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPV 2700

Query: 2701 LYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTD 2760
            LYKDILRSLKLLRTDLSV+ISS KVQISPISLFDVEVLV+RIDKVSIRSETHSGKKLKTD
Sbjct: 2701 LYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760

Query: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820
            LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE
Sbjct: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820

Query: 2821 KTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXX 2880
            KTNNLEYLFACSFSDKISVRWNLGPV+FIKEMWTTHVKALAVRRSQ+ANISFGQT     
Sbjct: 2821 KTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELE 2880

Query: 2881 XXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQ 2940
                       FNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRK+FPKFTHQTAVIPVQ
Sbjct: 2881 ESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ 2940

Query: 2941 KLVYLAEKQYVKILDDTH 2958
            KLVYLAEKQYVKILDDTH
Sbjct: 2941 KLVYLAEKQYVKILDDTH 2958

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 5472 bits (14196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2634/2959 (89%), Positives = 2770/2959 (93%), Gaps = 1/2959 (0%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            MEAISQLRGVPLTHQKDFSWVFLVDWILTVV+CLTMIFYMGRIYAYLV+FILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
             IKINVETLRVSLLGGRIHFK+LSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNK S
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
              K  KLPCK S+ECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE FSDG
Sbjct: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASI+NDRDYQETDIGK PK L FLPIELKF+RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240

Query: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300
            FTPSVMILSYE+G+G+IDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK+
Sbjct: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360
            D GKVSKLWKTFVRV +I              G SDD+F+ KWKGLSLYKA+ GDAK SD
Sbjct: 301  DTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPSD 360

Query: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDD+EFD TNHEYAKFTSILKCPK+TIAYDVDV G VPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRT+KP+KKLPPGSRRIYTLFRMN+ 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480

Query: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540
            IMEDTTWRIPTRE+SKD EFL+HYKET+EEYRPFGWMDLRFCKDTYANFN+ +CPTV+GF
Sbjct: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540

Query: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            QNNFHVHF+ETEIRSSVNHDILLKSKVF++DGDIGYPLGWNSKAIWIINMKS+QLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAG+PTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGD+L ID+TVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFT+KGSYLLYSELDIDNVDTLVIEC S STVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAREVG++ TKSSV DLAST+DSGYQNSSLKNESEDK P+KRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVW+GALILPETIYS DPCIALHF ELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960
            SK INEVFDFIRRNNGA+EQEHG LSDLTIHGHRM+GLPPTEPTYFCQWDINLGDL IDS
Sbjct: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020
            DIEFIKGFFNSFYKIGFGYNDLENILLYDTET++DMTSLTVH E+I+I   DPVMKSQSV
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020

Query: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            ++AES+LFTLIDFENE+YSQRIDVKIPKL ISL+CVMGDGVDTSFLKFETKLRFTNFEQY
Sbjct: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQRRYIT HDSPYHRCPFLLPLFYQDSDTYQ LYG                 
Sbjct: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200
                +IIEDIVGEYATLLETTNPFK+IFAETPST+EPSRAS +EDDNDE ADP  FKP+A
Sbjct: 1141 DTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200

Query: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTE RNH+R NYV+DVSYILLDVDPLLF+F KSLL++ YSE+MVQVLDDIEIGIVK+LSN
Sbjct: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320
            LQEGITSISNID+HIAY+NLIWQETGEEGFELYLDRIDYQMSEKSLEKNRT+KLLEVA L
Sbjct: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320

Query: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            A++KTVRVTVNQK+NPDLSEDRPPALSLG+EGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLFEYCSDQGNLIQE   SF+SIQ+TR +SKTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ NI++VLKE+KYTSAKDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF+ +N +HKQNL+KKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620
            +ADANLVVDLTPPVTSL  NREETIEITGRVGSVKGKFSDRLLKLQDLIPL+AAVG  DK
Sbjct: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620

Query: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SD K ELSKQFKMNTVLLVDKSE+QLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740
            IFSQKSEVWLKH S+IL EAQLRDFS+LATTEAWSHKPTILINNQCADLHFRAMS+TEQ 
Sbjct: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSTTEQT 1740

Query: 1741 VTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800
            VT ITEIRES++ I             SQFV  KIN VLSCYFSNVSSE+MPLSPFYIRH
Sbjct: 1741 VTVITEIRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860
            EAKQLDIYFNKFGSNE+LLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGIS+E YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLP-KKEKQAPSIM 1919
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLL SLK L F+S LP KK+K+AP+ M
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARM 1920

Query: 1920 INWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFL 1979
            INWTLDTSITYFG+LVPVASTYFVFELHMLLLSLTNTNNGMLPEE KVTGQFSIENILFL
Sbjct: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980

Query: 1980 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2039
            IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL
Sbjct: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040

Query: 2040 DLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGL 2099
            DL HYYSRRHAPNIW+ KMFTGKSDK KE+PINFRSIHILSYKFCIGW+FQYGAGS+PGL
Sbjct: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100

Query: 2100 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWF 2159
            MLGYNRLFSAYEKDFGKFTVVDAFFSVANGN SSTFFSEGNEKDKYNRSFLPNMQISYWF
Sbjct: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160

Query: 2160 KRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDN 2219
            KRCGELKDWFFRFHGEALDVNFVPSFMDVI+STLQS+RAFQELKKNILDVSE    E+DN
Sbjct: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220

Query: 2220 XXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTI 2279
                           PFLDNIRSVNSNFKYDGGVFRVYTY+DIE KSEPSFEIKSPVVTI
Sbjct: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280

Query: 2280 NCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFT 2339
            NCTYKH+E++ KPH+ R LI VDPT NTLYAGCAPLLMEFSESLQKMIKKHSTD+KP+FT
Sbjct: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340

Query: 2340 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSE 2399
            KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSM TNEFDSE
Sbjct: 2341 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2400

Query: 2400 QPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFF 2459
            QPLEFSLTL+ TKASI+HIFSREVSTSFEVGFMDLTLLFTHPDVISMYGT LVSDLSVFF
Sbjct: 2401 QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF 2460

Query: 2460 NVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFT 2519
            NVKQLQNLYLFLDIWRFSSILHTRPVQ +++KEI+MSSLTSTNY D G EIPWCFTLIFT
Sbjct: 2461 NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT 2520

Query: 2520 NVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579
            NVSGDVDLGPSLG+ISLRTQRTWLATDHY+EKRQLLHAFTDG+SLTSEGRLSGLFEVANA
Sbjct: 2521 NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA 2580

Query: 2580 SWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKG 2639
            SW+SEVKW  EKSKN+HPLVSTSLNIDD+AVKAAFDYHMFLIGTI+NI F LHNEKDAKG
Sbjct: 2581 SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG 2640

Query: 2640 VLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699
            +LPDLLQVSFSSDEI LSSTALV ANILDIYNTIVRMRQDNKISYMETLRDSNPGES+QP
Sbjct: 2641 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP 2700

Query: 2700 ILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKT 2759
            ILYKDILRSLKLLRTDLS+NISS KVQISPISLFDVEVLV+RI  VSIRSETHSGKKLKT
Sbjct: 2701 ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT 2760

Query: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDY+HYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2761 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE 2820

Query: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXX 2879
            EKTNN+EYLFACSFSDKISV+WNLGPV+FIKEMWTTHVKALAVR+SQ+AN+SFGQT    
Sbjct: 2821 EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEEL 2880

Query: 2880 XXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPV 2939
                        FNYIALEEPQI+VPQIRDLGDATPPMEWFGVNRK+FPKFTHQTAVIPV
Sbjct: 2881 EESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2940

Query: 2940 QKLVYLAEKQYVKILDDTH 2958
            QKLVYLAEKQYVKILD TH
Sbjct: 2941 QKLVYLAEKQYVKILDGTH 2959

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5388 bits (13976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2585/2959 (87%), Positives = 2745/2959 (92%), Gaps = 2/2959 (0%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILTV+ CLT IFYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
            KIKINVETLR+SLLGGRI+FK+LSVIHKDYTIS+LEGSLTWKYWLLNCRKAELIEN K+S
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            SGK  +LPCK  +ECEGLE FIYNRT+AYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSD+SI+NDRDYQET+IGK+PK L F PIELK +RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240

Query: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300
            FTPSVMILSYE+G+GIIDVLPPKERLDLYRNKT +E KNFEISIKQNIGYDDAIGLKFK+
Sbjct: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360
            D GKVSKLWKTFVRV ++             AG SDD F+ KWKGLSLYKASAGDAK SD
Sbjct: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGK-KAGPSDDAFFQKWKGLSLYKASAGDAKTSD 359

Query: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDD+EFD T+HEYAKFTSILKCPKVT++YDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRR+YTLFRMNI 
Sbjct: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479

Query: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540
            IMEDTTWRIPTRESSKD EFL+HYK+T+EEYRPFGWMDLRFCKDTYANFNISVCPTV+GF
Sbjct: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539

Query: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            +N+FHVHF+ETEIRSSVNHDILLKSKVFD+DGDIGYPLGWNS  IWIINMKSEQLEAFLL
Sbjct: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGDPTPYELFRPFVYK+NWEM+GYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659

Query: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDKL+ID+TVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719

Query: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            +YDFTIKG YLLYSELDIDNVD+L I C S STVLHCYGFVMRYL NVKMNYFGEFFNFV
Sbjct: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779

Query: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAREVG+V TKSSV DLAST+DS YQN S+KN++ED GPMKRSDLKRTTNE
Sbjct: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNE 839

Query: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVW+GALILPETIYSFDPCIALHF ELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 840  TDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 899

Query: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960
            SKQINEVFDFIRRNNGADEQEHG+LSDLTIHGHRMYGLPPTEPTYFCQWDINLG+L I+S
Sbjct: 900  SKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINS 959

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020
            DIEF+KGFF SFYK+GFGYNDLENILLYDTETINDMTSLTVH E+I I L DPVMKSQS+
Sbjct: 960  DIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI 1019

Query: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            +S ES+LFTLIDFENE+YSQRID+K+PKLT+SL+CVMGDG +TSFL FETKLRFTNF QY
Sbjct: 1020 VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQY 1079

Query: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXX 1140
            KD DKKRSEQRRYI ++DSPYHRCPFLLPLFYQDSDTYQ LYG                 
Sbjct: 1080 KDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1139

Query: 1141 XXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200
                YIIEDIVGEYATLLE TNPFK++FAETPST+EP RASF+EDD++E ADP  FKPVA
Sbjct: 1140 DTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADPLEFKPVA 1199

Query: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTE+ NHERDNYV+DVSYILLD+DPLLF+F KSLLEQ YSE+MVQVLDDIEIGIVKRLSN
Sbjct: 1200 FTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSN 1259

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320
            LQEGI SISNIDIH+AYLNLIWQETGEEGFELYLDRI+YQMSEKSLEKNRT+K LEVA L
Sbjct: 1260 LQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVL 1319

Query: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            AKVKTVR TVNQKKNP+LSEDRPPALSLG+EGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1320 AKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1379

Query: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLFEYCSDQGNLIQEV TS NSIQNTRS++KTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1380 MEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPA 1439

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ+NID+VLKE+KY+ AKDAKNIFMSVF
Sbjct: 1440 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVF 1499

Query: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF A++ KHK N IKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1500 STWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1559

Query: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620
            VADANLVVDLTPPVTSL SNREETIEITG+VGSVKGKFSD+LLKLQDLIPL+ AV EDDK
Sbjct: 1560 VADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDK 1619

Query: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SDPK ELSKQFKMNTVLLVDKSE+Q+VMD+TK+MSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1620 SDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLV 1679

Query: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740
            IFSQKSEVWLKH S ILGEAQL DFS+LATTEAWSHKPTIL+NNQCADLHFRAMS+TEQ+
Sbjct: 1680 IFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQM 1739

Query: 1741 VTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800
            V AITEI+ES++ +             SQFV  +INTVLSCYFSNVSSE+MPLSPFYIRH
Sbjct: 1740 VNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRH 1799

Query: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860
            EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG S+E YSLIN
Sbjct: 1800 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN 1859

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLL SL  LF +++    +K+ P+ MI
Sbjct: 1860 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKETPAKMI 1919

Query: 1921 NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980
            NWTLDT+I+YFG+LVPVASTYFVFELHMLLLSLTNTNNG+LPE+T++TGQ SIENILFLI
Sbjct: 1920 NWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLI 1979

Query: 1981 KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
            KERSLPIGLSKLLDFSIKVSTLQRT DTEQSFQVESSHFRVCLSPDSLLRL+WGA+KLLD
Sbjct: 1980 KERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLD 2039

Query: 2041 LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM 2100
            +  YYS+RHAPNIWN +MFTGKSDK KE+PINFRSIHILSYKFCIGW+FQYGAG +PGLM
Sbjct: 2040 MVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLM 2099

Query: 2101 LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160
             GYNRLFSAYEKDFGKFT+VDAFFSV+NGNTSSTFFSEGNEK+KYNRSFLPNMQISYWFK
Sbjct: 2100 FGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFK 2159

Query: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNX 2220
            RCGELKDWFFRFHGEALDVNF+PSFMDVI+STLQS+RAFQELKKNILD+      EN + 
Sbjct: 2160 RCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSP 2219

Query: 2221 XXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN 2280
                          PFLDNIRSVN NFKYDGGVFRVYTY+DIE KSEPSFE+KSPVVTIN
Sbjct: 2220 DAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTIN 2279

Query: 2281 CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDE-KPNFT 2339
            CTYKHDE K KPH+ RTLITVDPTHNTLYAGCAPLLMEFSESLQ MIKKHST E KPNFT
Sbjct: 2280 CTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFT 2339

Query: 2340 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSE 2399
            KPS+QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSM TNEFDSE
Sbjct: 2340 KPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2399

Query: 2400 QPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFF 2459
            QPL FSLTLE TKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGT LVSD+SVFF
Sbjct: 2400 QPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFF 2459

Query: 2460 NVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFT 2519
            NVKQLQNLYLFLDIWRFSSILHTRP QR  NKE+ MS+L+S +  D GTEIPWCFTLIFT
Sbjct: 2460 NVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFT 2519

Query: 2520 NVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579
            N+SGDVDLGPSLG+ISLR+QRTWLATDHY+EKRQLLHAFTDGISLTSEGRLSGLFEVANA
Sbjct: 2520 NLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579

Query: 2580 SWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKG 2639
            SW+SEVKWP E SKNTHPLVSTSLNIDD+AVKAAFDYHMFLIGTI+NI FHLHNEKD+KG
Sbjct: 2580 SWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKG 2639

Query: 2640 VLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699
            +LPDLLQVSFSSDEI LSSTALV ANILDIYNTIVRMRQDNKISYMETLRDSNP ES+QP
Sbjct: 2640 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQP 2699

Query: 2700 ILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKT 2759
            ILYKDILRSLKLLRTDLSVNISS KVQISPISLFDVEVLV+RIDKVSIRSETHSGKKLKT
Sbjct: 2700 ILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759

Query: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2760 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819

Query: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXX 2879
            EKTNNLEYLFACSFSDKISVRWNLGP++FIKEMWTTHVKALAVRRSQ ANISFGQT    
Sbjct: 2820 EKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEEL 2879

Query: 2880 XXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPV 2939
                        FNYIALEEPQIEVPQIRDLG+ATPPMEWFGVNRK+ PKFTHQTAVIPV
Sbjct: 2880 EESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPV 2939

Query: 2940 QKLVYLAEKQYVKILDDTH 2958
            QKLVYLAEKQYVKILDDTH
Sbjct: 2940 QKLVYLAEKQYVKILDDTH 2958

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3523 bits (9136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1667/2970 (56%), Positives = 2202/2970 (74%), Gaps = 37/2970 (1%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M+A+SQ +GVPLT Q++FSW+FLV WILTV++ L+ IFY+GR  AY+++FILEWLLWK A
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIE----- 115
            K+K+N+++LR+SLLGGRI FKN+++IHKD TIS+LEG++TW+YWL N RK E  E     
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 116  -NNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFP 174
               K +S K  +LPC+  V  EGLEIF+YN+TVAYDN+I + SK+ER +FEK+LNE    
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176

Query: 175  EPFSDGSSADKLDE---DLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFS 231
            +  SD ++   +D+   D SES  T  S++S  NDR +QE +       L FLPI+   +
Sbjct: 177  QILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDT-SSFLRFLPIQFLVT 235

Query: 232  RGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYD 291
            RGSL+LGNKFTPS++I+S +S   ++D   PKE+LDLY+ K   E  N E ++KQNIG+D
Sbjct: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295

Query: 292  DAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKA 351
            + + +KFK+DRGKVS++W  F R+  I                 +D F  KW+GL+LYK 
Sbjct: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355

Query: 352  SAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGP 411
            +    + +D+DD+EFD  NHEYAKF+SILK PKVT     D+PG+VPHGAHPTI  +DGP
Sbjct: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415

Query: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRI 471
            DVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRTAKP+K+L PG RRI
Sbjct: 416  DVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRI 475

Query: 472  YTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNI 531
            YT  ++ ++IM+D TWRIPTRESSKD EFL+HY+ETN EYRPFGW+DL+F K+T  N   
Sbjct: 476  YTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTF 535

Query: 532  SVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMK 591
            ++CPTV GF+NN  +H  E E RSSVNHDILLK K FD D D  +PLGWN +A W IN+ 
Sbjct: 536  ALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLN 595

Query: 592  SEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651
            S Q+EAF+LREHITL+ADTL+DFS+G+PTPYELFRPF+Y +NW+++GYS+YLNVNDHNIV
Sbjct: 596  SSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIV 655

Query: 652  NNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNE 711
            NNPLDFNENCYLS HGD+LS+D  +P+ SI   +TD+SY I TPMFR++LNTPPWNTLNE
Sbjct: 656  NNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNE 715

Query: 712  FMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMN 771
            FMKHKEVGR+YDF + GSYL+YS+LDIDNVDT++++C SK T L CYGFV+RYL NVKMN
Sbjct: 716  FMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMN 775

Query: 772  YFGEFFNFVTSEEYTGVLGAREVG-DVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMK 830
            YFG+FF+FVTSEEYTG + A E      ++S     + +     Q +           ++
Sbjct: 776  YFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLHTELQ 835

Query: 831  RSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAV 890
            RSDLKRTTNETD+WFTF+VW+GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYMD++A 
Sbjct: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895

Query: 891  LNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWD 950
            +N  SIKR+VSK  +E+F+ I +NNG +   HG LS LTIHGHRMYGLPP EPTYFCQWD
Sbjct: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955

Query: 951  INLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGL 1010
             +LG L I SDIEF++GFF+SF +IGFGY DLENILLY+ ET +DMTS+TV++EK+ + L
Sbjct: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015

Query: 1011 KDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFET 1070
            ++P +   +     ++ FT IDFENEKYS R+D+ IP L  SL     DG        ET
Sbjct: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075

Query: 1071 KLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXX 1130
            K++ TNF Q +D D+ R  QR YI +HD+PYHRC F+LP  YQD++ YQ L+G       
Sbjct: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSS 1135

Query: 1131 XXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEE 1190
                          +IIED++GE+  LLET++PF+  F++     +      S+D+ +E+
Sbjct: 1136 LPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSD-----QDYATDVSDDETEED 1190

Query: 1191 ADPSSFK-PVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDD 1249
             DP  F  P    ++   ERD++++DVS+I +++ P +     + L    +EN+VQ++DD
Sbjct: 1191 IDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQIIDD 1250

Query: 1250 IEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKN 1309
            IEI  V RLSNL+EG   ++N+ I+I YL+L W    + G  +YLDRID+ M EK++E+N
Sbjct: 1251 IEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEEN 1310

Query: 1310 RTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNL 1369
            +  KL+E+  L K+++VR TVNQ      +E+RPPALSL IEG+E+WSST + QVNSLN+
Sbjct: 1311 KEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNI 1370

Query: 1370 TSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQI 1429
             S+DIT+DE+Q+EWLF Y  +QG  IQ++  + ++IQ  +  S+ ELIS LTAASEYYQI
Sbjct: 1371 LSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQI 1430

Query: 1430 SHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKK-YTS 1488
            SHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW S I+  L + K   +
Sbjct: 1431 SHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAAT 1490

Query: 1489 AKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTV 1548
             +DAK IF+SVFS WRNWEFSD+ARSYIY KLF  ++   + +  KK +   + SF++TV
Sbjct: 1491 TQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTV 1550

Query: 1549 YGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDL 1608
            Y  GYEVEHNF++   NL+++   P +    +RE    ITG +G+ KGK SD+++ +++L
Sbjct: 1551 YSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNL 1610

Query: 1609 IPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWEN 1668
            +P +  + +  KS    +  K FK+NT++L ++ ELQ+ +  T+L+SR  G R+S+LWE+
Sbjct: 1611 LPSL-KITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWES 1669

Query: 1669 LKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCAD 1728
             KD TSQA SL +++Q++E+ LKH +  L E Q+RDFS++ TTE+WS+KPTIL+N+QC+D
Sbjct: 1670 PKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSD 1729

Query: 1729 LHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQ----KINTVLSCYFS 1784
            LH  AM++T+ LV +I EI E++  I             ++        K+NT+L+C+F+
Sbjct: 1730 LHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFT 1789

Query: 1785 NVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGD 1844
            N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNEILLS+WD D ++TSH TK+QY RFSFGD
Sbjct: 1790 NISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGD 1849

Query: 1845 IEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFF 1904
            +++KG +  + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I    +L  LF 
Sbjct: 1850 LQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLD-LFG 1907

Query: 1905 SSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEE 1964
             S   K + +  +   +W++DT+I YFG+L P+ S YF+FEL MLL SLT   +  +P +
Sbjct: 1908 LSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD-IPNQ 1966

Query: 1965 TKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLS 2024
            + ++GQFS+EN+LF IKER+LP+ LSKLLDFSIKVS LQ+  +T  ++Q+ESSHFRVCLS
Sbjct: 1967 SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLS 2026

Query: 2025 PDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFC 2084
            P+SL+RL+W  +++     YY   H  N W+ +       K+ ++P+N  S HILSY FC
Sbjct: 2027 PESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFC 2086

Query: 2085 IGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDK 2144
            +GW+F   + S PGL+LGYNRLFSAYEK+ GK T+VD FFS+ANGN+S  FFSEG EKDK
Sbjct: 2087 VGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDK 2146

Query: 2145 YNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKK 2204
            YNRS+LPNMQISYWFK  G ++D F RFHGEALDV F+ S++DVIES L S++ FQELKK
Sbjct: 2147 YNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKK 2206

Query: 2205 NILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIET 2264
            +++      +  ND+               PFL NIRS++  FKYDGGVF++++ ED ET
Sbjct: 2207 DLIPGLPKKQKVNDD------KTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAET 2260

Query: 2265 KSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQ 2324
            +SEPSFE+ SP V I+  YKH E++ K H  R+LI ++ THN LYA CAPLL +F E +Q
Sbjct: 2261 QSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQ 2320

Query: 2325 KMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGF 2384
             M+KKHS+ E+   +KPSSQN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAKVQAD+GF
Sbjct: 2321 GMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGF 2380

Query: 2385 ESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVI 2444
            +SF+F++ TN+ D+ +PL FSL++E T+ASIKHIFSRE STS  V F+D+TL+FTHPDVI
Sbjct: 2381 QSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVI 2440

Query: 2445 SMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYA 2504
            +++GT L+S++++FFNVKQLQNLYLFLDIWR S +L ++P    V  + + SSL+    +
Sbjct: 2441 NVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQLS 2499

Query: 2505 DAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISL 2564
            D  + IPWCFTLIFTNV GDVDLGPSLG+IS++ +RTW ATDHY   R++LHAFTDG SL
Sbjct: 2500 DPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSL 2559

Query: 2565 TSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTI 2624
            +S+GRLSG+FE+  ASW+SEV WP + + N HPLVS ++NID+I+ KAAFDYHMFLIG I
Sbjct: 2560 SSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAI 2619

Query: 2625 SNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISY 2684
            +N   HLH+EKD  GV+PDLL+V+F  + I L STALV ANILDIYNT +RMRQDNKISY
Sbjct: 2620 NNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISY 2679

Query: 2685 METLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDK 2744
            +ETLR+SN  ES+ PI Y DILRSL LL+TD+SV+I +  +QISPI+LFDVEVLVI I+ 
Sbjct: 2680 IETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIES 2739

Query: 2745 VSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTI 2804
            +S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YASKIVGGTI
Sbjct: 2740 ISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTI 2799

Query: 2805 IDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRR 2864
            I+IPKL V MTT QEEK++ LEYL+ C F DK+SVRWNLGP++FIKEMWTTH++A+AVRR
Sbjct: 2800 IEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRR 2859

Query: 2865 SQVANISFGQTXXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNR 2924
            SQV  +  GQ+                F Y+ALE P+I++PQIRDLGDATPPMEWFGVNR
Sbjct: 2860 SQVVGVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNR 2919

Query: 2925 KKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            K+FP FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2920 KRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3387 bits (8781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1616/2967 (54%), Positives = 2190/2967 (73%), Gaps = 30/2967 (1%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M+AISQ + +PLT QKDFSWVFLVDWIL ++V L +IFY+ R  AY +SFILEW LWKR+
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNK 118
             +KIN+E++R+S LGGR+ FKN+ +IH+DYTIS LE ++TW+YWLLN RK+  +  E   
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 119  SSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFS 178
             +S    KLPC+  +E EGLEIF+YNR VAYDN+I   SK+ER++FEK+LNE  F +  +
Sbjct: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180

Query: 179  DGSSAD-KLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLL 237
            + S+++   +ED  ESA T  SD+S  NDR +QE ++ + P+ L FLPI+ K S GSL++
Sbjct: 181  EVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGSLII 239

Query: 238  GNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297
            GNKFTPS+MI S  S  G+IDV  P E+LDLY+ +  ++FK F I IKQNIG+++   +K
Sbjct: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299

Query: 298  FKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAK 357
            FKIDR +VSK+W+ F +V               +  + +D FY KW+GLSLY+ +     
Sbjct: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 359

Query: 358  ASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNG 417
              D++D++FD  NHEYAKF+SI++ P+    ++ D+PG+VPHGAHPT+   DGPDVGN+G
Sbjct: 360  NDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSG 419

Query: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRM 477
            APP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR AKP K+L PG  RIYT F+ 
Sbjct: 420  APPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKT 479

Query: 478  NISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTV 537
             IS  E+TTWRIPTRESSKDPEFL+HY+ETNEEYRPFGW+DL+F KDTY    ++ CPT 
Sbjct: 480  TISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTK 539

Query: 538  QGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEA 597
            +GF+N   +H  + EIRSSVNHDILLK K F+   DIG+PLGWN +A W I+++S QLEA
Sbjct: 540  EGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEA 599

Query: 598  FLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657
            F+LREHITL+ADTL+DFS+G+PTPYELFRPFVY++NW++ GYS+YLNVNDHNIVNNPLDF
Sbjct: 600  FILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDF 659

Query: 658  NENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKE 717
            NENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK+KE
Sbjct: 660  NENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKE 719

Query: 718  VGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFF 777
            VGR++DF I GSYL+YSELDIDNVDT++IEC+S+STVL CYGFV+RYLTNVKMNYFG+FF
Sbjct: 720  VGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFF 779

Query: 778  NFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDS--GYQNSSLKNESEDKGPMKRSDLK 835
            +FVTSEEYTG + A EV +  T   + +  +++ S    + SS++ E      +KRSDLK
Sbjct: 780  HFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRSDLK 839

Query: 836  RTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTS 895
            R TNETD+WFTF+VW+GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A +N  S
Sbjct: 840  RATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDIS 899

Query: 896  IKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGD 955
            ++R++ KQ NE+++ +R++NG   +++G LSD+ IH HRMYGLPP EPTYFCQWD +LG 
Sbjct: 900  LRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGT 959

Query: 956  LCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVM 1015
            L ++ DI F++GF  SF KI FG  DLENILLY+ E I+DMTSLTV V+KI I +++  M
Sbjct: 960  LDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEM 1019

Query: 1016 KSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFT 1075
             +  + +AE + F+ I+FENEKY  R+D++IP   + +  + G   +  F +FETK+  +
Sbjct: 1020 DTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKVNLS 1078

Query: 1076 NFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXX 1135
            NFE+  DI   +S+Q+ YIT+HD+PYHRC F+LP   QDS+ YQ+L+G            
Sbjct: 1079 NFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLP 1138

Query: 1136 XXXXXXXXXYIIEDIVGEYATLLETTNPFKNIF--AETPSTMEPSRASFSEDDNDEEADP 1193
                     YI++D++G +  +LE+ NPF+  F  A +P    P   S +E  +DEE DP
Sbjct: 1139 IPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTE--SDEELDP 1196

Query: 1194 SSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIG 1253
              FK     +      DN+V+D+SY  L ++P L+ +  +  E   S+++VQ+LDDIEIG
Sbjct: 1197 LEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIG 1256

Query: 1254 IVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNK 1313
            IV  LS+LQEGI +  NI + I YL+L W +    G  LYLDRID +M +K LE+N   K
Sbjct: 1257 IVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETK 1316

Query: 1314 LLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSD 1373
            + EV  L K+++VR T+N+  +   +++RPPALSL IEG E+WS   + QVNSLN+ S+D
Sbjct: 1317 ITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSAD 1376

Query: 1374 ITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDP 1433
            ITIDE+Q++WLF+Y   Q  L QE+ ++  SIQ +RS ++ +L+SKL  ASEYYQISHDP
Sbjct: 1377 ITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDP 1436

Query: 1434 YVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAK 1493
            YVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   IDE+  ++   +  D  
Sbjct: 1437 YVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPG 1496

Query: 1494 NIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGY 1553
            N F+SVFS WRNWEFSD+ARSYIY  +F+  + K ++N ++  +K  + S + TVY  GY
Sbjct: 1497 NAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGY 1556

Query: 1554 EVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIA 1613
            EVEHNF++   N+VV+  P ++     +E+ I +TG +G++KGK S +L+ L+ L+P ++
Sbjct: 1557 EVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELS 1616

Query: 1614 AVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDST 1673
                   S P     + FK+N +LL ++SELQ V+  +K+MSR  GG++S+LWE+ KD  
Sbjct: 1617 MKKNLKPSTP---FLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLA 1673

Query: 1674 SQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRA 1733
            S+A S+ +++Q+SE+W+KH ++IL E+Q+R+FS++ T E+WS+KPT+L+N QC D+HFRA
Sbjct: 1674 SKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRA 1733

Query: 1734 MSSTEQLVTAITEIRESLMMIXXX--XXXXXXXXXXSQF--VDQKINTVLSCYFSNVSSE 1789
            M++T+ L  ++ EI E++  +               SQ+  ++QKIN VL+CYF+NV+ E
Sbjct: 1734 MTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQKINMVLTCYFTNVNLE 1793

Query: 1790 VMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKG 1849
            +MPLSPF  RH AKQLDIYFN+ GSN+++LS+WDTD F+ SH TKE+Y RFSFG+I++KG
Sbjct: 1794 IMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKG 1853

Query: 1850 GISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLP 1909
             I       IN+D+S S++KLT  + RR++ SFLQDEK+  + +    SLK   F    P
Sbjct: 1854 NILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLK--LFQRKKP 1911

Query: 1910 KKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTG 1969
                +     + W+L+++I YFG+LVP++STYF+ ELHMLL+SL N   G+  +   ++G
Sbjct: 1912 APSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSKYNGLSG 1970

Query: 1970 QFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLL 2029
            QFSI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCLSP SL 
Sbjct: 1971 QFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLA 2030

Query: 2030 RLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIF 2089
             ++W  ++ L    YY + H    W   +    ++ S E+  +F S H+LSY FC+GW+F
Sbjct: 2031 HMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLF 2089

Query: 2090 QYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSF 2149
                 + PGL++GY+RLFSAYEK+FGK T++DA+FSVANG TS TFFS+G+EKD+YNRS+
Sbjct: 2090 SPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSY 2149

Query: 2150 LPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDV 2209
            LPNMQISYW K  G L+D + RFHGEALDVNF+ SF+DVIES+L+S++ FQELK++++  
Sbjct: 2150 LPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGT 2209

Query: 2210 SESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPS 2269
            + +++ +  +               PF   IRS+N  F+YDGGVF+V++  +     +PS
Sbjct: 2210 ASNIKEQTQSTTQEPIGDIS-----PFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPS 2264

Query: 2270 FEIKSPVVTINCTYKHDEDKVK-PHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIK 2328
            FEIKSP V I+  YK++E K + P   RTLIT++ THNTL+A CAPL+ EFSE +QKM+K
Sbjct: 2265 FEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK 2324

Query: 2329 KHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFL 2388
            +HS+D +P+ T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+GF+SF 
Sbjct: 2325 RHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFT 2384

Query: 2389 FSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYG 2448
            F++ TN++D E+PL F+L++E T+ASIKHIFSRE STSF V F+DLT++FTHP+ I++ G
Sbjct: 2385 FTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILG 2444

Query: 2449 TGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGT 2508
            TGL+SD+ VFFNVKQLQNLYLFLDIW+ S++L+++P+   V    ++ SL+S    D  +
Sbjct: 2445 TGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDS 2504

Query: 2509 EIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEG 2568
             IPWCFTLIF+N++GDVDLGP+LG++SL  +RTW ATDHY   R++LHA+T GI+LTS+G
Sbjct: 2505 TIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKG 2564

Query: 2569 RLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIH 2628
            RLSG+ E+  ASW+SEV WP  ++ N +PLVS SLNID +  K AFDYHMFL+G I+NI 
Sbjct: 2565 RLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNID 2624

Query: 2629 FHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETL 2688
             H+H+EKD  G+ PDLL+V+   + I L STALV ANILDIYNT++R+RQDNKISY+ETL
Sbjct: 2625 VHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETL 2684

Query: 2689 RDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIR 2748
            ++SN  E RQ + YKDILRSL L++TD+SV+I +  +QISPISLFD E+LV+ I+ +S R
Sbjct: 2685 KESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISAR 2744

Query: 2749 SETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIP 2808
            SETH+G KLKT+L++QV D S ALSTSKEELDE++ A+I+++DYMHYA +I GG II+ P
Sbjct: 2745 SETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAP 2804

Query: 2809 KLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVA 2868
            +L + MTT Q+EK++ LEYL+ CSF DKISVRWNLGPV+FIKEMW THV+A+AVRRSQ+ 
Sbjct: 2805 RLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQI- 2863

Query: 2869 NISFGQ-TXXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKF 2927
            +++FG  +                F Y+ LEEP+I++PQIRDLGDATPP+EWFG+NRK+F
Sbjct: 2864 DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRF 2923

Query: 2928 PKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            P FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2924 PAFTHQTAVILVQKLVHTAEKEYGSIL 2950

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3264 bits (8462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1569/3003 (52%), Positives = 2138/3003 (71%), Gaps = 68/3003 (2%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M + S+ + VP++  K+FSWVFL+DWIL VV+CL++IFY+GR  AY+ S ILEWLLWKRA
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
             IK+N+E+LR+SLLGGRI FKN+++IHKDYTIS+L+G+LTW+YWLL  RK      +K S
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  SG----KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEP 176
            +G    K  +LPC+  + CEG EIF+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 177  FS--------------DGSSADKL-DEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLL 221
             S              + +S  KL DED  ES Y++ S  +  NDR + +    K    L
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 222  MFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFE 281
               P+E++  R SL  GNKFTPS++I+S E G GIID   PKE+LDLY+ K  +E  NF 
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 282  ISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYH 341
            +++K NIGY + + LKFKIDRGK+S+LWK F  +  I                  D F  
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 342  KWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGA 401
            KW+GLSLYK +  +    DLDD++FD  NHEYAKF+S++KCPK    Y+ D+PG VPHGA
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461
            HPT  +IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  P+
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 462  KKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRF 521
            K+  PGS RIYT  +++ISIM+DTTWRI TRE SKD  FLKHYKETN++YRPFGW+DLRF
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 522  CKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWN 581
             K++YA F  ++ PT +GF+N+ ++H  + EIRSSVNHDIL+K K FD D D+ YPL WN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641
             +A W I+M S QLE FLLREHITL+ADTL+DF++G+PTPYELFRP    +NW+M+ Y I
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMML 701
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I+VT+P E I   + +++Y I+TPMFR++L
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFV 761
            NTPPWNTLNEFMK+KEVGR+YDF+ KGSYLLYSELD+DNVDT+ I C S+ T L CYGFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVA------DLASTVDSGYQ 815
            +RYL NVKMNYFG+FFNF+TSEEYTG+    E+ +    S+++      D+ S  +SG  
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESG-M 839

Query: 816  NSSLKNESEDKGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELV 875
            + ++  E  ++  +KRSDL+RT NETD++ TFSVWDGA+ILPETIY+ D C AL F EL+
Sbjct: 840  DDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELI 899

Query: 876  VDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRM 935
            +D RS NYYMD++A L  T ++R+  K   ++F  +  +N    +  G LSDL+IHGHRM
Sbjct: 900  IDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRM 959

Query: 936  YGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETIND 995
            +GLPP EPTYFC+WD ++G L ++S+ +F+KGF  SF +IGFG+ DLENILLY  E IND
Sbjct: 960  FGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIND 1019

Query: 996  MTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNC 1055
            MTSLTV+ ++I + LK+ V      +  + + FT IDFE+  YS R+D+ IP L +S+  
Sbjct: 1020 MTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYG 1079

Query: 1056 VMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDS 1115
            +  DG       F TK+  T+F Q K+  + RS QR YIT++D+ +HR  FLLP  +Q  
Sbjct: 1080 LDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKK 1139

Query: 1116 DTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTM 1175
            + Y  LYG                     +I+ED +GEY +LL+    F+  F    ST 
Sbjct: 1140 ELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---STN 1196

Query: 1176 EPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLL 1235
             P++AS     ++E+ DP  F     + ++N++ DN V+D+ YI ++++P +  + +SL 
Sbjct: 1197 TPNQAS---THHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLS 1253

Query: 1236 EQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLD 1295
              +Y EN+VQV+DDIEI  +K LS  QEG +SI+NI + + Y ++ W E    G ELYLD
Sbjct: 1254 STVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLD 1313

Query: 1296 RIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEV 1355
            ++D++MS++++EK+R   LLE+  LAK +++R +++++ +    ++RPPALSL +EG E+
Sbjct: 1314 KLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCEL 1373

Query: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTE 1415
            WS+T ++QVNS++  S+DITIDESQ+EWLF + ++Q   +Q + T+ NS+Q   + S+ +
Sbjct: 1374 WSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRK 1433

Query: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQS 1475
            LISKLTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW+S
Sbjct: 1434 LISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWES 1493

Query: 1476 NIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF-TAENEKHKQNLIK 1534
             ++  LKEK      +AK +FMSVFS WRNWEFSDVARSYIYG+LF T + EKHKQ++ +
Sbjct: 1494 GVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSM-R 1552

Query: 1535 KLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSV 1594
            +++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T    +RE+ I +TG +GSV
Sbjct: 1553 RIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSV 1612

Query: 1595 KGKFSDRLLKLQDLIPLIAAVGEDDKSDPK---KELSKQFKMNTVLLVDKSELQLVMDQT 1651
            KG FSD LL+L++LIPL+    E  +  P      + K FK+N +LL +K+E+QLV+ ++
Sbjct: 1613 KGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGES 1672

Query: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATT 1711
            KL +R + G+VSLL ++ K++ S AGS+++++++SE  + H +  L E Q+RDFS+ AT 
Sbjct: 1673 KLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATV 1732

Query: 1712 EAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESL------MMIXXXXXXXXXXX 1765
            E+WS KPT+L++ QCA  H ++M+ T  LV ++ E+ +++      + I           
Sbjct: 1733 ESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKS 1792

Query: 1766 XXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTD 1825
               +  D +I  V  C  SNVS E+MP+SPFYIRHE K+ D+ F +FGS  +++ +WDTD
Sbjct: 1793 PKKKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTD 1850

Query: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885
            FF+ S  TK+QY R SFGD +I   +    + +++ ++S SMIKLTFSEP RI++SFLQD
Sbjct: 1851 FFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQD 1910

Query: 1886 EKLASQGINLLYSLKPLFFSSNLPKKEKQ---APSIMINWTLDTSITYFGVLVPVASTYF 1942
            E+ AS+   LL +LKP      LP+ E +   A +  + W LDT I YFG+LVP+++TYF
Sbjct: 1911 ERTASESFKLLKALKPFL----LPQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYF 1966

Query: 1943 VFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTL 2002
            VFE H L+LS+++ +     E+ +   Q SIEN++FLIK+R +P  LS++LDFSI  ST+
Sbjct: 1967 VFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTI 2026

Query: 2003 QRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWN--TKMFT 2060
            Q+ ++ + SFQVES+HFR+ LSP SL+RL+WG  + L L++YY  +   ++W+       
Sbjct: 2027 QKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLK 2086

Query: 2061 GKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVV 2120
             +   S  + +N  S H+LSY FCIGW+F     S PG+MLG++RLFSAYE  +GK T+V
Sbjct: 2087 KEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLV 2146

Query: 2121 DAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVN 2180
            DAFFSVA G TS+TF+   +E +  NRS+LPNMQI+YW K+ G +KD F RFHGEALDV+
Sbjct: 2147 DAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVS 2206

Query: 2181 FVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNI 2240
            F+ +F+ VIES LQS + FQELK +++  + S    N                 PFL NI
Sbjct: 2207 FLTTFITVIESMLQSFQVFQELKTSLIQPNTSTTENN--------TEPKIKSLAPFLSNI 2258

Query: 2241 RSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLIT 2300
            +SVN  FKYDGGVF+V+++EDIE+  EPSFE+K+P V I+  YKH+   +KPH  R L+ 
Sbjct: 2259 KSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVA 2318

Query: 2301 VDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEK-----PNFTKPSSQNVDYKRLLDQF 2355
            +  THNTL+A CAPL+ EF E + +M+KKHS++ K      N +K  SQN+DYKRLLD F
Sbjct: 2319 IGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGF 2378

Query: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASI 2415
            D+A KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D  +PL FSL+++ TKASI
Sbjct: 2379 DIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASI 2438

Query: 2416 KHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWR 2475
            KHIFS+E STSF +  +DL  +FTHPD+I+MYGTGL+S++ ++FNVKQLQNLYLF+DIW+
Sbjct: 2439 KHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWK 2498

Query: 2476 FSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMIS 2535
             SS +   P  ++ N + E   LT    ++   EIPW FTLIFTN++G  DLGPSLG++S
Sbjct: 2499 LSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLS 2558

Query: 2536 LRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNT 2595
            L+ +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV WP EK  + 
Sbjct: 2559 LKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHN 2618

Query: 2596 HPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEII 2655
            +PLV+ S+NID++++KAAFDYHMFLIGTIS   F LH+EKD  G +PDLL+V+F+ + I 
Sbjct: 2619 YPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMIN 2678

Query: 2656 LSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESR-QPILYKDILRSLKLLRT 2714
            + STALV ANILD+YNT++RMRQDNKI Y+ETLR+S+  E+R  P  Y+DILRSL LL+T
Sbjct: 2679 ICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQT 2738

Query: 2715 DLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALST 2774
            D+S NI   K+Q+SPI+LFD+EVLVI I+ +S R+ T +G+KLKT L+L+V D   ALST
Sbjct: 2739 DVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALST 2798

Query: 2775 SKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFS 2834
            SK E+DE+  ++I++ DYM YASKI GGTII++PKL + MT+ QEE ++ LEYL+ C+F 
Sbjct: 2799 SKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFE 2858

Query: 2835 DKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXXXXXXXFNY 2894
            DKI+V+WNLGPV+FIKEMWTTHVKALAVRRSQ    +  QT                  Y
Sbjct: 2859 DKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKY 2918

Query: 2895 IALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            + +EEP+I++PQIRDLGDATPP+EWFGVNRK+ P FTHQT V+PVQKLV+ AEKQY  +L
Sbjct: 2919 VPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978

Query: 2955 DDT 2957
            D++
Sbjct: 2979 DNS 2981

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 3217 bits (8341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1582/3001 (52%), Positives = 2134/3001 (71%), Gaps = 76/3001 (2%)

Query: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAK 61
            ++ +  RG  L  +++FSWVFLVDWILTV++ L  +FY+ R +AY V+FILEWLLWK+AK
Sbjct: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64

Query: 62   IKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRK-----AELIEN 116
            +K+++  LR+SLL GR+ FKNL++I KD TI++LEGS+TW+YWL+  RK     A++   
Sbjct: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124

Query: 117  NKSSSG---------------KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDER 161
            +  SSG               K+ KLPC+   ECEG E+FIYNRT AYDN++N+LSK ER
Sbjct: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184

Query: 162  DKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLL 221
            +KFEK++ E+ F +P SDGSS DK++E  + SA  +  + +I NDR +Q       P+ L
Sbjct: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242

Query: 222  MFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFE 281
              LPIE   ++GS+L+GNKFTP V+ILS+ES   + DV     +LDLYR K ++  KN E
Sbjct: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302

Query: 282  ISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYH 341
            I +KQNI YD+     F+ D+GK+S+LW  F R+F++                  DNF  
Sbjct: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQP---HDNFMQ 359

Query: 342  KWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGA 401
            KWKGLS+Y+      +  + DD+EFD+++HEYAKFTS+LK P+VTI +D D+PG VPHGA
Sbjct: 360  KWKGLSMYRNDMF-GEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418

Query: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461
            HP     DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRTAKPI
Sbjct: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478

Query: 462  KKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRF 521
            KKL PGS+RIYT+ ++ I+ MED TWRIPTRESSKD EFL HYKETN++YRPFGW+D++ 
Sbjct: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538

Query: 522  CKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWN 581
             +D+   F++++CPT +GF+N   V  ++TEIRSSVNHDI LKSK F  + DIGYPLGWN
Sbjct: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598

Query: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641
            ++A W I M S QLE FLLREH+TL+ADTL+DFS+G+P PYELFRPFVY + W M+GYS 
Sbjct: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658

Query: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMML 701
            YLNVNDHNIVNNPLDFNENCYLS+HGD L+++V VP+++I   +T+M+Y+I TPMFR++L
Sbjct: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLL 718

Query: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFV 761
            NTPPWNTLNEFM++KEVGR++DF +KGSYL+YSELDIDNVDTL +EC+S+ T LH YGFV
Sbjct: 719  NTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778

Query: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKN 821
            +RYL NVKMNYFGEFF+FVTSEEYTG     ++ ++ ++    D  S+ +S    S + +
Sbjct: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYES---VSRISS 835

Query: 822  ESEDKGP-------MKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAEL 874
             S DK P       +K+SDLKRT+NETDIWFTFSVWDGALILPETIY+ DPCIALHFAEL
Sbjct: 836  NSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAEL 895

Query: 875  VVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHR 934
            +VD RSCNYYMDI+A     ++KR+V K+ +E+++++  NNG D + HG LSD+ IHGHR
Sbjct: 896  IVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHR 955

Query: 935  MYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETIN 994
            MYGLPPTEPTYFCQWD++ G L IDS++ F++G F +FYKIGFGY DLENILLY+TE I+
Sbjct: 956  MYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIID 1015

Query: 995  DMTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLN 1054
            DMTSLT+ +  I I L D    + + +  E   FTLIDFENE+YS+R+D+KIP L    N
Sbjct: 1016 DMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSL--EFN 1073

Query: 1055 CVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQD 1114
                +  D S L F+  + FTNF Q +D +K R  QR YI ++D+PYHRC FLLP  YQ 
Sbjct: 1074 IFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQK 1133

Query: 1115 SDTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAET--P 1172
            S  Y  L+G                     Y++ED++ +Y  L E     K    E    
Sbjct: 1134 SRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLEL 1193

Query: 1173 STMEPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAK 1232
            S +E +RA          ++P +    A       E DNYVV V  I++D++P L+   +
Sbjct: 1194 SAIEATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIVIDINPALYTTIE 1247

Query: 1233 SLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFEL 1292
             LL+ +Y ++ VQ++D IEIGIVKRLS++ +G+T+++N+ + I + NL W E   +   +
Sbjct: 1248 KLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSM 1307

Query: 1293 YLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEG 1352
            + D++D+ ++EK+LE+N    LLE+  LAK+K VR+TV Q+     +++RPPA+++G+EG
Sbjct: 1308 FFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEG 1367

Query: 1353 FEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNS 1412
            FE WS+  ++QVNS++++S+DIT+D++Q+EW F+Y   Q     ++  S+N IQN R  S
Sbjct: 1368 FEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIES 1427

Query: 1413 KTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDD 1472
            + ELIS+LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP D
Sbjct: 1428 QKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKD 1487

Query: 1473 WQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNL 1532
            W  N+ + L+++K+  ++DA++IFMS+FS WR+WEFSDVARSYIYGKLF  ++ + K+  
Sbjct: 1488 WYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQS 1547

Query: 1533 IKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSN---REETIEITG 1589
            ++KL K  +G+F++TVY   Y+V+H+ VV++A L+++LTP  T    N   REE I+I+G
Sbjct: 1548 LQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISG 1607

Query: 1590 RVGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKE-LSKQFKMNTVLLVDKSELQLVM 1648
             V  +KGK S +LLKLQ LIP++    E     P ++ + K FKMN   +V+  ++QLVM
Sbjct: 1608 TVDVIKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVM 1667

Query: 1649 DQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVL 1708
            D TKL      GR+S+LWENL+DST+QAGS+V+FS+ +E+ LKH + +L E ++ +F   
Sbjct: 1668 DATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYAT 1727

Query: 1709 ATTEAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXXXS 1768
             TT+ W+ +PT LI+++ + +HFR M+ TE+LV AI +I+  +  I              
Sbjct: 1728 FTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHP 1787

Query: 1769 QFVD-QKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFF 1827
               D  K N + SC FSNVS ++MP+SPF +++ AKQ+D ++NKF S+  L+ + DTDFF
Sbjct: 1788 TVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFF 1847

Query: 1828 MTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEK 1887
            +TS QTKEQY+R S   ++I+  +S     L+++++S +++KLTFSEP+ IV SFL+DE+
Sbjct: 1848 LTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDER 1907

Query: 1888 LASQGINLLYSLKPLFFSSN----LPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFV 1943
            +AS+ ++LL +LKPLF  S+     P+  ++    +  W+LD+SI YFG+L+P+ STY+V
Sbjct: 1908 VASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYL--WSLDSSIDYFGILIPMTSTYYV 1965

Query: 1944 FELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQ 2003
             E H  + S++N  NG       +TG  S+ENILFLIKE SLP GLSK++D ++ VSTLQ
Sbjct: 1966 MEFHSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQ 2024

Query: 2004 RTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNT------K 2057
            R  D  +S QVESSH R+CLSPDSLLRL+WG ++   LS +Y + H+ ++W +      K
Sbjct: 2025 RVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDK 2084

Query: 2058 MFTGKSDKSKEMPI--NFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFG 2115
                 S KS E     +  SIH LSY  C+GW+F+Y  G   GL+ GY+RLFSAYE   G
Sbjct: 2085 QQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMG 2144

Query: 2116 KFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGE 2175
            K TV+D++F+ A GNTSSTF+ E N K+ +NR +LPNMQI +W+K    +KD + RF GE
Sbjct: 2145 KLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGE 2204

Query: 2176 ALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXP 2235
             LDV ++  FM  IESTL S++ FQ+LKK +  + E+ + E                   
Sbjct: 2205 TLDVKYLSDFMLTIESTLHSIKMFQKLKKEL--IVETPKRE----VVHIKEDKPVNSSNN 2258

Query: 2236 FLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKF 2295
             L NI+SVN +FKYDGG + V+   D      P+ EIKSPV++++  YKH++   K H  
Sbjct: 2259 ILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSI 2318

Query: 2296 RTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSS-QNVDYKRLLDQ 2354
            R L+ +DPTHN LYA CAPL+  F E ++ +  ++ ++ K + T P+S QN+DY++LL+ 
Sbjct: 2319 RCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLED 2378

Query: 2355 FDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKAS 2414
            +D+A+ +TSAKQQLSLSCEPKAKVQADVGFE+   SM TN FD ++PL FS +++ TKAS
Sbjct: 2379 YDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKAS 2438

Query: 2415 IKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIW 2474
            IKH+FSRE STSF VG++DLTLLFTH + I+ YGT L+SD+ ++FNVKQLQNLYLFLDIW
Sbjct: 2439 IKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIW 2498

Query: 2475 RFSSILHTRPVQRTVNKEIEMSSLTSTNYA-DAGTEIPWCFTLIFTNVSGDVDLGPSLGM 2533
            + S +L+  PV  +  + I      S +      +++PWCFTLIFTNV GD+DLGPSLG+
Sbjct: 2499 QLSELLN--PVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGL 2556

Query: 2534 ISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSK 2593
            ISLR  RTWLATDH++ KRQ+LHAF D + L SEGRLSG+  +  ASW+SEV W  +  +
Sbjct: 2557 ISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKR 2616

Query: 2594 NTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDE 2653
            +  PLV+ SLN D I +KAAFDYHMFLIGT++NI F LH+E+D  GV PDLL+VSFS +E
Sbjct: 2617 DNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEE 2676

Query: 2654 IILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLR 2713
            I L STALV ANILDIYNTI+RMRQD KISY+ETL+DSN   ++Q + Y+DIL+SL+LLR
Sbjct: 2677 IKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLR 2736

Query: 2714 TDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALS 2773
            TDL+V+I S ++QISPISLFDVEV+VI +  VS RSETHS  KL T L ++V D + +LS
Sbjct: 2737 TDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLS 2796

Query: 2774 TSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSF 2833
            T+K+ELDE+  + I + DYM YASKI GGTII+IP++ V MTT QEEK++ LEYL++C F
Sbjct: 2797 TAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKF 2856

Query: 2834 SDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXXXXXXXFN 2893
             DK++VRWNLGPV+F+KEMWTTHVKA+AVRRSQV   SF  +                 N
Sbjct: 2857 HDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLN 2916

Query: 2894 YIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            Y+ +EEPQI++PQI+DLGDATPP+EWFGVNRK+FP FTHQTAV+PVQ LVYLA+KQY K 
Sbjct: 2917 YVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKT 2976

Query: 2954 L 2954
            L
Sbjct: 2977 L 2977

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3107 bits (8055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1512/3010 (50%), Positives = 2093/3010 (69%), Gaps = 75/3010 (2%)

Query: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAK 61
            + +SQ   + L   KDFSWVFLVDWILT+++ +T++FY+GR  A+ +SFI EWLLWKR +
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   IKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------E 115
            +K+N+E+LRVSLLGGRI FKNL++I KDYTIS L G ++W+YWL   R  + +      +
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 116  NNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175
            ++ +S  +  KL C++ +ECEG+E+F+YNRTVAYDN I + SK+ER KFE++LNEH F +
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 176  ----------PFSDGSSADKLD-EDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFL 224
                         +  + D+++ +  +ES++  ++++ + NDR + + + GK+   L +L
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKN-LFLNYL 241

Query: 225  PIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISI 284
            P+++K S  S ++GNKFTPS++I+S +S +G++D   PKE+LD+Y+ K  M+ KN  +S+
Sbjct: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301

Query: 285  KQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWK 344
            KQNIGY++ + LKFK+  GK+SKLW  FV+                +  +   NF+ KW+
Sbjct: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361

Query: 345  GLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPT 404
            GLSLYK    +   +DLDD+EFDL  HEYAKFTSI+KCP+  + Y+ D+PG VPHGAHPT
Sbjct: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421

Query: 405  IPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 464
            +  IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KP+K L
Sbjct: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481

Query: 465  PPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKD 524
             PG RR+YTLF++ I + ED TWRIPTRESSKD EFL+HYK TNE+YRPFGW+DL+F KD
Sbjct: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541

Query: 525  TYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKA 584
            +YA+FN ++C T  G QN   +H  ++EIRSSVNHDI +KSK  D D ++G+PLGWN KA
Sbjct: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601

Query: 585  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLN 644
             W IN+ S QLE FLLREHITL+ADT+SDFS G+PTPYELFRPF+Y +NW+++GYSIYLN
Sbjct: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661

Query: 645  VNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTP 704
            VNDHNIVNNPLDFNENCYLS HGD L++D+TVP++ I    TD+SY I TPMFR+MLN P
Sbjct: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721

Query: 705  PWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRY 764
            PWNTLNEFMKHKEVGRAYDF   G+YL+Y+ELD+DNVD + I C+SKSTVLHCYGFV+RY
Sbjct: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781

Query: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESE 824
            L N+KMNYFG+FF+FVTSEEYT  + ++  G+ +     +D AST  S +  +   NE +
Sbjct: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKN---NEED 838

Query: 825  DKGPMKR--SDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCN 882
            DK  + R  +D++R TNETD+W TF++W+GAL+LPETIY+ DPCIALHF EL +D RS N
Sbjct: 839  DKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTN 898

Query: 883  YYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTE 942
            YYMD++A L+   ++++ + Q NE+F+ +R+ NG D + H  +S++ IHGHRMYGLPPTE
Sbjct: 899  YYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTE 958

Query: 943  PTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVH 1002
            PTYFC+WD +LG + ++S+++F+KG   SF KIGFG++DLEN+LLY+ E ++DMT++TV+
Sbjct: 959  PTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVN 1018

Query: 1003 VEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGV- 1061
            V+  +I + +P + S++ +   ++ F  IDFENEKYS R+D++IP L +SL     +   
Sbjct: 1019 VKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASK 1078

Query: 1062 DTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNL 1121
            + SF  FETK+ FTNF  YK+  + R+ QR YIT++D+P+HRC F+LP  YQ+S  YQ L
Sbjct: 1079 ELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKL 1138

Query: 1122 YGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRAS 1181
            YG                     +II+D + EY     TT+    +    P +   +  S
Sbjct: 1139 YGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEY----NTTSDCIILNLPYPDSTNLNSDS 1194

Query: 1182 FSE--DDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLY 1239
            F+   D        +  +     ED   ERDNYV+D  YI + +DP LF + + LL   Y
Sbjct: 1195 FNSYPDTAPHTLSDTIIRKSPLPED---ERDNYVIDFRYISISIDPELFFYIEKLLNHFY 1251

Query: 1240 SENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDY 1299
             ++  QV+D IEIG+VKRLSN QEGI+SI+N  I I + ++ W +    G ELYLD +D+
Sbjct: 1252 GDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDF 1311

Query: 1300 QMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSST 1359
            +M+EKS+EKNR   L EV  L K+ ++R +VN K +   +E +PPALSL +EG + WS+T
Sbjct: 1312 EMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTT 1371

Query: 1360 EDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISK 1419
              + +NS+ LTS D TIDE+Q+ WLF +  DQ  LI  V  +F  +Q  R+ S+ ELIS+
Sbjct: 1372 AKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISR 1431

Query: 1420 LTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDE 1479
            LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLPDDW   + +
Sbjct: 1432 LTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAK 1491

Query: 1480 VLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKC 1539
             LKE+KY ++KDAK+IFMSVFS+WRNWEFSDVARSYIY K+F A   + +Q  + K  K 
Sbjct: 1492 QLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKA 1551

Query: 1540 TMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFS 1599
               S Y+TVY  G  V+H+F+V  +NLV + TP  T    N+E+ I +TG +GS+KGK S
Sbjct: 1552 AFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKIS 1611

Query: 1600 DRLLKLQDLIPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVG 1659
            D++ KL +L+ L+    ED         S+ FK+N  LL D S+L  V  +T L +    
Sbjct: 1612 DKMFKLHNLMNLVQQ-QEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGETSLTNTIHS 1670

Query: 1660 GRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPT 1719
            G+ S LWEN K  T +  SLV+++++ E  +KH + +L E Q+   ++ A  ++    P+
Sbjct: 1671 GKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHPS 1730

Query: 1720 ILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXX-----XXXXXXSQFVDQK 1774
            I+ N QC D++ R M  TE +VT + E      ++                   +    K
Sbjct: 1731 IVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTK 1790

Query: 1775 INTVL------SCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFM 1828
            IN  L      +C+FSNVS ++MP+ PF  R E K+++  F+   +     +IWD+D ++
Sbjct: 1791 INPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYL 1850

Query: 1829 TSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKL 1888
             SH TK+QY R S G+I +     R   ++ N+D+S S++KLTFSEP R++ SFLQDE+ 
Sbjct: 1851 GSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDERE 1910

Query: 1889 ASQGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHM 1948
             S+ +  L  L  LF  S+ P+         I+W L+  I Y G+L+PV++T+FVFE+H 
Sbjct: 1911 VSRSVKKLQVLGNLF--SSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHT 1968

Query: 1949 LLLSLTNTNNGMLPEET-KVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVD 2007
            LL SL + + G +  E  + +GQ S++NILFLIK+R++P  LS+++D S K+S +Q+ ++
Sbjct: 1969 LLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIME 2028

Query: 2008 TEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWN-----TKMFTGK 2062
            +  S+Q+ES H R C SP SL+R++WG H+LL L  +Y R H+ N+W+      K     
Sbjct: 2029 SHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVEED 2088

Query: 2063 SDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDA 2122
               S    + F S HILSY FC+GW+FQ    ++ GL+LGYNRLFSAYEK  GK T+VDA
Sbjct: 2089 KTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDA 2148

Query: 2123 FFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFV 2182
            FFSV+NG TS TF+S+GNE+DKYNRSFLPN+QI YW K   E+KD F R HGE LDVNF+
Sbjct: 2149 FFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFL 2208

Query: 2183 PSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXX--------- 2233
             SF+ +IE+TLQS++ FQELKK +++      A ++                        
Sbjct: 2209 SSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDA 2268

Query: 2234 -----XPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDED 2288
                  PFL +IR VN  FKYDGG+F+VY++EDIE+  +PSFEI+SP VTI+  YK++  
Sbjct: 2269 PRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIG 2328

Query: 2289 KVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKP----NFTKPSSQ 2344
             VKPH  RTLITV+ THN L+A CAPLLM  S+ +Q M+KKHS+ +KP      ++P SQ
Sbjct: 2329 DVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSRP-SQ 2387

Query: 2345 NVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEF 2404
            N+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN+ D+ +PL F
Sbjct: 2388 NIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSF 2447

Query: 2405 SLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQL 2464
            +L +++T+++I+HIFSRE S SF +  +D+T +FTHP++I+M+G  L+SD+ V+FNVKQL
Sbjct: 2448 ALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQL 2507

Query: 2465 QNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGD 2524
            QNLYLFLDIW+ S++L  +P+++  +  + + +  S+   D G  IPWCFTLIF N++G 
Sbjct: 2508 QNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPSSP-MDVGNIIPWCFTLIFANINGK 2566

Query: 2525 VDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSE 2584
            VDLGPSLG++SL  ++ W A+DHY  KRQLLHA+ D I LT++GRLSG+ E+  A W +E
Sbjct: 2567 VDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAE 2626

Query: 2585 VKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDL 2644
            V WP  K  + +PLV+ S  I +I++K AFDYHMFLIGT+ N  FHLH+E+D  G +PDL
Sbjct: 2627 VNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDL 2684

Query: 2645 LQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKD 2704
            L+V  + ++I + STALV AN+LD+YNTI+RMRQD  +SY+ETLR+SN  ++++ + YKD
Sbjct: 2685 LKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKD 2744

Query: 2705 ILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQ 2764
            IL+ L L++TD+ V+I++  VQISPISLFDVEVLV+ I  V    +TH+G+KL+T L LQ
Sbjct: 2745 ILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQ 2804

Query: 2765 VLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNN 2824
            + +   +LS+SK E+DE++ + I+++DYM YASKIVGGTI DIPKL + M T Q+  ++ 
Sbjct: 2805 LYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDI 2864

Query: 2825 LEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXX 2884
            LEY +  +F DKI+VRWNLGPV+FIKEMWTTH+KALAVRRSQ    + G           
Sbjct: 2865 LEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMR 2924

Query: 2885 XXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVY 2944
                     YIA+EEPQI+ PQI+DLGDATP +EWFG+NRKKFP FTHQT ++PVQKL++
Sbjct: 2925 DEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIH 2984

Query: 2945 LAEKQYVKIL 2954
             AEK+Y  I+
Sbjct: 2985 SAEKEYANIV 2994

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 3021 bits (7833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1486/2985 (49%), Positives = 2041/2985 (68%), Gaps = 80/2985 (2%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            ME  SQ   V L+++++FSWVFLVDW+L  VV LT+IFY+GR++AY ++ +LEW LWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
            K+KI+VE+LR++ L G I F+NL +I KD TIS+L+GSL W+Y LL  R+++  E +   
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  SG-----------KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169
             G           K   LPC+  + CEG EIFIYNRTVAY+N+I + S++ER +FEK+++
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELK 229
            +    E F   S              ++ SD   +NDR + E    K    + FLP+EL+
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 230  FSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIG 289
             SRGS++LGNKFTPS++I S  SG+G++D+  PKE+LDLY+   Q++F + +ISI+QNI 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 290  YDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLY 349
            Y+     K     GK+S++W TFV+V  I            + GT  + F  KWKGL LY
Sbjct: 301  YNRK---KATFKNGKLSRMWATFVKVLHIPFYNKSHN----NKGTESEPFMTKWKGLGLY 353

Query: 350  KASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDID 409
            K    D    D D+V FD  NHEYAK ++I+K P+  + Y  D+PGVVPHGAHPT+   +
Sbjct: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---E 410

Query: 410  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSR 469
            GP+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R++ PIK L PGSR
Sbjct: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470

Query: 470  RIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANF 529
            RIYT+F+    +++ ++WRIPTRE SKD EFLK +K T+EEYRPFGW+DL+F  D+Y + 
Sbjct: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530

Query: 530  NISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIIN 589
               +CP  +GF N  ++HF E E  SSVNHD++LK   FD+ GD+GYPLGWNS A W IN
Sbjct: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590

Query: 590  MKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHN 649
            + S QLE FLLREH+TLVAD  +DFS+G+PTPYELFRPF+Y++NW ++GYSIYLNVNDHN
Sbjct: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650

Query: 650  IVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTL 709
            IVNNPLDFNENCYLSLHG++L IDVT P +SI G Y D+ Y+ISTPMFR++LNTPPWNTL
Sbjct: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTL 710

Query: 710  NEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVK 769
            NEFMK+KEVGR+Y F + G Y +YSELDIDNVDTL +EC S  T LHCYGFVMRYL NVK
Sbjct: 711  NEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770

Query: 770  MNYFGEFFNFVTSEEYTGVLGAREVGDV--TTKSSVADLAS--TVDSGYQNSSLKNESED 825
            MNYFG+FF+F+TSEEYTGV+ A+E   V  T + S+ D ++  + DSG  +        D
Sbjct: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRAD 830

Query: 826  KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYM 885
              P+ RSD+KRTTNETDIWFTFSVW+GAL+LPETIY+ DPC+ALHF EL+VD RSCNYYM
Sbjct: 831  P-PVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYM 889

Query: 886  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTY 945
            D++A ++ TSIKR+VS+Q +E+F+ IRR+NG  E+EHG L+ LTIHGHRMYGLPP EPTY
Sbjct: 890  DLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTY 949

Query: 946  FCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEK 1005
            FCQW I+L  L I+SD EF KGFF  F  IGFGY +LEN LLYD ET +DMTS+TV V  
Sbjct: 950  FCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVRD 1009

Query: 1006 IRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSF 1065
            + + +++    S++V+   ++ FT IDFENE+YSQRID+K+P L+I L     D      
Sbjct: 1010 MNVVVEND--SSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRL 1067

Query: 1066 LKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXX 1125
            +   TK+  T+F Q +D  K RS+QR YIT++DSP++RC FLLP + Q+S  Y++L G  
Sbjct: 1068 MDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGSI 1127

Query: 1126 XXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSED 1185
                               +IIED++GE+A  L      K  +    +  +P   S S D
Sbjct: 1128 SPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGL------KCDYDTQRTVDDPDSPSESFD 1181

Query: 1186 DNDEEADPSSFK-------PVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQL 1238
             + E   P   +       P   + +   + DN ++DV ++ +D+DPL+  +   LL + 
Sbjct: 1182 TSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEF 1241

Query: 1239 YSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRID 1298
            +  N V ++D+IE+ IVKRL  L    T + N+ +++  +N  W +   +  +LY D++D
Sbjct: 1242 WKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLD 1300

Query: 1299 YQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSS 1358
            + + +++ + +    + E   L+K+++VR TV  +   +  E+RPPALSL +EG+E +S 
Sbjct: 1301 FDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSW 1360

Query: 1359 TEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELIS 1418
              ++ V S++L S+DIT+DESQ+EWL  Y ++Q +LI+ + TSF  +      ++ +L+ 
Sbjct: 1361 MREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLR 1420

Query: 1419 KLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNID 1478
             +T ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W++N  
Sbjct: 1421 DITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN-- 1478

Query: 1479 EVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLK 1538
              ++      + DA     SV S WR WE SD+ RSYIY  +F ++  K +   +KK+LK
Sbjct: 1479 SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLK 1533

Query: 1539 CTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPV----TSLPSNREETIEITGRVGSV 1594
                SF+ T+Y EGY V HNFV+  AN+V +  P           + +  + +T  +G++
Sbjct: 1534 VDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAI 1593

Query: 1595 KGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLM 1654
            KG+ +D+LLKL+++    A      +S     +SK +K+N +L  D+SELQ V+ QT+L 
Sbjct: 1594 KGELNDQLLKLRNIFSK-AQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLT 1652

Query: 1655 SRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAW 1714
            +R + G+ +LL E LK+S + A S V F+++SE WLKH  ++L EA  R+ S+  T E W
Sbjct: 1653 NRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELW 1712

Query: 1715 SHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMI----XXXXXXXXXXXXXSQF 1770
            S+ P++ IN QC++ H RAM+STE LV +I +I ES+  +                 +  
Sbjct: 1713 SYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNL 1772

Query: 1771 VDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTS 1830
                 NT L+  FS+V++E+MPL+PF +RHE KQL +Y N+  SNEIL+SIWD +  + S
Sbjct: 1773 SIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKS 1832

Query: 1831 HQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLAS 1890
            HQT EQY  F+ GD+++K  +  E  +++NV +S S++KLT SEPRRI++SFLQDEKL  
Sbjct: 1833 HQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIG 1892

Query: 1891 QGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLL 1950
            + +  +  L  LF  S L + + Q+ +  + W+LD ++ YFG+LVP+AST+FVFE+HMLL
Sbjct: 1893 ESLGYIKGLLQLF--SPLARNKTQSSA--LRWSLDANLNYFGILVPMASTFFVFEIHMLL 1948

Query: 1951 LSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQ 2010
             ++ N ++G    +  VTGQ SIEN L LIKE SLP  LSKLLDFSI+V + Q+  ++ Q
Sbjct: 1949 AAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQ 2008

Query: 2011 SFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYS--RRHAPNIWNTKMFTGKSDKSKE 2068
            S+Q+ESSHFRVCLSP SL++++WG H+L  L  Y+   R+    I    +F G +   ++
Sbjct: 2009 SYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQ 2068

Query: 2069 MPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVAN 2128
              I+FRSIHILSY  CIGW+FQ G     GL++G++RLFSAYEK +GK T++D +FSVAN
Sbjct: 2069 --IDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVAN 2126

Query: 2129 GNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDV 2188
            G ++ TF+S+G+EK +YNRSFL N+QI+YW K    +KD F R +GEAL+V+ + +  D+
Sbjct: 2127 GQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDI 2186

Query: 2189 IESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFK 2248
            IESTL S++ FQ LKK      E +   +                 PFL +IR+++  FK
Sbjct: 2187 IESTLASIQKFQTLKK------ERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFK 2240

Query: 2249 YDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTL 2308
            Y GGV ++Y+ +D+     PS EIKSP V I   Y H+E + +PH+ R L+++DPTHN L
Sbjct: 2241 YVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNIL 2300

Query: 2309 YAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQL 2368
            Y+ C P+L +  E+ Q+M++KHS DE P     SSQ++DYK LLD FD+A K+TS +QQL
Sbjct: 2301 YSQCVPILNDIVEASQRMVQKHSPDETP---LESSQSIDYKSLLDSFDIAFKVTSGRQQL 2357

Query: 2369 SLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFE 2428
            SLSCEP+AKVQADVGF+SF F + TN+     P   SL++E  ++S++HIFSRE S SF 
Sbjct: 2358 SLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFS 2417

Query: 2429 VGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRT 2488
            V F+D T +FTHPDV   +G  LVSD++VFFN+KQLQNL LFLDIW+ +  L+ +   + 
Sbjct: 2418 VDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKD 2474

Query: 2489 VNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHY 2548
             +++ +  S+T +      T I W FTLIFTNV GDVDLGPSLG++SLR  RTW ATDHY
Sbjct: 2475 DDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHY 2534

Query: 2549 NEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDI 2608
              +R++LHAF D +S+ SEGRLSG+F++ NA+W+SEV +P   S      +S SL++  +
Sbjct: 2535 GAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRV 2594

Query: 2609 AVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILD 2668
            A+K AFDYHMFLIGTI  + FHL +E D  G+LPDLL V+ S  E+   +TAL  ANILD
Sbjct: 2595 AIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILD 2654

Query: 2669 IYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQIS 2728
            IYNTI RMRQDN+ISY+ETLR+SN  E+R  +LY DIL+SL LLRTDLS +I++ K QIS
Sbjct: 2655 IYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQIS 2714

Query: 2729 PISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIA 2788
            PISLFDVEVLV+ ID VS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I+
Sbjct: 2715 PISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKIS 2774

Query: 2789 IDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDF 2848
            I+DYM YASKI GGTI+ +P+L V MTT Q+ K++ +EYLF C F D+++V+WNLGP++F
Sbjct: 2775 IEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINF 2834

Query: 2849 IKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIR 2908
            IKEMW+TH+K+LAVR++Q +N +  +                   Y+ L+EP IE+PQI+
Sbjct: 2835 IKEMWSTHIKSLAVRQTQ-SNKTMSE-KDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIK 2892

Query: 2909 DLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            DLGDATPPMEWFGV+RK+ P  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2893 DLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2762 bits (7159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1388/3044 (45%), Positives = 1999/3044 (65%), Gaps = 133/3044 (4%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M+  S  + V L   ++FSWVFLVDW+LT +V LT+IFY+GRI+ +L++FILEW++WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIEN---- 116
            K+KIN+E+LR++ LGG I F+NL +IH+DYTIS LEG++ W+YWL N RK++  EN    
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 117  ---------NKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKY 167
                      KS+SG+K   PC+  + CEGLEIF+YN+T +Y+N+I++ SK+ER +FEK+
Sbjct: 121  EERLENGQEPKSNSGRKH--PCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKF 178

Query: 168  LNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDAS------------------------- 202
            +++ +  E F++    +K+  + + S+ T  +  S                         
Sbjct: 179  VDDQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAP 238

Query: 203  --IVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVL 260
              + ND  +++    +    + FLPI++   R SL+LGN+FTPS++++S ++ KGIID+ 
Sbjct: 239  NNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLC 298

Query: 261  PPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXX 320
            PPKE+LDL++ K + E  + + S+KQNIG+DD I   FK  RG++SKLW+ F R+F +  
Sbjct: 299  PPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPT 358

Query: 321  XXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSIL 380
                           D  F   WKGLSLY+    + +  +L++V+FD  NHEYA+  SIL
Sbjct: 359  LGPKHLQTQ-----EDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISIL 410

Query: 381  KCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQ 440
            K  K+   Y+ D+PG+VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA+
Sbjct: 411  KSAKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWAE 467

Query: 441  RQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEF 500
            RQ+S+L+ +LSPVVSRT KPIK L PGS+RIYT+F+ +ISIME++TWRIPTRE SKD EF
Sbjct: 468  RQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEF 527

Query: 501  LKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHD 560
            L+HY ET EE+RPFGW+DL+F KD+Y   +  +CPT +G  NN + HF   EIR+SVNH+
Sbjct: 528  LRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHE 587

Query: 561  ILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPT 620
            +LL++K FD + D+GYPLGWN +A W IN+ S QLE F+LREHITL++D  +DFS+GDPT
Sbjct: 588  LLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPT 647

Query: 621  PYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRES 680
            PYELFRPF+Y++NW ++GYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  DV +PR++
Sbjct: 648  PYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQT 707

Query: 681  ILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDN 740
            +    T+++Y ISTPMFR++LNTPPWNTLNEFMK+KEVGR+Y+F + G Y ++SELDIDN
Sbjct: 708  VANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDN 767

Query: 741  VDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARE-----VG 795
            VDT+ +EC+S  T LHCYGFV+RYL NVKMNYFG+F +FVT+EEYT      E     +G
Sbjct: 768  VDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLG 827

Query: 796  DVTTKSSVADLASTVDSGYQNSSLKNESEDKG-PM-KRSDLKRTTNETDIWFTFSVWDGA 853
            D   + S  +++ST D     ++ +    +KG PM KRS+LKRT NE DIWF FSVW+GA
Sbjct: 828  D---EHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGA 884

Query: 854  LILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRR 913
            LILPETIY+ DPCIALHF EL VD RS NYYMD++A +N T +KR+VS+  +++F+ +R+
Sbjct: 885  LILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRK 944

Query: 914  NNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFY 973
            +NG  E+ HG LS LTIHGHRMYGLPPTEPTYFCQW +++  L I+SD+EF KGF   F 
Sbjct: 945  DNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFS 1004

Query: 974  KIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDF 1033
            KIGFG+ +LENILLY+T T+ DMTS+TV V++++  + D    S+SV+ A+ I FT IDF
Sbjct: 1005 KIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDF 1064

Query: 1034 ENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFL-KFETKLRFTNFEQYKDIDKKRSEQRR 1092
            ENE YSQR+D K P +   +  +  +  +  FL   +T+L FT+F Q +     R  QR 
Sbjct: 1065 ENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQRE 1124

Query: 1093 YITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVG 1152
            YIT+HDS Y+RC FLLP F+Q+S  Y+ L G                     YIIED +G
Sbjct: 1125 YITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLG 1184

Query: 1153 EYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKP-VAFTEDRNHER-D 1210
            EYA  +      K   + +  T E  R   + +D   +A+   F P +      N +R +
Sbjct: 1185 EYAPTV------KPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYN 1238

Query: 1211 NYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISN 1270
            NYV+DV Y+ L+V P +     + L++ Y+E+   ++D  EI IVK+L NLQ G + ++ 
Sbjct: 1239 NYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTT 1298

Query: 1271 IDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTV 1330
              +H+  L+ ++      G EL L+  D+ +  K++E      +LE    + + T+R+++
Sbjct: 1299 SRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISL 1358

Query: 1331 NQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSD 1390
              + +P     +P AL L IE  E+WSST D  VNS+N+TS   T+DESQ+E +  Y   
Sbjct: 1359 -LEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFG 1417

Query: 1391 QGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHV 1450
            Q  ++++  TS   ++N R  ++ +LI  LT+ASEYYQISHDPYVITKPAFIMRLS+GHV
Sbjct: 1418 QIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHV 1477

Query: 1451 RENRSWKIITRLRHILTYLPDDWQS--NIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEF 1508
            RENRSW+IITRLRHILTYLP+DW++  ++  V   +     +  ++IF+SVFS WRNW+ 
Sbjct: 1478 RENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDL 1537

Query: 1509 SDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVV 1568
            SD+ RSYIY K+F  +NE   +  ++ +LK    SF+ TV   GYEV  + +    N++V
Sbjct: 1538 SDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIV 1597

Query: 1569 DLTPPVTSLPS----NREETIEITGRVGSVKGKFSDRLLKLQDLI--------------- 1609
            D+ PP  +  S     +E+ I +T  +G++KG++ + + KL++L                
Sbjct: 1598 DVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLG 1657

Query: 1610 -----PLIAAVG------EDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTV 1658
                   I+  G      E  ++    +  +  K+   ++ ++ +L  V+  T+L +R +
Sbjct: 1658 SISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRII 1717

Query: 1659 GGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKP 1718
             G+ S+L EN K++T  A S V F+Q+ E+WLKH++ +L E  L+   V AT +     P
Sbjct: 1718 NGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIP 1776

Query: 1719 TILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTV 1778
             + +N Q  +   RAM ST  L  ++ +I+  + ++             S  V +K   +
Sbjct: 1777 FVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKN--SSAVTKKTPRI 1834

Query: 1779 -----LSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQT 1833
                 +   F+++SSE+M LSPFY+  + KQL IY +   + E++L   + D ++ S  +
Sbjct: 1835 PIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLS 1894

Query: 1834 KEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893
             EQ+ +FS  D++ K  ++ E   ++ V IS S++KLT  EPRR +++ LQDE+   + +
Sbjct: 1895 SEQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESV 1954

Query: 1894 NLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSL 1953
            + +  L     S++      ++PS    W LD ++ YFG+LVPV+S  ++FELH L  SL
Sbjct: 1955 DHIQKLWNFLRSAS--GGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASL 2012

Query: 1954 TNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQ 2013
            TN N      +   +GQ  +E+   L+KE SLP  LSK+LDFSI+  T Q+  ++ QS+Q
Sbjct: 2013 TNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQ 2072

Query: 2014 VESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINF 2073
            +ESS+FR+CL P+ L+ ++W  H L  L +++ + H P  W     + K+ KS E  ++F
Sbjct: 2073 IESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGESTLDF 2129

Query: 2074 RSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSS 2133
            RSIHILSY FC+GW+F+ G  S PGL+LGY+RLFSAYEK FGK T++D + SVANGNTS 
Sbjct: 2130 RSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSD 2189

Query: 2134 TFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTL 2193
            TF+S+ +EKD Y R++L NMQI YW K    LKD F RFHGE +DV F+ +   ++E TL
Sbjct: 2190 TFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTL 2249

Query: 2194 QSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGV 2253
             S++ F E+KK        ++    +               PFL +IR++NS   + GGV
Sbjct: 2250 HSIKRFNEMKK------AKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGV 2303

Query: 2254 FRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCA 2313
            F+VY+  ++++K+EP  EIKSP V +   Y+ +E + K H  R   T++PTHN L+A CA
Sbjct: 2304 FKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCA 2363

Query: 2314 PLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCE 2373
            PLL +F+ +++ MI+  S+++K + +KP + ++DYK LL+ +D+A ++ S KQ+LS SCE
Sbjct: 2364 PLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCE 2423

Query: 2374 PKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMD 2433
            PKAKVQ D GF SFLF + T++ DS +P   S +++  ++S++HIFSR+ S +F + ++D
Sbjct: 2424 PKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYID 2483

Query: 2434 LTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEI 2493
            + ++FT+P+V   YG  LVSD++++ N+KQ QNL +FLDIWR S+   T+P +     + 
Sbjct: 2484 IVMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKS 2540

Query: 2494 EMSSLTSTNYADAGTE----IPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYN 2549
            +     S  ++ +  +     PW FT+IFTN+ G VDLGPSLG+++L  ++ W+ T H  
Sbjct: 2541 DAKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQG 2600

Query: 2550 EKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIA 2609
            ++++  H F  GI++ SEGRLSG+FE+  AS +SE+ WP E      PL+S S+ I+ ++
Sbjct: 2601 DQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMS 2660

Query: 2610 VKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDI 2669
            +K+AFDYHMFLIG++ ++  HLHNE D   +LPDLLQVS   + I+L +TAL  AN LDI
Sbjct: 2661 IKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDI 2720

Query: 2670 YNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISP 2729
            YNTI+RM+QDN+ISY+ETL++SN   S   + Y+++L SL LLRTD+SV +   KV ISP
Sbjct: 2721 YNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISP 2780

Query: 2730 ISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAI 2789
            +SLFD EVLV+ +  V+ RSET SG+KLKT+LQLQ+ DV+A+LS+SKEELDEE  + IA+
Sbjct: 2781 MSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAV 2840

Query: 2790 DDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFI 2849
            DDYM YASK  GGTII +P+L V MTT Q++ +  LEYLF C F DKIS++WNLGPV+FI
Sbjct: 2841 DDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFI 2900

Query: 2850 KEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIRD 2909
            KEMW THV++LAVRR+Q+ N S                    F Y+ L+EP IE+PQI+D
Sbjct: 2901 KEMWATHVRSLAVRRTQLGNSS--PELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKD 2958

Query: 2910 LGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            LGDATPP+EWFGV+RK  P  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2959 LGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2707 bits (7018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1383/3022 (45%), Positives = 1956/3022 (64%), Gaps = 92/3022 (3%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            ME  SQ   + L  +K FSWVFL  W+LT +  LT+IFY+ R++  + +FIL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-IENNKS 119
            K+KIN+E++RVS LGG +  KN+S+I++D+T+S LE  + W+YWLLN R+ E  ++ N S
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 120  SSG-------------KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEK 166
            S               K +KLPC I +EC+G E+F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 167  YLNEHSFPEPFSDGSSADKLDEDLSESAYTTNS-DASIVNDRDYQETDIGKHPKLLMFLP 225
            +LNEH   +  S+ ++ + +D+D  ES  T NS +++++NDR Y++    +   L  FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 226  IELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIK 285
            I+L+   G++ LGN+FTPS+++ SYE+  G++DV    E++DLY++K  M+F++  IS+K
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 286  QNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDD---NFYHK 342
             N+ YD     +  ID+GK+S++W TF+ +  +                  D    F +K
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 343  WKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAH 402
            W+GLSLYK +  DA    LD+  +D  N EYAKF+SILKCP  T++Y +D PG+VPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 403  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 462
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   PIK
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 463  KLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFC 522
            KL PGSRRI+T+F+M++ I+++++WRIPTRE SKD EF+K + +TN+++RPFGW+D    
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 523  KDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNS 582
            K T A FN S+ PT+ G  NNF +HFL+ E+ +SVNHDILLKSK FD+  DIGYPLGWNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 583  KAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIY 642
            +A W  ++ ++QLE FLL+EHI+L +D  SDF++ DPTPYELFRPF Y +NW++EGYSIY
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 643  LNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLN 702
            LNVND NIVNNPLDFNENCYLSLHGD+L ID  +P   I   YT++++ I TPMFR++LN
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 703  TPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVM 762
            TPPWNTL+EFMK KEVGRA+DF I+GSYL+YS+LDIDNVDT+ +EC S+ST L CYG V+
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 763  RYLTNVKMNYFGEFFNFVTSEEYTGVL--GAREVGDVTTKSSVADLASTVDSGYQNSSLK 820
            RYL NV+ NYFG+F +F+TSEEY+ +L    +   D     + +  +S  +S   ++ L 
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSVQNSSSDDTVLY 840

Query: 821  NESED--KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDF 878
             + +D  K  ++R+D+ RT NE DIWFTF VWDGALILPE +Y+ + C +L F+EL++ F
Sbjct: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900

Query: 879  RSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGL 938
            R  NYYMD +  L    I R ++   +E+F ++R  +      HG LSD+TIH HRM+GL
Sbjct: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960

Query: 939  PPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTS 998
            PP + TYFCQW I+ G L IDS+IEF+  FF  F K+GFGY++LEN L+Y  E+ +DMT 
Sbjct: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020

Query: 999  LTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMG 1058
            LT++ EK+ I + D V + Q+ +    +    IDF+NE+YS+RI++KIP+ +IS+  V  
Sbjct: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080

Query: 1059 DGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTY 1118
              +    L F+TK+ FTNF   +D     + QR YIT+HDSPYHRC F+LP  YQ+S  Y
Sbjct: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140

Query: 1119 QNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFA----ETPST 1174
              LYG                     +++ED + EY+ LLE  NPF NI +    +T S 
Sbjct: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLDTSSL 1198

Query: 1175 MEPSRAS--FSEDD--NDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIF 1230
                R     SE      EE +  ++ P        +E DNY+++V YI +D++PL   F
Sbjct: 1199 FNEYRVDTYISEKAIFKAEEKNTVNYDP-------KYEYDNYILNVEYIRVDINPLFSDF 1251

Query: 1231 AKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGF 1290
              S+  +LYSENMV ++D+IE+ IV+RL + ++ +   +N+ + I+Y+++ W     EG 
Sbjct: 1252 IDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGI 1311

Query: 1291 ELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGI 1350
            E+YLD++D++M ++  +      L E   L+K+K++R + ++ +  ++  +RPPALSL +
Sbjct: 1312 EIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTV 1371

Query: 1351 EGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRS 1410
            EG EVWS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q      +  S + +Q    
Sbjct: 1372 EGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDV 1431

Query: 1411 NSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1470
              +  LISKLT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHIL YLP
Sbjct: 1432 TLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLP 1491

Query: 1471 DDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQ 1530
            + W+ +    ++ +   S  D KN+F+SVFS WRNWE SDVARSYIY ++F  + EK   
Sbjct: 1492 EGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK--- 1548

Query: 1531 NLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLT----PPVTSLPSNREETIE 1586
            NLI    K  M SFY T+Y + Y V+HN VV   N+++D       P  +  +  ++  +
Sbjct: 1549 NLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYD 1608

Query: 1587 ITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQL 1646
            ITG VG+ KG+  D+L++L+ L     A    +KS     + K FK+N VL+V+K EL L
Sbjct: 1609 ITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEKGELTL 1667

Query: 1647 VMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFS 1706
                TKL+SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH  +IL +A L D  
Sbjct: 1668 AAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLF 1727

Query: 1707 VLATTEAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXX 1766
            +    E    KPTIL+N + + L F+A+ +T+ LV  + E    +  I            
Sbjct: 1728 ISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKR 1787

Query: 1767 XSQ----FVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIW 1822
             +     F  +KI+        ++SSE++ LSPF ++H  K+L I FN+ G N+ + SI 
Sbjct: 1788 HTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSIL 1847

Query: 1823 DTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSF 1882
            D D ++TS+Q   QY R S+ DI ++  ++     LI ++I  S+IKLT ++P++I NS 
Sbjct: 1848 DADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSL 1907

Query: 1883 LQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPS---IMINWTLDTSITYFGVLVPVAS 1939
            LQDEK   Q +  + +L  L FSSN   +     +    M+N+ L    TYFG+L PV +
Sbjct: 1908 LQDEKTFEQSLESIKTLNTL-FSSNREVRTSAVDNPYKFMVNFDL----TYFGLLFPVDT 1962

Query: 1940 TYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKV 1999
            +YF+ ELH LL + +N        + K+T   +++N LF+IK   +   +SK+LDFS+ +
Sbjct: 1963 SYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNL 2022

Query: 2000 STLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMF 2059
            ST  + +++++SF+VESSHFRVCL+P+SLL+++ G  +      YY       I+ TK  
Sbjct: 2023 STETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKK 2082

Query: 2060 TG-KSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFT 2118
                S+     P+   SIH LSY FCIGWIF+    S PGL++GY+RLFSAYE  +GK T
Sbjct: 2083 ASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLT 2142

Query: 2119 VVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2178
            VVD FFS+ANG +S TF+S+GNEK+KYNRS+LPN+QI YW K    +K  F RF+GE +D
Sbjct: 2143 VVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETID 2202

Query: 2179 VNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLD 2238
            V F+ +F  +I  T++S++ FQ +KK      E++R  N                  F  
Sbjct: 2203 VRFLSNFATIINLTIESVQHFQMIKK------ETVREMNVEAEKKVGEDDISTKFSLFFS 2256

Query: 2239 NIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTL 2298
             ++ +N    YDGGVF VY        +E + EI +P V I+  YK+  D  KPH  R+ 
Sbjct: 2257 KVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSF 2316

Query: 2299 ITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVA 2358
            I ++PT+NTL +  A  L EF ES+ +M+ K S  E+P   K  S  +DYKR+L+ FDV+
Sbjct: 2317 INIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVS 2376

Query: 2359 VKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHI 2418
              +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D  +PL  SLT+   K SI H 
Sbjct: 2377 FSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHE 2436

Query: 2419 FSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSS 2478
            FS E + SF V F+D+T LFTHPD+   YGT L+SD+S++FN+KQLQNL +FLDIW    
Sbjct: 2437 FSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKR 2493

Query: 2479 ILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRT 2538
            ++  RP +    K+ E    +ST  +   T IPW FT+I T+++GD+ LGPSLG +SL+ 
Sbjct: 2494 LIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKL 2553

Query: 2539 QRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPL 2598
            ++ W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SW+  V++   +  +  PL
Sbjct: 2554 KKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPL 2613

Query: 2599 VSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658
            V  +LN++++AVKAAFDYHMFLIG + NI F+L +EKD  G LPDLL++    DEI + S
Sbjct: 2614 VDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICS 2673

Query: 2659 TALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSV 2718
            TALV +NILDI NTI R RQD++ SY+ETL +SNP   +  I Y DIL+SL LLRTD+ +
Sbjct: 2674 TALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGI 2733

Query: 2719 NISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2778
             I   +VQISPISLFDVEV+V  ++ VS RS T SG+KL TDLQ+++   + +LS S EE
Sbjct: 2734 EIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEE 2793

Query: 2779 LDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKIS 2838
            LDEE  + I++DDYM YA K+ GG I+ IPKL V MTT Q E +  +EYLFAC F DKIS
Sbjct: 2794 LDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKIS 2853

Query: 2839 VRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQ-----------------------T 2875
            VRWNLGPV+FIKE+W THVK+LAVRR+Q+      Q                        
Sbjct: 2854 VRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSE 2913

Query: 2876 XXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTA 2935
                            F Y+ L+EPQIE+P+I+DL DATPP+EWFGVNRKKFP+ THQTA
Sbjct: 2914 SSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTA 2973

Query: 2936 VIPVQKLVYLAEKQYVKILDDT 2957
            +I +QK+V++A+K+Y K+L D+
Sbjct: 2974 IILIQKIVHVAQKEYAKVLGDS 2995

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2403 bits (6227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/2578 (46%), Positives = 1696/2578 (65%), Gaps = 62/2578 (2%)

Query: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTL 474
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 475  FRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVC 534
             ++++SIMED++WR+PTRE SKD +FLK Y +TN+  R FGW DL F +++ A F IS  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 535  PTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQ 594
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN +  W     S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 595  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654
            LE F LREH+ L+ADT SDFS+G+PTPYE FRP +YKV+W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 655  LDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMK 714
            LDFNENCY+S+HGD   I V +PR  I  TYTD+ ++ISTPMFR++LNTPPWNTLNEFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 715  HKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFG 774
            +KE+GR YDFT +GSY++YS+LDIDNVD+L IEC+++   L  YGFV+ YL NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 775  EFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVD-SGYQNSSLKNESEDKG------ 827
            EF +F+T+EEYT ++   +   V+T +  + ++ T   S   NS    ++  K       
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 828  ---PMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYY 884
               P+++ D+KR  NETDIWFTFSVW+GAL+LPE +Y+ DPCIAL F EL++DFR+C+YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 885  MDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPT 944
            +D++A LNGTS KR + K  N++F+ +  N   + +EHG +S+++IHGHRMYG PPT P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 945  YFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVE 1004
            YF  W +++ +L I+SDI FI+GF +   K+GF +++L+NILLYD   +++MTS+TVH  
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1005 KIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVD-T 1063
             I I + D    +Q +++ + I F  I+F N++YS RID+++P L  +     G  +D T
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF-FDNGSSMDKT 1248

Query: 1064 SFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYG 1123
               +F+TK+ FTNF Q KD +    +Q+ +I ++DS +HRC FLL    Q+S  Y  LYG
Sbjct: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308

Query: 1124 XXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAETP--STMEPSRAS 1181
                                 +II+D +G +   + +T    +I   TP  S+ +P +  
Sbjct: 1309 GITPSSSVPPLPIPVQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHSSNKPLKPP 1366

Query: 1182 FSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSE 1241
             S   +  E+  S   P   ++   H   NY++D+SYI LD++PL F +A + L++ YSE
Sbjct: 1367 SSSVIHPIESMQSHLVP---SQSVTH--GNYIIDISYITLDINPLFFTYASNFLDEFYSE 1421

Query: 1242 NMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQM 1301
            N+++ +D IE+ IV RL    E + S++NI + I YL+  + +   EG ELY+D+ID ++
Sbjct: 1422 NIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEV 1481

Query: 1302 SEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTED 1361
            S+K+ +K  T  L E+A L++  ++R ++N+KK  +  ++RPPALSL +EG+E WSST  
Sbjct: 1482 SQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTAS 1541

Query: 1362 RQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLT 1421
             QVNSLN++S+DIT+DESQ+EWL +Y +     + E+  S +SIQ   +  + +L+S LT
Sbjct: 1542 SQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLT 1601

Query: 1422 AASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVL 1481
             ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++ E +
Sbjct: 1602 LASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEM 1661

Query: 1482 KEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTM 1541
            + K      D+ +IF++VFS WRNWE SDVARSYIY K+F + +E   +  ++  +K  +
Sbjct: 1662 RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNL 1721

Query: 1542 GSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDR 1601
             S + T+Y  GY ++HN ++  A ++++LT      P   +  + +TG +GS+KG+FSD+
Sbjct: 1722 NSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEFSDK 1781

Query: 1602 LLKLQDLIPLIAAVGEDDKSDPKK-----ELSKQFKMNTVLLVDKSELQLVMDQTKLMSR 1656
             L+L +LIP  +   ED KS  +      E S  F ++  LL +   LQL M  T L + 
Sbjct: 1782 FLRLLELIPDFSK-EEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNN 1840

Query: 1657 TVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSH 1716
               G++S L E    S   + S   + +KSE+ LKH   I+ E QL    +++T      
Sbjct: 1841 VTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPI 1900

Query: 1717 KPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKIN 1776
             P ILIN + ADLHF++++STE++V  I +I E  + +             ++ VDQK  
Sbjct: 1901 CPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTK-VDQKPE 1959

Query: 1777 TV-----LSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSH 1831
             +     ++C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  EILLS+WDTD F+TSH
Sbjct: 1960 KINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSH 2019

Query: 1832 QTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1891
             TKEQY RFS+ DI+I      E   ++ V +S S++KLTFSEPRRI  SFLQDE++  +
Sbjct: 2020 HTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITIE 2079

Query: 1892 GINLLYSLKPLFFSS--NLPKKEKQAPS--IMINWTLDTSITYFGVLVPVASTYFVFELH 1947
                L  LK +FFS+  N+ K     P       W L+ +I YFG+L+P+AST+FV ELH
Sbjct: 2080 SFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELH 2139

Query: 1948 MLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVD 2007
            MLL SLTNT   +     +++GQ S+ENILFLI +RSLP+ LSKL+DFSI++STLQ+T  
Sbjct: 2140 MLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTS 2199

Query: 2008 TEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWN-TKMFTGKSDKS 2066
            + +S Q+ESSHFR+C SP+SL+ ++WG  +L +   YY        WN +   TG    +
Sbjct: 2200 SYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTGTKSST 2259

Query: 2067 KEMPIN-FRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFS 2125
             E P+N FRSIHILSY FCIGW+        PG M GY+RLFSAYEK++GK T+++ + S
Sbjct: 2260 SESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMS 2319

Query: 2126 VANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSF 2185
            V N N+S+ FFS+G EK+++NRSFLP+MQI YW K     KD F R HG+ALDV+ + +F
Sbjct: 2320 VTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNF 2379

Query: 2186 MDVIESTLQSMRAFQELKKNIL-------DVSESLRAENDNXXXXXXXXXXXXXXXPFLD 2238
            +++IE   +S + F++ +K+ +          E +++EN                  FL 
Sbjct: 2380 VNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSEN-----------ATEFVPTFLS 2428

Query: 2239 NIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTL 2298
            +I S+N  FKY+GG  RV++ +D+E  S PS E+ +P V+I   YKH +D  KPH  R +
Sbjct: 2429 DINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCV 2488

Query: 2299 ITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVA 2358
            I +  +HN LY+ CAP ++EF ES+Q++++    + K + +K ++ N  YKR+L  FD+A
Sbjct: 2489 IDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDIA 2548

Query: 2359 VKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHI 2418
             ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L +     S++HI
Sbjct: 2549 FRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHI 2608

Query: 2419 FSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSS 2478
            FS+E S SF + F+DLT +FT P   ++Y  GL+SD+ +FFN+KQ QNL LFLDIW  S 
Sbjct: 2609 FSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSE 2665

Query: 2479 ILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRT 2538
             +  RP ++    +              G  IPW F +IFTNV+ D+ LGP+LG++S + 
Sbjct: 2666 SIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKL 2725

Query: 2539 QRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPL 2598
            ++TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV +   +     P+
Sbjct: 2726 EKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPI 2785

Query: 2599 VSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658
            V+  ++I  +A+K AFDYHMF+I  ++NIHF LH+E+D +G LPDLL  +   +EI + S
Sbjct: 2786 VAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICS 2845

Query: 2659 TALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSV 2718
            T LV +NILDIYNTI+R RQD K SY ETL +SN  ++R  I Y DIL+SL LLRTD+ +
Sbjct: 2846 TTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQI 2905

Query: 2719 NISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2778
            ++S  ++QISPISLFD EVLVI ID +S RSET S  KLKT L+LQV + S ALST+KEE
Sbjct: 2906 DVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEE 2965

Query: 2779 LDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKIS 2838
            LDEE    I++ DYM YASKI GGTI+ IPKL V MTT Q+  +N +EY F C F  K+S
Sbjct: 2966 LDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVS 3025

Query: 2839 VRWNLGPVDFIKEMWTTHVKALAVRRSQVAN--ISFGQTXXXXXXXXXXXXXXXXFNYIA 2896
            VRWNLGPV+FIKEMW THVK+LAVR++++        +                 F Y+A
Sbjct: 3026 VRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVA 3085

Query: 2897 LEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            L EP IE+PQI+DL DATPPMEWFG+NRKKFP FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 3086 LVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 123/172 (71%), Gaps = 9/172 (5%)

Query: 9   GVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKINVET 68
            V L+ +K FSWVFLV WILT ++CL M FY+ R++AY ++FIL+WLLW+  K+KI+ E+
Sbjct: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCES 68

Query: 69  LRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNK-------S 119
           +R+SLL  RI FKNL +I ++ TIS+LEG + W+YWLLN R +  EL +  K        
Sbjct: 69  IRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128

Query: 120 SSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEH 171
           S  K  +LPCK   +CEG EIF+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 114/190 (60%), Gaps = 12/190 (6%)

Query: 221 LMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKE-RLDLYRNKTQMEFKN 279
           L F P  LK ++GS++ GNKFTPS++I+SY+S +GI+DVLP    R+DLY+ K +++F+N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 280 FEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTS---- 335
           FEI +K NI Y+D    K       +S+LW  F  +F I                +    
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 336 ------DDNFYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAY 389
                 D++F  KWKGLSLYK +A + + +  + +EFD  NHEYA++ SI+K P++    
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALN-RGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 390 DVDVPGVVPH 399
           + D+PG+VP+
Sbjct: 477 EYDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2233 bits (5786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1160/2888 (40%), Positives = 1747/2888 (60%), Gaps = 80/2888 (2%)

Query: 122  GKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD-- 179
             K  KL    ++ C G EIF+YNR  AY+ +I   SK+E+ +F  +L +H   + F +  
Sbjct: 179  NKNKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVS 238

Query: 180  ---------------------GSSADKLDED-----LSESAYTTNSDASIVNDRDYQETD 213
                                 GSS     E      +S  +   +SD S +++R+     
Sbjct: 239  SEIKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAH 298

Query: 214  IGKHPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKT 273
            I +   L + LP+++  ++G++ +GNKFT S++++++    G++D   P  +LD+++NK 
Sbjct: 299  IMRKLHLDI-LPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKV 357

Query: 274  QMEFKNFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAG 333
              E  + ++SIK+NIGY+  +  +F    G ++++W     V  +               
Sbjct: 358  TFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRY 417

Query: 334  TSDDNFYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDV 393
              D  F  KW GL LYK S   +     DDV+FD  NHEYAK ++  K P++  + + D+
Sbjct: 418  KEDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDI 477

Query: 394  PGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPV 453
            PG+VPHG+HP +    GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV
Sbjct: 478  PGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPV 537

Query: 454  VSRTAKPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRP 513
            +S+  KP+ KL PG  R++++F  ++S+++D++ R+PTRE SKD +FLK Y ET +++R 
Sbjct: 538  ISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRA 597

Query: 514  FGWMDLRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGD 573
            FGW+DL F K +    NI + PT  GF+N     F E E+ +SVNH++L KS   +I  +
Sbjct: 598  FGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAAN 657

Query: 574  IGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVN 633
            IGYPLGWN    WI N+ S+QL+ FLLREHITL++D + DFS  +PTPYELFR F Y +N
Sbjct: 658  IGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLN 717

Query: 634  WEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEIS 693
             ++ GYS Y NVND NI+NNPLDFNENCYLS HGD  + ++T+P  S+   Y  +SYEI 
Sbjct: 718  LKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIF 777

Query: 694  TPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKST 753
            TPMFR+ LNTP WNTL+EFM++KE+GR++DF + G+YL+YSELDIDNVD+L I+  S ST
Sbjct: 778  TPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNST 837

Query: 754  VLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSG 813
            VL+C+GFV++Y+ N + NYFG F  F+T+EEY+ ++    V D     +  DL S ++  
Sbjct: 838  VLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGL 895

Query: 814  YQNSSLKNESED--KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHF 871
             +  S+ N+ ED  +  +KRSDL RT NETDIW  F V DGALILPE +Y+ D C++L F
Sbjct: 896  QKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSF 955

Query: 872  AELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIH 931
             EL ++ R+CNYYMD+   L   ++ R      +E+F++I+  N +   E G +SD+TIH
Sbjct: 956  GELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIH 1014

Query: 932  GHRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTE 991
            GHRMYGLPP E TYFCQW IN+G   IDSD+ F+  F  S  KIGF  ++ EN LLY+++
Sbjct: 1015 GHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESD 1074

Query: 992  TINDMTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTI 1051
            T+NDMT L+V VE +++ L DP++++++ I A SI+   IDFENEKY++R+DV   +   
Sbjct: 1075 TVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYF 1134

Query: 1052 SLNCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLF 1111
            SL+ +  D    + L   TKL  TNF +  +       QR++I +HDSPYHRC FLLP  
Sbjct: 1135 SLDSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEK 1194

Query: 1112 YQDSDTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYAT-LLETTNPFKNIFAE 1170
            +Q+S +Y+ LYG                     +I+E I+ +Y+  LL   +   +I AE
Sbjct: 1195 FQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAE 1254

Query: 1171 TPST-MEPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDP-LLF 1228
              S    P + SF       +   ++F+ +  TED  +E DN+VV+V Y+ + V+P ++F
Sbjct: 1255 LNSVDTTPLKDSF-------DMQITNFQNILTTEDP-YETDNFVVNVKYLTVTVNPDIVF 1306

Query: 1229 IFAKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEE 1288
               K   E     +M   +D IE+ IV RLS+L+E I+S  N+++++  ++  W      
Sbjct: 1307 TIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVC 1366

Query: 1289 GFELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSL 1348
                Y++ + +++S++S   N      ++  L K ++VR+ +        S+DRPP LSL
Sbjct: 1367 FIGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSL 1426

Query: 1349 GIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNT 1408
             +EGFE WSST  +Q+ +LNLTS DIT+DE Q+ WL  Y   Q  L  ++  S   I + 
Sbjct: 1427 MLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDE 1486

Query: 1409 RSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTY 1468
            +++ +   I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTY
Sbjct: 1487 QASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTY 1546

Query: 1469 LPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKH 1528
            LP+DW+  +DE    K+    K+A + F++VFS WRNWE SD+ +SYIY  +F  E  K 
Sbjct: 1547 LPEDWEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKR 1606

Query: 1529 KQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTS---LPSNREETI 1585
               +++  +K  + +FY T+Y   Y  + NF++  AN++++      +   L   +EE +
Sbjct: 1607 ---ILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIV 1663

Query: 1586 EITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKK-ELSKQFKMNTVLLVDKSEL 1644
            ++  ++GS+K +F++ +LKL+  I  I     D KS+  K  ++K FK+N   + D  + 
Sbjct: 1664 DVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDF 1723

Query: 1645 QLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRD 1704
                  + L SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+R+
Sbjct: 1724 NGQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRN 1783

Query: 1705 FSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXX 1764
                 T E  S   +++IN +C++LHF+++  TE  V AI  I+  +  +          
Sbjct: 1784 LFASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGT 1843

Query: 1765 X----------------XXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIY 1808
                                   + K N  LS  F+NVSSE+  L P Y++HE   ++I 
Sbjct: 1844 TDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNIS 1903

Query: 1809 FNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMI 1868
            +N    +E+L+ + DTD ++ S  TKEQY R S+  +E+   +      LI+++IS S++
Sbjct: 1904 YNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSIL 1963

Query: 1869 KLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSI 1928
            KLT S+PRR++ SFLQDEK     +  L SL+ L   +N    E    S    W ++   
Sbjct: 1964 KLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSS--YEWIVNFKS 2021

Query: 1929 TYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIG 1988
             Y GVL+P+ +TY+VFELH  L +++N          K  G  S ++I+FLIK++S+P  
Sbjct: 2022 KYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHK 2081

Query: 1989 LSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRR 2048
             SK+LDFSIK+ST +   + ++SF++ESS FRVCL+P SL++ MWG ++LL L + Y  +
Sbjct: 2082 FSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQ 2141

Query: 2049 HAPN--IWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRL 2106
               N  ++N     G ++  KE   + RS HILSY F IGW++Q    + PGL+LGYNRL
Sbjct: 2142 STVNFFVFNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRL 2201

Query: 2107 FSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELK 2166
            FS YE + GK T+VD FFS+ANG++  TF+S G+E  K+NRS+LPN+QI YW K   ++K
Sbjct: 2202 FSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMK 2261

Query: 2167 DWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXX 2226
              F +FHGE LDVNF  +F+++IEST++S+  FQ LK+  ++     + E D        
Sbjct: 2262 HLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERD----EKSN 2317

Query: 2227 XXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHD 2286
                    P    ++ VN  F YDGG+FR+++   +  K EP+  IKSP V I  +Y + 
Sbjct: 2318 SALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYF 2377

Query: 2287 EDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNV 2346
            E ++K H    LI ++PT N L +GC P L +F   ++ +++    + + N        +
Sbjct: 2378 EKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPI 2437

Query: 2347 DYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSL 2406
            +   LL+ FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   PL+ SL
Sbjct: 2438 NITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISL 2497

Query: 2407 TLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQN 2466
             +   K S+KH FS E S SFEV  +D+ L+FTHP+V   +GTGLV D+ + FN+KQ QN
Sbjct: 2498 KINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQN 2554

Query: 2467 LYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVD 2526
            + +FLDIW  S     +  ++  N  ++  S          + +PW F  I TN++GD++
Sbjct: 2555 ISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDIN 2614

Query: 2527 LGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVK 2586
            +G +LG ++L  QRTW++TDH++ KRQLLH FTD + ++SEGRL G  E+ + +W  +V 
Sbjct: 2615 MGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVN 2674

Query: 2587 WPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQ 2646
            +  +      PLV    ++  +++K AFDYHMFLI T+ ++ FH+ +EKD   +LPDLL 
Sbjct: 2675 YVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLT 2734

Query: 2647 VSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDIL 2706
            V+ + DEI + +TALV +NILDIYNTI+R RQDNK SY+ETL +SN    ++  LY+DIL
Sbjct: 2735 VNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDIL 2794

Query: 2707 RSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVL 2766
            +SL LL+T LS NI    +QISP SL+D EV++IR+  V   +ET +G+K+KTDL+++V 
Sbjct: 2795 KSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVY 2854

Query: 2767 DVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLE 2826
            + + +L++  +EL EE  A ++ + Y+ YAS +  G I +IP+L ++MTT Q      L+
Sbjct: 2855 NATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQ 2914

Query: 2827 YLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXX 2886
            Y ++CSF  K+ V WNLGP++FIKE+W THV++L VR  Q    +   +           
Sbjct: 2915 YTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMG-NHDISLENEGDTDESV 2973

Query: 2887 XXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLA 2946
                   YIALEEP IE+PQI+DL DATPP+EWFG+NRK FP  THQ+ ++P+QKLV +A
Sbjct: 2974 KVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVA 3033

Query: 2947 EKQYVKIL 2954
            +K+Y K+L
Sbjct: 3034 QKEYAKVL 3041

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 83/119 (69%)

Query: 5   SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
           ++   V L+ ++ FSWVFLV WIL VV   T +FY+ +++ + ++F  EWLLWK   IK+
Sbjct: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65  NVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSSSGK 123
            +E++R+S L G I FKN+ +I +D TIS+LE S+TW+YWLLN RK+E   N K+ + K
Sbjct: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSK 124

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2226 bits (5769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1235/3042 (40%), Positives = 1801/3042 (59%), Gaps = 132/3042 (4%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M+A SQ + +P++ + +FSWVFLVDW+L VV+ L+++FY GR  AY ++ +++W+LW+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
            K+KIN+++L++S LGGR+ FKNL+VI KD TIS L+GS TW+YWLLN RK  L E  KS 
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  SGKKAK---LPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPF 177
              K  K   L C+  +E +G E+FIYNRTVAYD ++  ++KD+++ F+K+       E  
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFF------EGG 174

Query: 178  SDG--SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSL 235
             D   SS +KL ED + ++ ++ S+    NDR++QE D      LL FLPI LK +RG++
Sbjct: 175  EDSLHSSEEKL-EDETLASDSSVSNVDSTNDRNFQEQD--SRSMLLQFLPIHLKVNRGAV 231

Query: 236  LLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIG 295
            LLGN  TPSVMI+ YES +G++DV    E+LDLY+ +  ++F N ++ IK NI + D   
Sbjct: 232  LLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENP 291

Query: 296  LKFKIDRGKVSKLWKTFVRVF-QIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKA--- 351
            +K  I   ++S++WK F ++F +                     F+ KW+GL+LY     
Sbjct: 292  IKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNV 351

Query: 352  -----SAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIP 406
                 S GD +  + +++  D+ NHEYAK+T ILK  KV + Y  D+PG+VPHGA  T+ 
Sbjct: 352  TTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTME 411

Query: 407  DIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPP 466
              DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR A P+KKL P
Sbjct: 412  QRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTP 471

Query: 467  GSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTY 526
            GSRRIYT F +++ +MED  WRIPTRESSKD +FLK Y+E+  + RPFGW+D++  K+T 
Sbjct: 472  GSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETD 531

Query: 527  ANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIW 586
                + +CPT+ GF+N    H ++ EIRSSVNHDI  K+    I  D+GYPLGWNS+A W
Sbjct: 532  LFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQW 591

Query: 587  IINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVN 646
            +    S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W ++ YSIYLNVN
Sbjct: 592  VFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVN 651

Query: 647  DHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPW 706
            D NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W
Sbjct: 652  DANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSW 711

Query: 707  NTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLT 766
            +TL+EFMK+KEVGR+YDF + GSY  +S++D+ N+DT++IEC SK T L C GFV+RYL 
Sbjct: 712  STLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLM 771

Query: 767  NVKMNYFGEFFNFVTSEEYTGVLG-------AREVGD-VTTKSSVADLASTVDSGYQNSS 818
            N+ MNYFG+F +F T+EEYT  L        A  + D V+ +SS     S V +  + + 
Sbjct: 772  NINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTE 831

Query: 819  LKNESEDKGP-MKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVD 877
                  ++ P +KR+DLKR  NE D+WFTF V DG L+ PE IY    CI LHF  L VD
Sbjct: 832  YDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVD 891

Query: 878  FRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYG 937
             R  NYYMD+ A L+ T IKRH       +FD +R   G  +   G LS+L IH HRM+G
Sbjct: 892  LRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFG 951

Query: 938  LPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMT 997
            LP  E TYFC+WD  +G L IDSDI+F KG   +F KIGFGY D EN+L+Y+     DMT
Sbjct: 952  LPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMT 1011

Query: 998  SLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTI------ 1051
            SLT+  + I   + D        +  + I  ++IDFENE+YS ++  KIP + +      
Sbjct: 1012 SLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKS 1071

Query: 1052 SLNCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLF 1111
            S N V G         FET L    F Q +D D  R+ QR +IT+HDSPYHRC FLLP+ 
Sbjct: 1072 SKNEVQG--------LFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQ 1123

Query: 1112 YQDSDTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAET 1171
            YQ +  Y  L+G                      I E ++G++    E  +   N   ET
Sbjct: 1124 YQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSD-ANYSKET 1182

Query: 1172 PSTMEPS---RASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLF 1228
              T E S   + S S     E +  S   P ++  +   E D++++++   ++ ++P   
Sbjct: 1183 AITEENSSFIQGSGSTSALKELSSYSQNCP-SYKLEPKFEYDSFIINLGKTIIAINPS-- 1239

Query: 1229 IFAKSLLEQLYSENMVQVLDDI----EIGIVKRLSNLQEGITSISNIDI----------- 1273
              ++  L  +Y +  V  +DDI    EI IV++ S      ++++N+ +           
Sbjct: 1240 --SEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGS 1297

Query: 1274 -----HIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRV 1328
                  ++  + ++ E      +L   +I  Q +   LE        EV +  K  ++  
Sbjct: 1298 PKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINF 1352

Query: 1329 TVNQKK-NPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEY 1387
             +NQ++  P       P  S+  E  E WS + +   NSLN  + D  ++ SQ+EWL +Y
Sbjct: 1353 FINQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDY 1412

Query: 1388 CSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSK 1447
                     ++  SF+  +      + ELI +   AS  Y I HD  VITKPA+I RLSK
Sbjct: 1413 LRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSK 1472

Query: 1448 GHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWE 1507
             H+RENRSW+IITRLRHIL YLP  W    +E LK++++    DA++ F+ +FS WR+WE
Sbjct: 1473 NHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWE 1532

Query: 1508 FSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLV 1567
            FSDV + YIY ++F + + K K  +     K  +     ++    +E E   VV +   V
Sbjct: 1533 FSDVQKCYIYKRVFLSRSMK-KNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSV 1591

Query: 1568 VDLTPPVTSLP--------SNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDD 1619
            +      +SLP        S   E + I+  + S++G   D ++KL  +   ++ + + +
Sbjct: 1592 ISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTN 1651

Query: 1620 -KSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGS 1678
             K+   K   K   +  VLLVD+++  + +D  +L+ R+   R S   E +   +    S
Sbjct: 1652 LKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVS 1711

Query: 1679 LVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTIL-INNQCADLHFRAMSST 1737
            L      SE W++H S +L E+ L+D   L  +++  H+  I  +  +   L   AM+ST
Sbjct: 1712 LAATCASSEAWVRHGSAVLLESSLKD-GALNFSQSLFHEHLITKVVLRSGGLSVSAMAST 1770

Query: 1738 EQLVTAITEIRESLMMIXXXXXXXXXXXXXSQF------VDQKINTV-LSCYFSNVSSEV 1790
            EQ +  I  I+ S+  I             +           ++NTV L    S  S  +
Sbjct: 1771 EQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNI 1830

Query: 1791 MPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIE-IKG 1849
             PL+PF I      ++++  K       ++I D D  + S ++K++YL+FS   +  +  
Sbjct: 1831 QPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVIS 1890

Query: 1850 GISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLP 1909
                +    +NV ++  + KLT S+PR  + S ++DE LA +    L SL   F S N  
Sbjct: 1891 NTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKN-Q 1949

Query: 1910 KKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEET---K 1966
            +K KQ     I W L  ++ Y G++V + S  +V EL+ +L SL+N  +     E     
Sbjct: 1950 EKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHG 2009

Query: 1967 VTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPD 2026
            + G FSIEN+L LI    L   LSKL+D ++ +   Q   D  Q+ Q+ESSHFRV L P 
Sbjct: 2010 IVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPM 2069

Query: 2027 SLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIG 2086
            SL +++W  ++   +S  Y  R +  +   K  T  +D S E+   FRSI ILSY FCIG
Sbjct: 2070 SLTKVLWAINEFTRVSEAYKTRSS--LLQHKK-TAPTDIS-ELSNKFRSIQILSYNFCIG 2125

Query: 2087 WIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYN 2146
            WIF  G+ ++PGL+ GY RLF+AY+K +GK T++DA+FS+A+G +S TFFS G EKD++N
Sbjct: 2126 WIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFN 2185

Query: 2147 RSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNI 2206
            RS+LP+MQI YWF + G+  + F R  GE LDVNF+ S + +    ++S++ FQELKK +
Sbjct: 2186 RSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTM 2245

Query: 2207 LDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKS 2266
            +D   +      N               P L  IR+ N   KY GGVF++++ EDI+  S
Sbjct: 2246 VDPFAT------NKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNS 2299

Query: 2267 EPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKM 2326
            +PSFE++SP V +   YKH  D +K H  R L+TVDP++NTL+  C P+L   ++ ++ M
Sbjct: 2300 KPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNM 2359

Query: 2327 IKKHSTDEKPNFTKP-SSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFE 2385
            +K  ++  KP+     SS  ++YK+LL  FD+A  +   KQ +SLSCEPKAKVQADVGFE
Sbjct: 2360 LKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFE 2419

Query: 2386 SFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVIS 2445
                 M TN  D+ +PL  S+ +EH +A+ +HIFSREVSTSF++  +D   + THP++I 
Sbjct: 2420 KLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQ 2479

Query: 2446 MYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSIL-------HTRPVQRTVNKEIEMSSL 2498
             YGT LVSD+ ++FN+KQLQ+L LFLDIW+  S +       +TR    + + ++ +S  
Sbjct: 2480 TYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKF 2539

Query: 2499 TSTNYADAGTE-IPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHA 2557
                   AGT   PW +TLIF+N+ GD+DLGPSLG++S+R  R+W  +DH+ + RQ L  
Sbjct: 2540 QKP----AGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSV 2595

Query: 2558 FTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYH 2617
            F + I L+S+GRL G   +    W SE+ WP +      PL+S SL +  +A+K +FDYH
Sbjct: 2596 FLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYH 2655

Query: 2618 MFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMR 2677
            MFLI  + ++   L+NE+D  G+L DLL VS +  +I L  TAL  AN +DIYNTI+RMR
Sbjct: 2656 MFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMR 2715

Query: 2678 QDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEV 2737
            QDNK SY+ETL+DSN   ++     +++L SL LLRTDLSV I    +Q+ P +LFD+EV
Sbjct: 2716 QDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEV 2775

Query: 2738 LVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYAS 2797
            LV++ + +S  ++T    K+KT L  Q+ +   +LS  K + +EE+ + I + +Y+ +A+
Sbjct: 2776 LVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHAT 2835

Query: 2798 KIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHV 2857
            K+ GGTI+  P + V MTT QE  +N +E L+  SF  K+ V+WNLGP++FI+EMW THV
Sbjct: 2836 KVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHV 2895

Query: 2858 KALAVRR---SQVANISFGQTXXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDAT 2914
            +ALA+RR    +  N SF +                 + YI LEEP+IE+PQI+DLGDAT
Sbjct: 2896 RALALRRVHDMRDKNKSFFED-EHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDAT 2954

Query: 2915 PPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956
            PP+EWFGVNR++FP  THQ+ V+P+QKL ++AE++Y ++L +
Sbjct: 2955 PPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1947 bits (5044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1098/3016 (36%), Positives = 1696/3016 (56%), Gaps = 121/3016 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
            SQ + V L+  +DFSWVFLVDW+L + V L   FY GR++ Y ++F+LEWL WKR K+KI
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   NVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSSSGKK 124
            ++++L++S LGGRI FKNL+V+ ++ T S L+GS+TW+YWLLN RK    + +++     
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122

Query: 125  AKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSAD 184
             KLPC+  VEC+GLE FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S D
Sbjct: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSVD 180

Query: 185  K----LDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240
            +        L  S  + +S +  +NDR +Q  D    P  L  LP+E    +G++++GNK
Sbjct: 181  EDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGNK 238

Query: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300
             + SVM+LSYE   G++D   P  ++DLY+ K + EF+ F IS+K N+  +    LK  +
Sbjct: 239  TSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFV 298

Query: 301  DRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360
             R K+SKLW    ++F              SA     N   +W+GL LY     +  A+ 
Sbjct: 299  KRSKLSKLWHRSYQLF-FKTDSPSSKNPANSAKDGTRNPLKRWRGLGLY---WKEEDAAW 354

Query: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420
             D  +FDL+ HEYA++T ++KC  + + Y  D PG+VPHGA PT   +DGPDVGN+G PP
Sbjct: 355  DDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPP 414

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480
            D+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR ++P+++L PGS+RIYT  R++I 
Sbjct: 415  DYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSIL 474

Query: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540
            I+ ++ WRIPTRE+SKD EFLK ++ET +E RPFGW+++   + +   FNI++CPT  GF
Sbjct: 475  IVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGF 534

Query: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
             N   +HF++ EIR+SVNHDILL ++   +   +GYPLGWN KA W+ +  S Q + F+L
Sbjct: 535  DNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFIL 594

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            ++HITL+ D +SDF +G+PTPYELFRPF Y  NW   GYSIYLNVND NIVNNP++FNEN
Sbjct: 595  KDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNEN 654

Query: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLS HGD L ++  VP+E+I G  T ++YE+ TP+FR+ +NTP WNTL+EFMK KEVGR
Sbjct: 655  CYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGR 714

Query: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            + +F++ GSYL +S+LD+DN+DT++IEC SKST L CYG+V+RY   VKMNYFG+F +F 
Sbjct: 715  SANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFK 774

Query: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPM--KRSDLKRTT 838
            T+EEY   L        TT  S  ++        ++SS + E   K P+  K++ LKR  
Sbjct: 775  TTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSS-QREQHIKDPLTAKKTSLKRMV 833

Query: 839  NETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKR 898
            NE D+WFTF V DG  ILPE +Y  D C AL F  L +D R  NYYMD+ A L+   I+R
Sbjct: 834  NEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRR 893

Query: 899  HVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCI 958
             +     EVF+   R     E   G LS L IH HRM+GLPP E TYFC+WD +LG L +
Sbjct: 894  LIDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDL 952

Query: 959  DSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQ 1018
             SD+ F  GF N++ K+GFG+ D ENI+ Y    I DMTS+T+ ++ I +   D +    
Sbjct: 953  SSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAI-VFCTDKIKDET 1011

Query: 1019 SV-ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNF 1077
            ++ ++A+ I     D EN  YS R+D+ +  LT S+  +  +  + +   F T ++ +NF
Sbjct: 1012 AIQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNF 1069

Query: 1078 EQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXX 1137
             Q +D+     +Q+ +I  +D+P+HRCPFL+PL  Q+S  Y+ L+G              
Sbjct: 1070 CQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVP 1129

Query: 1138 XXXXXXXYIIEDIV-GEYAT--LLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPS 1194
                    + +  +  E A+   ++   P   +  +  S+++  +       +D  +  S
Sbjct: 1130 LQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSS 1189

Query: 1195 SFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGI 1254
            SF    F      E +  VV++    L + P  +    + +EQ + + + Q +D+IE+ +
Sbjct: 1190 SFSDPTF------EHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDV 1243

Query: 1255 VKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLE------- 1307
            V     +     +  NI + +  L+++++   +E       ++    ++ SL+       
Sbjct: 1244 VLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGL 1303

Query: 1308 --KNRTNKLLEVAALAKVKTVRVTVNQK--KNPDLSE-DRPPALSLGIEGFEVWSSTEDR 1362
                  N   +  +L K++++ + V  K  K    +E D   A    ++  E WS     
Sbjct: 1304 KLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGI 1363

Query: 1363 QVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTA 1422
              +SL L S + ++   +  WL ++     N  +++    +        ++ E   +++ 
Sbjct: 1364 ADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISK 1423

Query: 1423 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLK 1482
            AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP    S+I   LK
Sbjct: 1424 ASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLK 1483

Query: 1483 EKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMG 1542
              +Y     A+  F+ +FS W NW++SDV + Y+Y ++FT  N        +   K   G
Sbjct: 1484 NSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFT--NTLDDTVAHESSTKIETG 1541

Query: 1543 SFYLTVY-----GEGYEVEHNFVVADA-NLVVDLTPPVTSLPSNREETIE--ITGRVGSV 1594
            +F L  +     G    +  N           D      S  SN E+ +E  ++  +   
Sbjct: 1542 TFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKA 1601

Query: 1595 KGKFSD----RLLKLQDLIPL---IAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLV 1647
            +   SD    +LL +++L       AAV E++K          F+  T  LVD+ ++QL+
Sbjct: 1602 QISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-------LPAFQQYTA-LVDRCDIQLL 1653

Query: 1648 MDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSV 1707
                +   ++ G  ++++ EN K   + A S        E  ++H + IL +A  R  +V
Sbjct: 1654 CGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTILLDAFSRSSAV 1712

Query: 1708 LATTEAWSHKPTIL-INNQCADLHFRAMSSTEQLVTAITEIRES-----LMMIXXXXXXX 1761
             A    +S K +   ++ +      +  S ++   T I  + ES     L +        
Sbjct: 1713 GA--HGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALGPNTGFLE 1770

Query: 1762 XXXXXXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSI 1821
                  ++ V  +    L+   S++++++  LS   I    K+L + + +  S+ + L+ 
Sbjct: 1771 KPHSAATEKVAPQF--ALNIDISDLTTDISLLSSLAITKNFKKLTLAYEQSASSALKLAF 1828

Query: 1822 WDTDFFMTSHQTKEQYLRFSFGDIEIK-GGISREGYSLINVDISISMIKLTFSEPRRIVN 1880
               D  + S +T +QYL+ S  +I        +   S   V +  ++ KL   +PR I  
Sbjct: 1829 ETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITL 1888

Query: 1881 SFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPS-------IMINWTLDTSITYFGV 1933
               +D    +Q    L SLK  F   N  K +K   S          +W     + Y G+
Sbjct: 1889 PLGKD---IAQAKACLASLKSCFGKLN-TKNDKDIMSQGNTKFNFSASWIFQVRLNYVGL 1944

Query: 1934 LVPVASTYFVFELHMLLLSLTN---TNNGMLPEETKVTGQFSIENILFLIKERSLPIGLS 1990
            L+P+ ST ++ EL+ +   +T    TN      +  + G  S  +I FLI +R LP  LS
Sbjct: 1945 LIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALS 2004

Query: 1991 KLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHA 2050
            +++DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++  ++L  LS    R+  
Sbjct: 2005 RVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQTV 2064

Query: 2051 PNIWNTKMFTGKSDKSKEMPIN------FRSIHILSYKFCIGWIFQYGAGSNPGLMLGYN 2104
                      GK  +S E+         FRS+ +LSY FC+GWIF       PGL+ GY 
Sbjct: 2065 ----------GKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQ 2114

Query: 2105 RLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGE 2164
            RLF+A+EK +GK T++DA+FS+A G+TS  F++  N  +  NRSFLP+MQI YW +  G 
Sbjct: 2115 RLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGL 2174

Query: 2165 LKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXX 2224
              + F R +GE LDV F+   +DV    ++S+  F ELKK  +D  +S+           
Sbjct: 2175 TDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSV------ANPKR 2228

Query: 2225 XXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYK 2284
                      P L  I+ V+   +Y GGVFR+Y+ +D++ ++ PSF+++SP V I   Y+
Sbjct: 2229 PSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYR 2288

Query: 2285 HDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKK-HSTDEKPNFTKPSS 2343
                    H  R  + V  +HNT++  C P+L E +  +++++K  + + ++ +    S 
Sbjct: 2289 RMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKSVSQ 2348

Query: 2344 QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLE 2403
            +++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE     + TN+ D  +PL 
Sbjct: 2349 ESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLS 2408

Query: 2404 FSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQ 2463
             S+ +    A  +HIFSREVSTS ++  +    + THPD I  YG   + ++ V+FN+KQ
Sbjct: 2409 LSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQ 2468

Query: 2464 LQNLYLFLDIWRFSSILHTRPV-----QRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIF 2518
            LQ+L +F++IW+  S + T+P       R +  E E   +       + T  PW F LI 
Sbjct: 2469 LQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSE-EKPLVAKFKKVSSTTSFPWNFILII 2527

Query: 2519 TNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVAN 2578
            + + GD+DLG SLG++SL T R W  TDHY++  Q L    + I L+S+GRL G   + N
Sbjct: 2528 SKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRN 2587

Query: 2579 ASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAK 2638
             SW+S ++WP  +     PLV+  + +D+  +K +FDYH+ LI ++  +   L N++D +
Sbjct: 2588 FSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPR 2647

Query: 2639 GVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQ 2698
            G+  +LL V+ SS+   L  TAL  ANILD+YNTI+RMR+DN+ SY ETL DSN  ++R 
Sbjct: 2648 GISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTRS 2707

Query: 2699 PILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLK 2758
                KDIL SL  LRT+L V++    +QI P  LFD+EVL  +      +S+    +KLK
Sbjct: 2708 ASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLK 2767

Query: 2759 TDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQ 2818
            T L+ Q+  V  ALS  K +L E+  + I + +Y+ +A K  GGTI+ IP + + MTT  
Sbjct: 2768 THLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWH 2827

Query: 2819 EEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXX 2878
            +  TN +E L++ SF  KI +RWNLG ++F++EMW THV+A+A+RRS             
Sbjct: 2828 DVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFFEDEH 2887

Query: 2879 XXXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIP 2938
                         + Y+ LEEP IE+PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P
Sbjct: 2888 LEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVP 2947

Query: 2939 VQKLVYLAEKQYVKIL 2954
            +QKL ++AE ++ +IL
Sbjct: 2948 LQKLAHIAETEWARIL 2963

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1909 bits (4944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1103/3006 (36%), Positives = 1670/3006 (55%), Gaps = 126/3006 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
            S+ R VP++  +DFSWVFL DW+L + V L   FY GR+  Y ++ ILE+L WKR  +K+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSSSGKK 124
                       GR+ FKNL+VI +D T S+L GS+TW+YWLL+ RK  L    +S S K 
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----ESQSEKA 107

Query: 125  AKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFS------ 178
            AKLPC+  +EC+GLE FIYNRT A+DN+++ L +++++  +K+ ++   P P +      
Sbjct: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSD---PSPRATEETST 164

Query: 179  -DGSSADK--LDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSL 235
             + S+A K  L+  +S  + +T S    +NDR YQ  +    P  L  LP+E    +G+L
Sbjct: 165  ENDSAAQKSHLETSMSSPSASTES----LNDRTYQLPN--SMPSFLRLLPLEYSVQKGAL 218

Query: 236  LLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIG 295
            ++GNK T SVM+ S+E  KG +D   P  ++DLY+ K Q +   F++S++ N+ YD+   
Sbjct: 219  IIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEP 278

Query: 296  LKFKIDRGKVSKL----WKTFVRVFQIXXXXXXXXXXXXSAGTSDD--NFYHKWKGLSLY 349
            LK      ++ KL    ++TF+RV +             +  T  D  N   +W+GL LY
Sbjct: 279  LKNLPKANRLPKLLHKYYETFLRVRK-----RYLSRGSKTESTRKDLRNPLERWRGLGLY 333

Query: 350  KASAGDAKASDLDDV-EFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDI 408
                  A     DDV  F+L  HEYA+++ ++KC  + I Y  D PGVVPHGA PT+  +
Sbjct: 334  WKENDPA----WDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPL 389

Query: 409  DGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGS 468
            DGPDVGN GAPPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR + P ++L  GS
Sbjct: 390  DGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGS 449

Query: 469  RRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYAN 528
             R++T  R++I IM D+ WRIPTRE SKD +FLK YKET ++ RPFGW++L   + +   
Sbjct: 450  TRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVR 509

Query: 529  FNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWII 588
             NI++CPT  GF N   +HF++ EIR+SVNHDILL ++  DI+  IGYPLGWN+KA W  
Sbjct: 510  LNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNF 569

Query: 589  NMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDH 648
            ++KS Q   F+L++HITL+ D LSDF  GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND 
Sbjct: 570  DLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDA 629

Query: 649  NIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNT 708
            NIVNNP+DFNENCYLS HGD L I   VP++SI G  T + Y + TP+FR+ +NTP WNT
Sbjct: 630  NIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNT 689

Query: 709  LNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNV 768
            L+EFMK KEVGRA DF++ GSYL +S+LD++N+DT++IEC S+ T L CYG+V+R+L  V
Sbjct: 690  LHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGV 749

Query: 769  KMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGY---QNSSLKNESED 825
            KMNYFG+F +F T+EEY   L    V         A+   T  +G    + ++ KN + D
Sbjct: 750  KMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTD 809

Query: 826  KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYM 885
                K+  LKR  NE D+WFTF V DG LILP+ +Y  + C A  F  L +D R  NYYM
Sbjct: 810  PVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYM 869

Query: 886  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTY 945
            D+ A L+   ++         +F              G +SDL IH HRM+GLPP E TY
Sbjct: 870  DLQAALSPVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETY 928

Query: 946  FCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEK 1005
            FC+WD ++G L I SD+  I  F +++ K+ F + D ENI+ Y    I DMTS+  H  +
Sbjct: 929  FCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGE 988

Query: 1006 IRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSF 1065
            IR+ + D  +    ++  E++    +DFENE+YS R DV I  +T+    V   G D S 
Sbjct: 989  IRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSL 1045

Query: 1066 L-KFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGX 1124
            +  F + L+ T F Q K+      +Q+ +I  +D+P+HRC FLLPL  Q SD Y+ L G 
Sbjct: 1046 IGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGS 1105

Query: 1125 XXXXXXXXXXXXXXXXXXXXYIIEDIV-GEYATLLETTNPFKNIFAETPSTMEPSRASFS 1183
                                 I+++ + GE  +L      F +   E       +    S
Sbjct: 1106 IVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMS 1165

Query: 1184 EDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENM 1243
              +ND                 N E ++ VV +      +        +S  +Q YS  +
Sbjct: 1166 STENDS----------------NVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFV 1209

Query: 1244 VQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSE 1303
             Q++D  EI +V              N+ +      +     G +      D +D  + E
Sbjct: 1210 EQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKE 1269

Query: 1304 KSLE----------KNRTNKLLEVAALAKVKTVRVTV-NQKKNPDLSEDRPPAL-SLGIE 1351
             S++           +  + + ++ AL KV+++ + V N  +N  L       L S  I+
Sbjct: 1270 ISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIK 1329

Query: 1352 GFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSN 1411
              E W ++ED + +S N TS D  +   + E    +  +    I  +    +  +     
Sbjct: 1330 DLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQK 1389

Query: 1412 SKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPD 1471
            ++ +   +++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP 
Sbjct: 1390 AQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPP 1449

Query: 1472 DWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQ- 1530
               + I   LK   + +  +A  IF+++FS WR+WE SDV + Y+Y K F ++ E     
Sbjct: 1450 SLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGP 1509

Query: 1531 -NLIKKLLKCTMGSFYLTVYGEG--YEVEHNFVVADANLVVDLTPPVTSL-PSNREETIE 1586
             NL  ++  C+  +   + + EG    V+   ++    L  ++   + ++      +   
Sbjct: 1510 LNLRVEVDSCS-ATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNS 1568

Query: 1587 ITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKEL--SKQFK-MNTVLLVDKSE 1643
            ++  + +VK   S+  +KL     L  +    D     + L   K  K M   LL+D+ E
Sbjct: 1569 LSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCE 1628

Query: 1644 LQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLR 1703
            +++ +D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A  R
Sbjct: 1629 IKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFAR 1688

Query: 1704 DFSVLATTEAWSHKPTI-LINNQCADLHFRAMSSTEQLVTAITEIRESLMMIXXXXXXXX 1762
              S L +  + S   T+  ++     L  +  SST+     I  + ES   +        
Sbjct: 1689 RGS-LGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNT 1747

Query: 1763 XXXXXSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIW 1822
                 S  +          +  + +SE+  LSP  I    K L + F K  ++ + L + 
Sbjct: 1748 RSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVE 1807

Query: 1823 DTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN-VDISISMIKLTFSEPRRIVNS 1881
            + D  + S  T +QYL+ S   +E+   I  +   + + + +  ++ K    +PR I+ +
Sbjct: 1808 NFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIET 1867

Query: 1882 FLQDEKLASQGINL----LYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPV 1937
              QD   A Q +      L +L  LF + +  ++          W     + Y G+LVP+
Sbjct: 1868 LTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPL 1927

Query: 1938 ASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSI 1997
             +T ++ E++ L  SL+            V G+ S+  I FLI ++ LP  LSK+L+F+ 
Sbjct: 1928 GTTSYISEINELSSSLSCDEAAEFSFPL-VHGELSVAGISFLINDKELPEDLSKVLEFAF 1986

Query: 1998 KVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTK 2057
            ++   +   ++ +S Q+ES+HFR+ L P SL+R++  A++   LS   + +    +    
Sbjct: 1987 RIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGV---- 2042

Query: 2058 MFTGKSDKSKE---MPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDF 2114
                 SD +K+   +   F SI ILSY FC+GWIF     SN GL  GY RLF+A+EK +
Sbjct: 2043 ---KSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPY 2099

Query: 2115 GKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHG 2174
            GK T++DA+F +A G+TS+ F+ + +E D+ NRS LP+MQI YWF+  G   + F R +G
Sbjct: 2100 GKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRING 2159

Query: 2175 EALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXX 2234
            E LDV+F+   + +     +S+  FQELK+  LD     + E                  
Sbjct: 2160 ERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLD---PFKPEE---PVKRVPAGSAFSKL 2213

Query: 2235 PFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHK 2294
            P L +I  VN   +Y GGVF++Y+ +DI+ K+ PSF+++SP V +   Y       + H 
Sbjct: 2214 PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHL 2273

Query: 2295 FRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIK--KHSTDEKPNFTKPSSQNVDYKRLL 2352
             R L++VD +HNTL+  C P++ E +  +++++K    S+ E P  T    + ++Y+ LL
Sbjct: 2274 LRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPR-TSNMQEGINYRSLL 2332

Query: 2353 DQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTK 2412
               D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD  +PL  SL + +  
Sbjct: 2333 QDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNIT 2392

Query: 2413 ASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLD 2472
            A+ +HIFSREVSTS  +  +    + THPD I  YG   +  + V+FN+KQLQ+L +F++
Sbjct: 2393 ATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFIN 2452

Query: 2473 IWRFSSILHTRPV--QRTVNKEIEMSSLTSTNYAD--AGTEIPWCFTLIFTNVSGDVDLG 2528
            IW+  S + ++P    + V     +    ++ Y    + +  PW F +I + + G++DLG
Sbjct: 2453 IWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLG 2512

Query: 2529 PSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWP 2588
             SLG++SL T++ W  TDHY++  Q L    D +SL+S+GRL G F + N  W+S++KWP
Sbjct: 2513 ISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWP 2572

Query: 2589 PEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVS 2648
              +     PLV  ++ +D+ AVK  FDYH+ LI ++  +   L N++D +GV+ +LL VS
Sbjct: 2573 LNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVS 2632

Query: 2649 FSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRS 2708
             SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  +++      +IL S
Sbjct: 2633 LSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSS 2692

Query: 2709 LKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDV 2768
            L  LRT+LSV +    +Q+ P +LFD+EV+  +    S  S+T   KKLKT L+L+V +V
Sbjct: 2693 LSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNV 2752

Query: 2769 SAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYL 2828
              ALST K +L E V + I + +Y+ +ASK+ GGTI+  P + + MTT  +  TN +E L
Sbjct: 2753 KLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELL 2812

Query: 2829 FACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXXXX 2888
            ++ SF  KI VRWNLG ++F++EMW TH +A+A+RRS                       
Sbjct: 2813 YSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDL 2872

Query: 2889 XXXFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEK 2948
               + YI LEEP IE+PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL +LAE 
Sbjct: 2873 GDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAES 2932

Query: 2949 QYVKIL 2954
            ++ +IL
Sbjct: 2933 EWARIL 2938

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1753 bits (4539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1018/2798 (36%), Positives = 1542/2798 (55%), Gaps = 95/2798 (3%)

Query: 204  VNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPK 263
            +NDR YQ  +    P  L  LP+E    +G+L++GNK T SVM+ S+E  KG +D   P 
Sbjct: 11   LNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPD 68

Query: 264  ERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKIDRGKVSKL----WKTFVRVFQIX 319
             ++DLY+ K Q +   F++S++ N+ YD+   LK      ++ KL    ++TF+RV +  
Sbjct: 69   TKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRK-- 126

Query: 320  XXXXXXXXXXXSAGTSDD--NFYHKWKGLSLYKASAGDAKASDLDDV-EFDLTNHEYAKF 376
                       +  T  D  N   +W+GL LY      A     DDV  F+L  HEYA++
Sbjct: 127  ---RYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPA----WDDVFHFELPKHEYARY 179

Query: 377  TSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYG 436
            + ++KC  + I Y  D PGVVPHGA PT+  +DGPDVGN GAPPDF+LD+Q+ G +I YG
Sbjct: 180  SKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYG 239

Query: 437  PWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSK 496
            PWA  ++  +Q+V SPVVSR + P ++L  GS R++T  R++I IM D+ WRIPTRE SK
Sbjct: 240  PWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSK 299

Query: 497  DPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSS 556
            D +FLK YKET ++ RPFGW++L   + +    NI++CPT  GF N   +HF++ EIR+S
Sbjct: 300  DLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTS 359

Query: 557  VNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSA 616
            VNHDILL ++  DI+  IGYPLGWN+KA W  ++KS Q   F+L++HITL+ D LSDF  
Sbjct: 360  VNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGT 419

Query: 617  GDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTV 676
            GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+DFNENCYLS HGD L I   V
Sbjct: 420  GDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRV 479

Query: 677  PRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSEL 736
            P++SI G  T + Y + TP+FR+ +NTP WNTL+EFMK KEVGRA DF++ GSYL +S+L
Sbjct: 480  PQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKL 539

Query: 737  DIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGD 796
            D++N+DT++IEC S+ T L CYG+V+R+L  VKMNYFG+F +F T+EEY   L    V  
Sbjct: 540  DVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEP 599

Query: 797  VTTKSSVADLASTVDSGY---QNSSLKNESEDKGPMKRSDLKRTTNETDIWFTFSVWDGA 853
                   A+   T  +G    + ++ KN + D    K+  LKR  NE D+WFTF V DG 
Sbjct: 600  KANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGC 659

Query: 854  LILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRR 913
            LILP+ +Y  + C A  F  L +D R  NYYMD+ A L+   ++         +F     
Sbjct: 660  LILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG-SE 718

Query: 914  NNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFY 973
                     G +SDL IH HRM+GLPP E TYFC+WD ++G L I SD+  I  F +++ 
Sbjct: 719  GRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWS 778

Query: 974  KIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDF 1033
            K+ F + D ENI+ Y    I DMTS+  H  +IR+ + D  +    ++  E++    +DF
Sbjct: 779  KLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDF 838

Query: 1034 ENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFL-KFETKLRFTNFEQYKDIDKKRSEQRR 1092
            ENE+YS R DV I  +T+    V   G D S +  F + L+ T F Q K+      +Q+ 
Sbjct: 839  ENERYSSRADVDIHSITVQ---VKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKS 895

Query: 1093 YITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIV- 1151
            +I  +D+P+HRC FLLPL  Q SD Y+ L G                      I+++ + 
Sbjct: 896  HIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLK 955

Query: 1152 GEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDN 1211
            GE  +L      F +   E       +    S  +ND                 N E ++
Sbjct: 956  GEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDS----------------NVESES 999

Query: 1212 YVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNI 1271
             VV +      +        +S  +Q YS  + Q++D  EI +V              N+
Sbjct: 1000 LVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNV 1059

Query: 1272 DIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLE----------KNRTNKLLEVAALA 1321
             +      +     G +      D +D  + E S++           +  + + ++ AL 
Sbjct: 1060 KVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALV 1119

Query: 1322 KVKTVRVTV-NQKKNPDLSEDRPPAL-SLGIEGFEVWSSTEDRQVNSLNLTSSDITIDES 1379
            KV+++ + V N  +N  L       L S  I+  E W ++ED + +S N TS D  +   
Sbjct: 1120 KVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSD 1179

Query: 1380 QMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKP 1439
            + E    +  +    I  +    +  +     ++ +   +++ AS+ YQI HDP VITKP
Sbjct: 1180 KTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKP 1239

Query: 1440 AFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSV 1499
            A+I RL   HVREN+SWKIITRLRHIL YLP    + I   LK   + +  +A  IF+++
Sbjct: 1240 AYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNI 1299

Query: 1500 FSTWRNWEFSDVARSYIYGKLFTAENEKHKQ--NLIKKLLKCTMGSFYLTVYGEG--YEV 1555
            FS WR+WE SDV + Y+Y K F ++ E      NL  ++  C+  +   + + EG    V
Sbjct: 1300 FSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDSCS-ATVSDSTHKEGDMIAV 1358

Query: 1556 EHNFVVADANLVVDLTPPVTSL-PSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAA 1614
            +   ++    L  ++   + ++      +   ++  + +VK   S+  +KL     L  +
Sbjct: 1359 KGLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFES 1418

Query: 1615 VGEDDKSDPKKEL--SKQFK-MNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKD 1671
                D     + L   K  K M   LL+D+ E+++ +D      ++ G  +S    + + 
Sbjct: 1419 QNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTES 1478

Query: 1672 STSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTI-LINNQCADLH 1730
            +     S+ +     E  ++H + I+ +A  R  S L +  + S   T+  ++     L 
Sbjct: 1479 ARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGS-LGSFISQSESTTLHRVHLGSQKLR 1537

Query: 1731 FRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTVLSCYFSNVSSEV 1790
             +  SST+     I  + ES   +             S  +          +  + +SE+
Sbjct: 1538 LKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEI 1597

Query: 1791 MPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG 1850
              LSP  I    K L + F K  ++ + L + + D  + S  T +QYL+ S   +E+   
Sbjct: 1598 SALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAK 1657

Query: 1851 ISREGYSLIN-VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINL----LYSLKPLFFS 1905
            I  +   + + + +  ++ K    +PR I+ +  QD   A Q +      L +L  LF +
Sbjct: 1658 IHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGT 1717

Query: 1906 SNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEET 1965
             +  ++          W     + Y G+LVP+ +T ++ E++ L  SL+           
Sbjct: 1718 DSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPL 1777

Query: 1966 KVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSP 2025
             V G+ S+  I FLI ++ LP  LSK+L+F+ ++   +   ++ +S Q+ES+HFR+ L P
Sbjct: 1778 -VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCP 1836

Query: 2026 DSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKE---MPINFRSIHILSYK 2082
             SL+R++  A++   LS   + +    +         SD +K+   +   F SI ILSY 
Sbjct: 1837 FSLIRILSLAYEATHLSGLQALKDNAGV-------KSSDDAKDFFNISQTFHSIQILSYD 1889

Query: 2083 FCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEK 2142
            FC+GWIF     SN GL  GY RLF+A+EK +GK T++DA+F +A G+TS+ F+ + +E 
Sbjct: 1890 FCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEV 1949

Query: 2143 DKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQEL 2202
            D+ NRS LP+MQI YWF+  G   + F R +GE LDV+F+   + +     +S+  FQEL
Sbjct: 1950 DRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQEL 2009

Query: 2203 KKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDI 2262
            K+  LD     + E                  P L +I  VN   +Y GGVF++Y+ +DI
Sbjct: 2010 KRQYLD---PFKPEE---PVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDI 2063

Query: 2263 ETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSES 2322
            + K+ PSF+++SP V +   Y       + H  R L++VD +HNTL+  C P++ E +  
Sbjct: 2064 KRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALD 2123

Query: 2323 LQKMIK--KHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQA 2380
            +++++K    S+ E P  T    + ++Y+ LL   D++  +   KQQ+SLSCEPKAKVQA
Sbjct: 2124 IRQLLKDLNKSSVETPR-TSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQA 2182

Query: 2381 DVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTH 2440
            DVGFE F   + TN+FD  +PL  SL + +  A+ +HIFSREVSTS  +  +    + TH
Sbjct: 2183 DVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTH 2242

Query: 2441 PDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPV--QRTVNKEIEMSSL 2498
            PD I  YG   +  + V+FN+KQLQ+L +F++IW+  S + ++P    + V     +   
Sbjct: 2243 PDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKP 2302

Query: 2499 TSTNYAD--AGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLH 2556
             ++ Y    + +  PW F +I + + G++DLG SLG++SL T++ W  TDHY++  Q L 
Sbjct: 2303 LTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLS 2362

Query: 2557 AFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDY 2616
               D +SL+S+GRL G F + N  W+S++KWP  +     PLV  ++ +D+ AVK  FDY
Sbjct: 2363 LQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDY 2422

Query: 2617 HMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRM 2676
            H+ LI ++  +   L N++D +GV+ +LL VS SSD   +  TAL  ANI D+YNTI+RM
Sbjct: 2423 HLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRM 2482

Query: 2677 RQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVE 2736
            R+DN+ SY+ETL DSN  +++      +IL SL  LRT+LSV +    +Q+ P +LFD+E
Sbjct: 2483 RKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDME 2542

Query: 2737 VLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYA 2796
            V+  +    S  S+T   KKLKT L+L+V +V  ALST K +L E V + I + +Y+ +A
Sbjct: 2543 VMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHA 2602

Query: 2797 SKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTH 2856
            SK+ GGTI+  P + + MTT  +  TN +E L++ SF  KI VRWNLG ++F++EMW TH
Sbjct: 2603 SKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATH 2662

Query: 2857 VKALAVRRSQVANISFGQTXXXXXXXXXXXXXXXXFNYIALEEPQIEVPQIRDLGDATPP 2916
             +A+A+RRS                          + YI LEEP IE+PQ +DLG+ATPP
Sbjct: 2663 ARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPP 2722

Query: 2917 MEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            +EWFGVNRK+FP  THQ  ++P+QKL +LAE ++ +IL
Sbjct: 2723 VEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARIL 2760

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 1594 bits (4128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1010/3049 (33%), Positives = 1578/3049 (51%), Gaps = 204/3049 (6%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M+  ++   + + +++ F WVFLV+W   +++ +   FY+ R   Y+V+ IL W++WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120
            K+ IN+++L  S++GG+++FKN+S+  +D TIS+L+G+ TW+YWLLN R  +L  +N + 
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120

Query: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYL--NEHSFPEPFS 178
               K    C+  +EC+G+E+FIYN+   Y++++N L+K ++D   K+   +E  F    +
Sbjct: 121  ENSK----CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKT 176

Query: 179  DGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLG 238
            D S    + + L ES+  +    +I+N    Q       P  L FLP E+  S G++++G
Sbjct: 177  DSSV---MFDPLDESSEQSKVGQTILNSVSNQSA----VPLYLDFLPAEVILSSGAVVVG 229

Query: 239  NKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDD-AIGLK 297
            NK TPSV I+ Y   +GIIDV  P   LD Y+ +++ E  +  +S+K NI + + +   K
Sbjct: 230  NKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKK 289

Query: 298  FKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSLYKASAGDAK 357
             KID GK   LW+                       T  + F   WKGL++Y  +  D  
Sbjct: 290  HKID-GKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTF 348

Query: 358  ASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNG 417
            +   D++ FDL NHEYAK+T+IL   ++ + Y  D PGV+          I G + G+  
Sbjct: 349  S---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETL------IKGYENGDIP 399

Query: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRM 477
              P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR 
Sbjct: 400  PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRC 459

Query: 478  NISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTV 537
             I IMED+ WRIPT+E SKD  FL  YK TN+E R FGW+D++  KDT  +  + +  + 
Sbjct: 460  EIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASE 519

Query: 538  QGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEA 597
             GF+N FH + +   I +SVNHD+L  +K   I     YP  WNS   W ++  S  LE 
Sbjct: 520  CGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLEL 579

Query: 598  FLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657
            F+LR+H  L+ D  +DF++GD  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDF
Sbjct: 580  FILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDF 639

Query: 658  NENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKE 717
            NENCY+S+HG+   I V +P E+I      +SYEI TP F + L TPPW+TL+EFM  + 
Sbjct: 640  NENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRF 699

Query: 718  VGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFF 777
            VGR+++F+  GSYL Y+++DIDNVDT+ +EC +       YGF++RY+ N+K+NYFGEF 
Sbjct: 700  VGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFA 759

Query: 778  NFVTSEEYTGVLGAREVGDVTT----------KSSVADLASTVDSGYQNSSLKNESEDKG 827
             F T+EEY+  L  R   DV T           + + +  S  +SG+    L  +  DK 
Sbjct: 760  QFRTTEEYSEELAQR--NDVATDIFNNNDDDQTTELVEPNSYGESGFD--ILHGKKIDK- 814

Query: 828  PMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDI 887
                + LKRT NE DIW TF   DG  +LPE+ Y F  C  LHF  +  D R  +YY D+
Sbjct: 815  ----ASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADL 870

Query: 888  MAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFC 947
               +N T IKR+     N VFD    N        G LS+  IH HRM+GLPP E TY  
Sbjct: 871  AFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLF 930

Query: 948  QWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIR 1007
            + D++LG L  +SDIE +KGF     K  FG+++ E++L Y+     D++ L+   + I 
Sbjct: 931  KIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDIS 990

Query: 1008 IGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLK 1067
            I L +        +S  ++   L+DF   KYS R ++ IP     ++ +  D  +     
Sbjct: 991  IRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGT 1048

Query: 1068 FETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGXXXX 1127
              T + F  F +  D     + Q ++I + D+P+ RC FL P  YQ SD Y+ LY     
Sbjct: 1049 ISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPP 1108

Query: 1128 XXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDN 1187
                              I E+++G+      +   F        + ++ +   F +   
Sbjct: 1109 SSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFD---ISNDTKLQLNIDEFKKHSE 1165

Query: 1188 DEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVD-PLLFIFAKSLLEQLYSENMVQV 1246
            +  +   +        D  HE  ++V ++ +I +D+   +L +FA  L  QL +  +   
Sbjct: 1166 NSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFA-DLYRQLTTFTISDT 1224

Query: 1247 LDDIEIGIVKRLSNLQEGITSIS-------NIDIHIAYLNLIWQETGEEGFELYLDRID- 1298
            +D + + IV   S    G +S++        ID  +        E  +  F   ++++D 
Sbjct: 1225 IDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDL 1284

Query: 1299 -------YQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKN---PDLSEDRPPALSL 1348
                   Y     + E N  NKL   +   K   +   +  K+N   P  SE    +   
Sbjct: 1285 NLRLRQEYDKESANSEMNSKNKL---SVYYKTALINGKMLSKENFIYP--SESSEFSYKS 1339

Query: 1349 GIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNT 1408
              E  E ++  +D  V   NL    + I++   + + E+             S    +N 
Sbjct: 1340 TFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNF 1399

Query: 1409 RSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTY 1468
              + K EL+ ++  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I+TRLRH+L Y
Sbjct: 1400 NKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNY 1459

Query: 1469 LPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFT-AE--- 1524
            LP  W       L++ K+ S +DAK  F+ +F+ WR+WEF+DV R ++Y K +  AE   
Sbjct: 1460 LPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPAEVTF 1519

Query: 1525 ---------------NEKHKQNLIKKLLKCTMGSFYLTVYGEGY--EVEHNFVVADANLV 1567
                           NE+ K++L        M SF + +  + Y        + A +N V
Sbjct: 1520 AKTICFSSDLLTISFNERDKEHLF-------MNSFMIDIRNDCYVSSAVGESMAAKSNNV 1572

Query: 1568 VDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLI-----------PLIAAVG 1616
                  +  L  N ++ I                +LKL  LI           P++ A  
Sbjct: 1573 YKTVVSLDELQINVDKKI----------------ILKLSKLIHTLKFEYVYSNPIVVA-- 1614

Query: 1617 EDDKSDPKKELSKQF-KMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQ 1675
              D +   K +S Q  K+ T   +    L  + ++  + S         L + L    + 
Sbjct: 1615 -KDANGRCKNISLQLNKITTNCFLGNVSLGFIFERIYVYS---------LIDTLDSGNNS 1664

Query: 1676 AGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLAT------TEAWSHKPTILINNQCADL 1729
              S+++F   ++++ ++ +  L      D     T      T  + H    +  N     
Sbjct: 1665 LLSVLLFFDVAKLFFRYKTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFMNINS---- 1720

Query: 1730 HFRAMSSTEQLVTAITEIRESLMMIXXXXXXXXXXXXXSQFVDQKINTVLSCYFSNVSS- 1788
               ++ S   ++ A  EIR  +  I                 D ++   ++    N+++ 
Sbjct: 1721 ---SIPSINDIIEANNEIRLHINEIGQDFASNIQYTELPVLPDSQVLKPIAMVKMNIAAI 1777

Query: 1789 --EVMPLSPFYIRHEAKQLDIYFNKFGSNEIL---LSIWDTDFFMTSHQTKEQYLRFSFG 1843
              ++  L PF +R+  K+ +I  + FG   IL   LS+ DT   + S + +E Y+++S  
Sbjct: 1778 NIQLQLLLPFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSHS 1834

Query: 1844 DIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLF 1903
             +++ G       +L  + +  S  KL+  EP++ +  FL D + A + I +L S     
Sbjct: 1835 YLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLET 1894

Query: 1904 FSSNLPKKEKQAP-SIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLP 1962
             SS +   + + P S +I   L+ ++ Y G+L+   +T +V E + L  S +       P
Sbjct: 1895 KSSTV---QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNP 1951

Query: 1963 EETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVC 2022
                 +  +S E+I FLIK+R +   LSK+LDFS+++  ++ ++   QS Q+ESS+    
Sbjct: 1952 VVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAV 2011

Query: 2023 LSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYK 2082
            LSP SL+RL+   ++   +   Y      +       T  +     +PI+ +S HILSY 
Sbjct: 2012 LSPMSLVRLLSFVNEFSIMKSIYHDIKPRS-------TSSNSTLSILPISIKSAHILSYN 2064

Query: 2083 FCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEK 2142
             CIGW+F  G  +N GL+ GY RLF+ Y+K +GK T++DA+FSVA+G +SST++ +GNEK
Sbjct: 2065 LCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEK 2124

Query: 2143 DKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQEL 2202
               NRS+LP+MQI+YW +     KD F R +GE LDV+ +  +  +++   QS+  F++L
Sbjct: 2125 GAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKL 2184

Query: 2203 KKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYDGGVFRVYTYEDI 2262
            K+ ILD    L+  +++               P   ++RS+N    Y G   ++Y+ +DI
Sbjct: 2185 KETILD---PLKVTSND----PILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDI 2237

Query: 2263 ETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSES 2322
            +     SFEI+SP  T+   YK+   K K H  RTL TV+ THNTL+  C PLL E   +
Sbjct: 2238 Q-HGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLT 2296

Query: 2323 LQKMIKKHS---TDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQ 2379
               M+K      ++  PN     ++ ++Y+ LL+ FD+AV +   KQ++SL+CEP AK+Q
Sbjct: 2297 FNTMLKNSCSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQ 2355

Query: 2380 ADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFT 2439
            A +GFE F   + TN    ++PL  S+ L +  AS +H+FSRE+S+S  +  + +    T
Sbjct: 2356 ATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLT 2415

Query: 2440 HPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLT 2499
            H + I  YG+ L+S    +FNVKQ+++L LFL+IW   SI   + V   +   +  SS  
Sbjct: 2416 HSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIW---SIEKQKSVNDIILAPVTASSFE 2472

Query: 2500 STNYADAGTEIP------WCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQ 2553
            S         +P      W + LI + +  ++DLGPSLG++ +++   W  + H  +  Q
Sbjct: 2473 SVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQ 2532

Query: 2554 LLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAA 2613
             L      I ++S GRL G   + +  W S++ WP   + +  PLV  SL +     K +
Sbjct: 2533 KLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLS 2592

Query: 2614 FDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTI 2673
            FDYHMF I TI N    L N++D +G L DLL VS S D I +  T+L  AN+ DIY+TI
Sbjct: 2593 FDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTI 2652

Query: 2674 VRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLF 2733
             RMR D+  + ++ L +SN  +         +L SL  LRT+LSVN     + I   +L 
Sbjct: 2653 RRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLI 2711

Query: 2734 DVEVLVIRIDKV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASI 2787
              EV+V+R  KV         S+T S  K++T+L  Q+ D+S +LS+ K +LDE     I
Sbjct: 2712 GTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKI 2771

Query: 2788 AIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVD 2847
             + DY+  AS I GG I++ P + V M T Q + +N +E L++ SF + +S+ WNL P++
Sbjct: 2772 DVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPIN 2831

Query: 2848 FIKEMWTTHVKALAVRRSQVANISFGQTXXXXXXXXXXXXXXXXFNYI--ALEEPQIEVP 2905
            FIK+MW+ H+ A+ +R  Q  N S                      YI   LEEP IE+P
Sbjct: 2832 FIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMP 2891

Query: 2906 QIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            +I+DLGDATPP+EWFG+NR +FP  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2892 KIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1521 (31%), Positives = 784/1521 (51%), Gaps = 106/1521 (6%)

Query: 37   IFYMGRIYAYLVSFILEWLLWKRAKIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLE 96
            IFY+GR+  Y+VS     +LWK+ ++ +++++L  S L G++HFKN+SV  +D  ISVL+
Sbjct: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65

Query: 97   GSLTWKYWLLNCRKAELIENNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLL 156
            G++TW+YWL+   +       +S +   A+  C+ +++ EG E F+YNR   YD +   L
Sbjct: 66   GTITWRYWLIGRYR-------RSGTADGARR-CRFALKFEGFEYFVYNRNGVYDRIAREL 117

Query: 157  SKDERDKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGK 216
                         E +  EP     S +++  +L +                        
Sbjct: 118  D-----------GEDTSAEPTVSVPSVEEVIAELQDD----------------------- 143

Query: 217  HPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQME 276
             P +  FLP+E   ++G+++LGNK T SV I++YE   G + +  P +       +T+ +
Sbjct: 144  -PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAK 202

Query: 277  FKNFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSD 336
              N  ++IK NI Y+    +K  ++  + ++LWK +  +                   + 
Sbjct: 203  ISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTP 262

Query: 337  DNFYHKWKGLSLYKASAGDAKASDLDD-VEFDLTNHEYAKFTSILKCPKVTIAYDVDVPG 395
              +Y  W+GLS+Y  +  +    +LD+ V+FD+ +HEYAK T++LK  ++ + Y   +PG
Sbjct: 263  -KWYDNWRGLSMYDVNLDE----ELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPG 317

Query: 396  V--VPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPV 453
               V    +   P ++ P++       D ++D+ ++  +  YGPWA RQV    RV SP 
Sbjct: 318  TARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPT 370

Query: 454  VSRTAKPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRP 513
            V R  K         +     F+++++IMED+  R+P +ESSKD  FL+ YK+T +E RP
Sbjct: 371  VCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRP 430

Query: 514  FGWMDLRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGD 573
            FGW+D+R  K++     ++  PT  GF+N  H + ++T I +SVNHD LLK+K  DI  D
Sbjct: 431  FGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVD 490

Query: 574  IGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVN 633
              YP GW  KA W  N+ S Q E F+LR+H+ L++D ++DFS G+   YE FRPF Y+  
Sbjct: 491  FSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFR 550

Query: 634  WEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEIS 693
            W++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I 
Sbjct: 551  WDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIF 610

Query: 694  TPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKST 753
            TP F + LN PPW+T +E + +KE+GR+ +F IKGSY  YSE+D+DNVD L I C +   
Sbjct: 611  TPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYI 670

Query: 754  VLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDS- 812
            V+ CYG +++ + NVK+NYFGE  +F T+EEY   L  R   + +T        +  DS 
Sbjct: 671  VVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSD 730

Query: 813  --GYQNSSLKNESEDK--GP--MKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPC 866
                +++ + + S D   GP  +K+S LKR+ NE D+WFTF    G    PE IY FD C
Sbjct: 731  VVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDAC 790

Query: 867  IALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLS 926
            +  +F  L    R  NYY+D    L+    KRH       +F  I       +     LS
Sbjct: 791  LGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLS 850

Query: 927  DLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENIL 986
              +   H+M G+ P+E +Y C++D+ +  L +  D+  +K F N+   + FG+ D+EN L
Sbjct: 851  QFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSL 910

Query: 987  LYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV---ISAESILFTLIDFENEKYSQRID 1043
             Y+ E + D+  ++  +E + + L++ V K + +   ++      T  D  NE+YS+R D
Sbjct: 911  QYEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRRSD 969

Query: 1044 VKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHR 1103
            + IP+L   +    GD   T    F T +  T FE+++   + R  QR++I ++D+P+HR
Sbjct: 970  LSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027

Query: 1104 CPFLLPLFYQDSDTYQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNP 1163
            C F+LP  Y+    Y++LYG                      I E ++GE          
Sbjct: 1028 CSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEI--------- 1078

Query: 1164 FKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA--FTEDRNHERDNYVVDVSYILL 1221
            ++   +++   +     S +E D   +   ++    +  F   +NH++      +S  ++
Sbjct: 1079 YQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQ-----TLSSFIV 1133

Query: 1222 DVDPL---LFIFAKSLLEQLYSE----NMVQVLDDIEIGIVKRLSNLQEGITSISNIDIH 1274
            + DP+   L + A   + ++Y      ++ + +D +EIGI+ +          IS + + 
Sbjct: 1134 EFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVL 1193

Query: 1275 IAYLNLIWQETGEEGFELY-----LDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVT 1329
               ++L      +  F ++     +  +D     KS + N      +     K+  +R  
Sbjct: 1194 CPNISLS-ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRAN 1252

Query: 1330 VNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCS 1389
            + Q       +      S  IE  E + S +   +   N+ S  +T+     + LFE+ +
Sbjct: 1253 IVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLN 1312

Query: 1390 ---DQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLS 1446
                  +L+Q   +SF   ++T   SK E +  +      Y+I HDP VITKPA I R S
Sbjct: 1313 PFISTFDLLQRELSSF---EDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFS 1369

Query: 1447 KGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNW 1506
              H+R   SW+II RLRHIL YLP +W  +    L  + +TS ++A   F+S+FS WR+W
Sbjct: 1370 NRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSW 1429

Query: 1507 EFSDVARSYIYGKLFTAENEK 1527
            E +DV  S+++ K+FT +  +
Sbjct: 1430 EPTDVQGSFVHEKVFTKKRSR 1450

 Score =  606 bits (1562), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 394/1204 (32%), Positives = 631/1204 (52%), Gaps = 43/1204 (3%)

Query: 1774 KINTVL-SCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQ 1832
            KI+ VL     +N++ ++  LSPF I + A+  ++      S    L+  ++   ++S +
Sbjct: 1700 KIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAK 1759

Query: 1833 TKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQG 1892
             K  Y +++   +++  G S       ++   I ++KL+  + +  +   LQD K A   
Sbjct: 1760 QKLDYFKYTHTCLKL-SGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA--- 1815

Query: 1893 INLLYSLKPLFFSSNLPKKEKQAPSIMINW------TLDTSITYFGVLVPVASTYFVFEL 1946
               L+S+K L    N+ +    A S   +W       L    TY G+L+    T ++ E 
Sbjct: 1816 ---LFSMKSLSDILNISQSSPTA-SAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEF 1871

Query: 1947 HMLLLSLTNTNNGMLPEETKVTGQF----SIENILFLIKERSLPIGLSKLLDFSIKVSTL 2002
            +       +T +G LP+       F    SIE+  FLIK+R +   L+K++DF++  + +
Sbjct: 1872 NNF--EAKHTRDG-LPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMV 1928

Query: 2003 QRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRR--HAPNIWNTKMFT 2060
              T    QS Q+ES+H ++ L+P +++RL+   ++   +   ++    + P+  +     
Sbjct: 1929 HDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTA 1988

Query: 2061 GKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVV 2120
             +  +     +  +S HILS+ F I W+F     S  GL+ GY+RLFS YEK +GK T++
Sbjct: 1989 TECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLL 2048

Query: 2121 DAFFSVANGNTS-STFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDV 2179
            +A+FS A    S + F+S    K + N S+L +MQ+ YWF    E  D F R HG  L V
Sbjct: 2049 NAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAV 2108

Query: 2180 NFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDN 2239
            +     + ++E T+QS++ F  LKK ++D   + + ++D                     
Sbjct: 2109 DISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSD------ISKEPYNWNNQLATG 2162

Query: 2240 IRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLI 2299
            +RS+N    Y G   +++++ D    + P  E+ SP   +   YK+  +  K H+FRTLI
Sbjct: 2163 VRSLNCIINYAGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLI 2220

Query: 2300 TVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSS----QNVDYKRLLDQF 2355
            T  PTHNT Y+  A L+ +      K++K  ST+ K +    SS    +  D   LL   
Sbjct: 2221 TATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSI 2280

Query: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASI 2415
            D+ + L   KQ+++ SCEPKAKVQA VGFE F   +  N  + E+ L  ++ +E+   + 
Sbjct: 2281 DLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNS 2340

Query: 2416 KHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIW- 2474
            +HI+SREV  S ++  + +        V  +YG+ L+S    +FN+KQLQ+L LF+D W 
Sbjct: 2341 RHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWF 2400

Query: 2475 RFSSILHTRPVQRTVNKEIEMSSLTSTNY-ADAGTEIPWCFTLIFTNVSGDVDLGPSLGM 2533
               + ++T      V  +    S+ S  Y   + +   W +++I      +++LGPSLG+
Sbjct: 2401 PQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGV 2460

Query: 2534 ISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSK 2593
            +++ ++  W  +    +  Q L      + +TS GRL G F V NA    E+KWP  K  
Sbjct: 2461 LNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDF 2520

Query: 2594 NTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDE 2653
               PLV   L  D +  K +FDYH F I ++   +  L NE+D  G L DLL V+ S + 
Sbjct: 2521 FQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFES 2580

Query: 2654 IILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLR 2713
            + +  TAL  ANI DI N+I R+++DN++SY+ +   S+   S +P     I  +L LLR
Sbjct: 2581 VNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQ-PSDEPEEDGGIFDTLSLLR 2639

Query: 2714 TDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALS 2773
            T LS+N+   ++QISP SLFD +VL++   K+   +   +  K+KTDL  Q+ DVS AL 
Sbjct: 2640 TQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALL 2699

Query: 2774 TSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSF 2833
                 LDE   A++ +  Y+  +S I GG I   P + V+MTT QE ++N +E L++ SF
Sbjct: 2700 PFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSF 2759

Query: 2834 SDKISVRWNLGPVDFIKEMWTTHVKALAVRRS---QVANISFGQTXXXXXXXXXXXXXXX 2890
               + +RWNLGP+ FIK+MW  H+ A+ +R      +A      T               
Sbjct: 2760 GGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGS 2819

Query: 2891 XFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQY 2950
             + Y+ L+EP IE+P+I+DLGDATPP+EWFGVNR KFP FTHQ  ++P+QKL   AEK+Y
Sbjct: 2820 DYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEY 2879

Query: 2951 VKIL 2954
             KIL
Sbjct: 2880 EKIL 2883

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1588 (31%), Positives = 815/1588 (51%), Gaps = 114/1588 (7%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60
            M++ S  R + ++ +KD S  FLVDWIL V++C+   FY+GRI A++++  L++ +W++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-IENNKS 119
            KIKIN+++++VS LGGRI FKNL+V+  D+TIS LEGS TW+YWLL+ R   +  E+   
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 120  SSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD 179
             + + AKLPC+  ++C+GLE+F+YN+   Y++V+       RD F              D
Sbjct: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVT---------KD 164

Query: 180  GSSADKLDEDLSESAYTTNSDASIVNDR-----------DYQETDIGKHPKLLMFLPIEL 228
            G   +  D+       T N++ +  N +             + TD  K        PI+L
Sbjct: 165  GQETESNDD------ITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLFPIQL 218

Query: 229  KFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNI 288
            + +R +++LGN+ T  V +  +E  KG+ D+      LD YR K  ++  +    ++ N+
Sbjct: 219  EANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNL 278

Query: 289  GYDDAIGLKFKIDRGKVSKLWKTFVRVFQIXXXXXXXXXXXXSAGTSDDNFYHKWKGLSL 348
            GY +   +K  +    + K+W+T  +  Q                 +   +   WKGL L
Sbjct: 279  GYQNDNPIKTFVVEKTMDKIWQTVKK--QCISISKLLLPNQGKTINNQQAYIDSWKGLDL 336

Query: 349  YKASAGDAKASDLDDVEFD-LTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPD 407
            Y  +    KA   ++V+   L   EYA+++ ++K  +V++ Y  D+PG+VP  +      
Sbjct: 337  YHHT----KAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQ 392

Query: 408  IDGPDVGN---NGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 464
             D  +  N   +   P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K 
Sbjct: 393  SDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKP 452

Query: 465  PPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKD 524
             PGS RIY  F++++   + +   IPTRESSKD EF+K YK T + +R FGW+++   + 
Sbjct: 453  EPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEG 512

Query: 525  TYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKA 584
                FN+++C       N  +V  L  EI+SSVNH++L +     I  +IGYP GWN +A
Sbjct: 513  GEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQA 572

Query: 585  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLN 644
             W+  + S   E FLLR+HI+L++D  +DFSA D   YELFRPF Y++ W    Y ++LN
Sbjct: 573  DWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLN 632

Query: 645  VNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTP 704
            VND NI+NN LD NENC+LSL GD L+  + +P  SI+    + ++ + +P+ ++ ++ P
Sbjct: 633  VNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPP 692

Query: 705  PWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRY 764
             WNTL+EF+     G   DF++ G+Y+ +  +D+DN DT++I+  S ST    +GFV+RY
Sbjct: 693  CWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRY 752

Query: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVD--------SGYQN 816
            L N+K+NYFG+F +F T+EEY+  L   E     TK+      + V+          YQ 
Sbjct: 753  LMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQV 812

Query: 817  SSLKNESEDKGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVV 876
            +   NE+     + +S L RT NETD+W TF V DG +I+PE +Y       L F  L  
Sbjct: 813  ADTINEN----TIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEF 868

Query: 877  DFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEH----GLLSDLTIHG 932
            D R  NY+MD+ A  +   +        N V         A E+ H    G L DL +HG
Sbjct: 869  DMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHG 920

Query: 933  HRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTET 992
            HRM+G+PP E TY C+WDI++G L  DSD +F+  F  +  K+GF Y D ENIL+Y    
Sbjct: 921  HRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHK 980

Query: 993  INDMTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTIS 1052
              D+TSLT+ + ++   ++     S + +S   I     D  N +YS+R+D+ +  +++ 
Sbjct: 981  PEDVTSLTISIGRVSSIVRTNHGGS-ATLSLNDITINSWDLSNSRYSKRVDLLVAAISV- 1038

Query: 1053 LNCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFY 1112
              C + D   T     +T +  T F    ++   R  Q+  + ++DSP+HRC FLL    
Sbjct: 1039 --CAI-DEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQ 1095

Query: 1113 QDSDT-YQNLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLETTNPF---KNIF 1168
             +  T Y +L G                      I E ++G Y  L+         KN+ 
Sbjct: 1096 LNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNLT 1155

Query: 1169 AETP--STMEPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPL 1226
             + P    + P   + S D + + A+               E +N  V++S + + V P 
Sbjct: 1156 DDRPDDKRLLPLSNTVSNDLSGQLAE-------------EFESENTTVNISTLSVFVTPK 1202

Query: 1227 LFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLS--NLQEGITSISNIDIHIAYLNLIWQE 1284
             F FA++    + + +   ++D  E+ IV   S  ++  G    S++ +    +N I  E
Sbjct: 1203 AFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDE 1261

Query: 1285 TGEEGFEL-YLDRIDYQMSEKSL------------EKNRTNKLLEVAALA-KVKTVRVTV 1330
            T  +  +L  LDR++  +S  S+            + N +  + + + ++    +++  +
Sbjct: 1262 TALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNI 1321

Query: 1331 NQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSD 1390
             +     L++  P A    I  F     ++  +V+ L   S    I ++ +EW  EY   
Sbjct: 1322 FKSSKNRLTKVLPIAW-FEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLK 1380

Query: 1391 QGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHV 1450
                  +   S   +   RS    E I ++    +   I   PY+ITKPA+I RLSK HV
Sbjct: 1381 LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHV 1440

Query: 1451 RENRSWKIITRLRHILTYLP--DDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEF 1508
            R+  SWKIITRLRH+  +     +  S  D++ +E +    KD K+ F+ +F  W+NW+ 
Sbjct: 1441 RDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVR-NICKD-KSQFLDIFVDWKNWDV 1498

Query: 1509 SDVARSYIYGKLFTAENEKHKQNLIKKL 1536
             +V +S ++  LF+ E+  H+++L  +L
Sbjct: 1499 YEVEQSSLFTLLFSGESTVHEEDLFNEL 1526

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/1201 (32%), Positives = 639/1201 (53%), Gaps = 66/1201 (5%)

Query: 1778 VLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQY 1837
            VLS    ++  +     PF IR     LD  F       I+++   T+  +  +  + + 
Sbjct: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819

Query: 1838 LRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLY 1897
            LR S    ++     R    L ++ +   ++KLT S+ R  +      E+L       + 
Sbjct: 1820 LRISNSVTKVD---YRSNTLLTDIGLDTDIVKLTLSDNRVYI------EELTDSLNGTVS 1870

Query: 1898 SLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTN 1957
             L  +F + N    E  AP      +   +  Y G+L  + +T +V E +    S  +  
Sbjct: 1871 ELIKIFKNKN-ADNEPAAPKFK-PCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRA 1928

Query: 1958 NGMLPEETKVTGQFS-----IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSF 2012
              +  EET            I+N+  L+    +   LSK+ D    +  ++   D +++ 
Sbjct: 1929 EAL--EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTL 1984

Query: 2013 QVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPIN 2072
            Q+E+ H RV L+P +L+ +++   +        ++     +     F   S+ + E+P  
Sbjct: 1985 QIETPHSRVMLAPSTLIAVIFFIQE--------AKVSLQKVKQKGKFNSSSN-AIEIPPY 2035

Query: 2073 FR--SIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGN 2130
            F   S++ILS K C+GWIF+     N G+++GY  LF+AYEK +GK T+VD + + A G 
Sbjct: 2036 FETLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGK 2094

Query: 2131 TSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIE 2190
             S+ FF   N   + NRS L +MQI++WF      KD F R + + LDV  + + ++++ 
Sbjct: 2095 ESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVN 2153

Query: 2191 STLQSMRAFQELKKNILDVSESLRAENDNXXXXXXXXXXXXXXXPFLDNIRSVNSNFKYD 2250
                S+ +FQ+    I ++ +S  + ++                    +IRS+N   KY 
Sbjct: 2154 VMRSSIESFQKKLAKISNIKKSSISTHNVAENLSDKVSIL--------SIRSINCIAKYG 2205

Query: 2251 GGVFRVYTYEDIETKS-EPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLY 2309
            GG+  +YT +DI   S + S E+ SP + ++  Y H+    K H  R+L+ V+ THN L+
Sbjct: 2206 GGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILF 2265

Query: 2310 AGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNV-------DYKRLLDQFDVAVKLT 2362
            + C P+L+  +  +QK +++ ++++K    K   Q         DYK L  + D A+ + 
Sbjct: 2266 SSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVIN 2325

Query: 2363 SAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSRE 2422
               Q ++L+CEP+AK+QAD+GF +F  SM T+  D  +PL  SL     + S +HIFSRE
Sbjct: 2326 VGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSRE 2385

Query: 2423 VSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIW----RFSS 2478
            +S+S  +  + L  + TH + I  YG  L+SD+  + N+KQLQ + LFLDIW    + + 
Sbjct: 2386 ISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQ 2445

Query: 2479 ILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRT 2538
             L + P      +   ++  T+        +IPW + +IF N S  +D+ PSLG I+ + 
Sbjct: 2446 KLGSGPHSGQKCQPQALTEFTTP-------KIPWIYQIIFKNTSAVIDMDPSLGSINFKV 2498

Query: 2539 QRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPL 2598
               W+++ H  +    +  + D ++  S+GRL GLFE+ N  + S + WP + +K   PL
Sbjct: 2499 PTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPL 2558

Query: 2599 VSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658
            ++ +  +  ++ K  FDYH FLI  +S++   + NE+D  G+L DLL VS S   + +  
Sbjct: 2559 INLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFL 2618

Query: 2659 TALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSV 2718
            TAL  AN+ DIY T  RMR +NK SY++TL++SNP  S +     + L +   LRT+L+ 
Sbjct: 2619 TALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTA 2678

Query: 2719 NISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2778
             I S ++ + P +LFD EVLV++ +K+++ + T + +K KTDL  Q+ D++ +L+  K E
Sbjct: 2679 EIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNE 2738

Query: 2779 LDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKIS 2838
            L EE  A +++++Y   A+ + G  I+  P + V +TT Q+    ++E+L++ SF DK+ 
Sbjct: 2739 LTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVD 2798

Query: 2839 VRWNLGPVDFIKEMWTTHVKALAVRRSQV---ANISFGQTXXXXXXXXXXXXXXXXFNYI 2895
            ++WNL P++FI+EMW THV+AL+VRR       +  F +                 + YI
Sbjct: 2799 IKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFE-DENIAEKIKIVNLGTKYKYI 2857

Query: 2896 ALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKILD 2955
             LEEP IE+P +RDLG+ATPP+EWFGVNRK+FP   HQ  V+P+QKL+Y+AE QY + L 
Sbjct: 2858 PLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

Query: 2956 D 2956
            D
Sbjct: 2918 D 2918

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%)

Query: 5  SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
          S+ R VP++  +DFSWVFL DW+L + V L   FY GR+  Y ++ ILE+L WKR  +K+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>TBLA0D00420 Chr4 complement(96949..105576) [8628 bp, 2875 aa] {ON}
            Anc_7.418 YBL088C
          Length = 2875

 Score = 33.9 bits (76), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 2655 ILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRT 2714
            IL ST  +V  I DI  T+ ++ +D+++SY+  ++ S   + R P L  D   S+ LL  
Sbjct: 1286 ILKSTEFLV--IEDIQTTLKKLHRDDELSYLLFVKYSKSSKYRSP-LKIDFPSSISLLNK 1342

Query: 2715 DLSVNISSSKVQISPISLFD 2734
                N  SS + I+ + + D
Sbjct: 1343 IFKANFQSSDIDITCLWILD 1362

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 316,730,867
Number of extensions: 14475664
Number of successful extensions: 44398
Number of sequences better than 10.0: 44
Number of HSP's gapped: 44876
Number of HSP's successfully gapped: 59
Length of query: 2958
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2830
Effective length of database: 38,804,151
Effective search space: 109815747330
Effective search space used: 109815747330
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)