Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR086W (SMC4)8.259ON1418141868670.0
Smik_12.1458.259ON1418141858920.0
Skud_12.1548.259ON1417141757510.0
Suva_10.1708.259ON1416141757450.0
KAFR0B027108.259ON1416143739540.0
TDEL0F038608.259ON1399142638910.0
ZYRO0C01716g8.259ON1413144538250.0
NCAS0B050008.259ON1409141538240.0
Kpol_392.88.259ON1427143137550.0
SAKL0H17094g8.259ON1422143837540.0
KNAG0G020208.259ON1444144136680.0
NDAI0B019708.259ON1415142136300.0
Kwal_56.238258.259ON1396144935630.0
KLTH0G13750g8.259ON1399143834750.0
AGR089C8.259ON1370137134510.0
Ecym_43118.259ON1376137733900.0
TBLA0E044108.259ON1422139033330.0
TPHA0J007208.259ON1393137033320.0
CAGL0L12188g8.259ON1398144031400.0
KLLA0F19085g8.259ON1372137730960.0
NDAI0G033208.68ON12317694824e-48
KLTH0A02706g8.68ON12281703781e-35
Skud_6.648.68ON12303753573e-33
Kwal_23.50438.68ON12251743564e-33
NCAS0C040008.68ON12231683531e-32
SAKL0B02288g8.68ON12281723502e-32
TPHA0P003408.68ON12191653502e-32
Kpol_1011.58.68ON12211693404e-31
KLLA0D07502g8.68ON12431803386e-31
TBLA0G035308.68ON12321633361e-30
AGL023W8.68ON12221613297e-30
TDEL0C009608.68ON12221763271e-29
Ecym_73038.68ON12222013271e-29
ZYRO0F03828g8.68ON12171633233e-29
CAGL0F02079g8.68ON12233333234e-29
ZYRO0D15642g7.186ON11703692608e-22
TDEL0H026107.186ON11703462609e-22
KAFR0G029307.186ON11703622591e-21
Smik_6.718.68ON12283822572e-21
Kpol_1063.207.186ON11713722536e-21
CAGL0D05258g7.186ON11704112528e-21
AGR236W7.186ON11703732492e-20
KNAG0G009108.68ON12262032464e-20
SAKL0F07282g7.186ON11703042464e-20
YFL008W (SMC1)8.68ON12251692411e-19
KLTH0E04774g7.186ON11701822392e-19
Ecym_43907.186ON11701812393e-19
Kwal_55.204217.186ON11701832374e-19
Suva_6.1047.186ON11701822375e-19
YFR031C (SMC2)7.186ON11701822375e-19
NDAI0G020707.186ON11711822366e-19
KNAG0L011607.186ON11703962359e-19
Skud_6.1197.186ON11701822331e-18
KAFR0C032008.68ON12232072322e-18
NCAS0E019207.186ON11701842313e-18
Suva_6.528.68ON12644422294e-18
TBLA0D046107.186ON11741792251e-17
TPHA0C044407.186ON11701822251e-17
KLTH0H09966g1.295ON12243362161e-16
ZYRO0G21296g1.295ON12271182072e-15
KAFR0A016101.295ON12271092053e-15
Kwal_14.24351.295ON12471042035e-15
Smik_7.3467.186ON1170792001e-14
SAKL0D06116g1.295ON1229941972e-14
NCAS0A093301.295ON12271061954e-14
KNAG0B052301.295ON12251171954e-14
Kpol_1018.21.295ON12111851955e-14
TDEL0D016201.295ON12232381937e-14
NDAI0G056301.295ON12291011901e-13
Smik_10.1671.295ON12291001892e-13
TBLA0C027401.295ON11191521873e-13
CAGL0H02805g1.295ON12193511874e-13
TPHA0I010901.295ON1216951857e-13
YJL074C (SMC3)1.295ON1230951847e-13
Ecym_63221.295ON12321031831e-12
Suva_6.1491.295ON12302181831e-12
AAL182W1.295ON12311021784e-12
Skud_10.1701.295ON1230951767e-12
KLLA0A00286g1.295ON1224891694e-11
KLLA0D16005g7.186ON1170751661e-10
SAKL0B09526g7.101ON10993921248e-06
NCAS0I005707.101ON10954441249e-06
KNAG0L006307.101ON11081581185e-05
ZYRO0G01584g7.101ON10883731132e-04
TDEL0E013404.237ON11062041122e-04
Kwal_26.72047.101ON11174281086e-04
KLTH0D02816g7.101ON10941641060.001
KLLA0F07997g7.101ON11192111050.002
ZYRO0B12122g4.237ON1109781030.002
NDAI0A084507.101ON11192701000.006
KAFR0D013307.101ON1080189980.011
Smik_15.1317.101ON1093142980.011
Kpol_1044.137.101ON1103138970.012
NCAS0J013904.237ON109668970.013
Suva_15.1337.101ON1092203970.013
TPHA0B008404.237ON111968970.015
Suva_10.5004.237ON111568960.017
CAGL0H05071g4.237ON111076960.018
Skud_12.4684.237ON112068960.018
YLR383W (SMC6)4.237ON111468960.018
Smik_12.4704.237ON111468960.019
NDAI0J021804.237ON1108107960.019
TBLA0I028904.237ON1098202950.021
KNAG0B060104.237ON111768950.022
Skud_15.1217.101ON109362950.025
YOL034W (SMC5)7.101ON109362940.028
TPHA0L006007.101ON111762940.032
TDEL0H034907.101ON110364940.033
Ecym_26257.101ON1097131930.036
AEL337C7.101ON1097355930.040
TBLA0E021907.101ON108962930.040
KLLA0E05303g4.237ON109870930.043
TBLA0A053001.67ON70763910.069
CAGL0F01155g7.101ON1105195910.070
TDEL0E013304.238ON1657176900.083
Ecym_53444.237ON110254870.18
SAKL0H03322g4.237ON111152860.27
Kwal_26.93804.237ON110285860.28
Kpol_483.104.237ON111883860.28
TDEL0G028102.351ON109471850.31
Ecym_23688.704ON758171840.40
NCAS0B087001.67ON71572830.53
KLTH0D14080g4.237ON110278830.55
KAFR0A060404.237ON110268830.64
Ecym_71018.604ON717111820.66
AER044W4.237ON110395820.69
Suva_15.3575.88ON117269820.74
Smik_8.322.542ON585130811.0
Skud_8.785.267ON1927174792.1
Smik_15.3828.604ON829161773.1
TPHA0P004308.85ON319126763.1
Smik_7.1212.316ON1132174773.4
TBLA0G001802.16ON1016169764.4
YHR158C (KEL1)5.88ON116469755.2
Skud_8.2225.88ON116969755.8
SAKL0F04026g7.163ON113999746.0
NDAI0A008301.162ON684108746.1
Smik_8.2425.88ON116869746.1
AFR683C1.67ON67782746.5
ZYRO0F17050g1.67ON71481746.7
CAGL0G03047g3.430ON53967737.2
Skud_8.352.542ON585124737.3
TDEL0C039802.263ON69053737.6
TPHA0K019904.46ON910119737.6
Smik_4.1764.238ON179586739.1
Suva_4.3473.343ON75183739.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR086W
         (1418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  2649   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  2274   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  2219   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  2217   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1527   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1503   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1477   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1477   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1451   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1450   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1417   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1402   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1377   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1343   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1333   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1310   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1288   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1288   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1214   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1197   0.0  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             190   4e-48
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   150   1e-35
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   142   3e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   141   4e-33
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   140   1e-32
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   139   2e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   139   2e-32
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   135   4e-31
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   134   6e-31
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   134   1e-30
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   131   7e-30
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   130   1e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   130   1e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   129   3e-29
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   129   4e-29
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   104   8e-22
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   104   9e-22
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   104   1e-21
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   103   2e-21
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...   102   6e-21
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   101   8e-21
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   100   2e-20
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    99   4e-20
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    99   4e-20
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    97   1e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    97   2e-19
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    97   3e-19
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    96   4e-19
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    96   5e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    96   5e-19
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    96   6e-19
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    95   9e-19
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    94   1e-18
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....    94   2e-18
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    94   3e-18
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    93   4e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    91   1e-17
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    91   1e-17
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    88   1e-16
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    84   2e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    84   3e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    83   5e-15
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    82   1e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    80   2e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   4e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    80   4e-14
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    80   5e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    79   7e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    78   1e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   2e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   3e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    77   4e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    76   7e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    75   7e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    75   1e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    75   1e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    73   4e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   7e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    70   4e-11
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    69   1e-10
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    52   8e-06
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    52   9e-06
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    50   5e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    48   2e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    46   6e-04
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    45   0.001
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.002
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    43   0.006
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    42   0.011
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    42   0.011
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    42   0.012
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.013
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    42   0.013
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.015
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.017
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.018
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.018
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.018
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.019
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.019
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    41   0.021
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.022
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    41   0.025
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.028
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.032
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.033
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    40   0.036
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    40   0.040
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.040
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.043
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.069
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    40   0.070
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    39   0.083
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    38   0.18 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.27 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.28 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.28 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.31 
Ecym_2368 Chr2 (715575..717851) [2277 bp, 758 aa] {ON} similar t...    37   0.40 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.53 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.55 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    37   0.64 
Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar t...    36   0.66 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    36   0.69 
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    36   0.74 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   1.0  
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    35   2.1  
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    34   3.1  
TPHA0P00430 Chr16 complement(91648..92607) [960 bp, 319 aa] {ON}...    34   3.1  
Smik_7.121 Chr7 (211577..214975) [3399 bp, 1132 aa] {ON} YGL151W...    34   3.4  
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    34   4.4  
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    33   5.2  
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    33   5.8  
SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa] ...    33   6.0  
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    33   6.1  
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    33   6.1  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   6.5  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   6.7  
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    33   7.2  
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    33   7.3  
TDEL0C03980 Chr3 complement(697431..699503) [2073 bp, 690 aa] {O...    33   7.6  
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    33   7.6  
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    33   9.1  
Suva_4.347 Chr4 complement(614150..616405) [2256 bp, 751 aa] {ON...    33   9.6  

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 2649 bits (6867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1330/1418 (93%), Positives = 1330/1418 (93%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240

Query: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360

Query: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420
            FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD
Sbjct: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420

Query: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480
            LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL
Sbjct: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480

Query: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540
            VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL
Sbjct: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540

Query: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEKI 600
            KDKTKNISAEIIRHEKELEPWDLQLQEK                  AKLKKNVETLEEKI
Sbjct: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI 600

Query: 601  LAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660
            LAKKTHKQE                 ERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR
Sbjct: 601  LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660

Query: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720
            SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780

Query: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840
            SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS
Sbjct: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840

Query: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900
            DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA
Sbjct: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900

Query: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960
            DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK
Sbjct: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960

Query: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSE 1020
            GLQDEIMKIGGIKLQMQNSKVESVCQKLDI                     FQKLLQNSE
Sbjct: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSE 1020

Query: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESIN 1080
            RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLN                 DMEESIN
Sbjct: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESIN 1080

Query: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140
            EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED
Sbjct: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140

Query: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200
            VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD
Sbjct: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200

Query: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260
            VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK
Sbjct: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260

Query: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418
            ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT
Sbjct: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 2274 bits (5892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1135/1418 (80%), Positives = 1242/1418 (87%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            M DSPLSKRQKRK+ +EPELSLD  DA ++ Q E + + SE TP+P+ PALE SY+KS+T
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNS TTSLHVPNLQPP TSSRGRD+K+Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSRVELQK+Y+ HQSS+KQQ RLFINELVLENFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP+LQSCSVAVHF+YVI
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DESSGTSRIDEEKPGL+ITRKAFKNNSSKYYIN KESSYTEVTKLLKNEGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE+M QIE LNEVCLEKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420
            FEIVDREKNSLESGKETALEFL KEKQLTLL+SKLFQFK+LQSNSKLASTLEKISS NKD
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480
             E EK+KFQESLKKV+E+K QRKEIKDRISS  S+EK LVLERRELEGTRVSLEERTKNL
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540
             +K+EK+E+T K TK SISEAE+ L+EL  QQTEHE+EIKDL QLLE+ERS+LD+IKLSL
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEKI 600
            KDKTK+IS EII+HEKELEPWDLQLQEK                  +KLKKNVET+EEKI
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 601  LAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660
            LA+K HKQE                 ERSQGE+NF+SAHLKL+EMQKVLN HRQRAMEAR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720
            SSLS+AQNKSKVLTALS+LQKSGRINGFHGRLGDLG+ID+SFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780
            VECAQ CIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPK+PKFSNAFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840
            SVLRDTLVA++LKQANNVAYG+KRFRVVT+DGKLIDISGT+SGGGNHV+KGLM+LGTNQS
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900
            +K+DDYTPEEV+KIE ELSERENNFRVA+DTVHEME ELK LRD EP +ES+ISK EMEA
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960
            DS+ SELTLAEQQVKEA +AY  A+SDKAQ+N++MKNLERL+GE++DLQSETKTKKEKIK
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSE 1020
             LQ EIMKIGG KLQMQNSKV S+CQ+LDI                     FQK L+NSE
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESIN 1080
            RDVELSS+ELK IEE+LKHTKL L+END  M ET N                 + EE+I+
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENID 1080

Query: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140
            EFKS+EIEMKNKLEKLNSLL +IK EI QQEKGL+ELSIRDVTHTL +LD+N MD VK D
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140

Query: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200
             K  Q + +E RS ETQDE  I++ E +CD++H M+IDETS+EV RGIPR SE+EL+ELD
Sbjct: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKELD 1200

Query: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260
            +EL+E +I+ELSYY++ETNVDIGVLEEYARRLAEFKRRKLDLN AVQKRDEVK Q+ +LK
Sbjct: 1201 IELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260

Query: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            KKRFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418
            ISLRNNMFELAQQLVG+YKRDNRT+STT+KNIDILNRT
Sbjct: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 2219 bits (5751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1099/1417 (77%), Positives = 1227/1417 (86%), Gaps = 1/1417 (0%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            M DSPLSK+QKRK+ +EPELSL+  DAE +S+VENRVN +E TP+P+ P+LE+SY++S+T
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNS TTSLHVPNLQPPK SSRGRD+K+Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPAR 120

Query: 121  XLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQK+YD H+SS KQQ RLFIN+LVL+NFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP LQ+CSVAVHF+Y+I
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240

Query: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGL+ITR+AFKNNSSKYYINEKESSYTEVTKLLK EGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER+ QIE+LNE+CLEK NR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360

Query: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420
            FEIVDREKNSLESGKETALEFL+KEKQLTLL+SKL QFK+LQSNSKLASTLEKISS N++
Sbjct: 361  FEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNRE 420

Query: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480
             E EK KFQESL++VDE+KAQ K+IKDRISS +S+EKTL LE+RELEG+RVSLEERTKNL
Sbjct: 421  FESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480

Query: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540
            V+KM KAEK LKSTKHSISE+E+M +EL+ QQTEHE EIKDL Q LE+ER ILDDIKLSL
Sbjct: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540

Query: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEKI 600
            KDKTK+ISA+IIRHEKE EPWDLQLQEK                  AKLKKN E LEEKI
Sbjct: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKI 600

Query: 601  LAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660
            ++KK  KQE                  RSQGE++F SAHLKLKEMQ++LNAHRQRAMEAR
Sbjct: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660

Query: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720
            SSLSKAQNK+ VLTALS+LQKSGRINGFHGRLGDLGVID+SFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLR+FNLQPISTPENVPRLFD+VKPK+PKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840
            SVL+DTLVA++LKQAN VAYGK+RFRVVTVDGKLIDISGTMSGGGNHV KGLM+LGTNQS
Sbjct: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840

Query: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900
            D+++DYTPEEV KIE EL+ERE NFRVA+DTVHEMEEELKK+RD EPDLESQIS+AEMEA
Sbjct: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900

Query: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960
            DSL SEL LAEQQ KEA+MAY KAV++K Q+N VMKNLE LRGEY DLQSET+TKKE+IK
Sbjct: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960

Query: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSE 1020
             LQD+IMKIGG KL  QNSKV S+CQ++DI                     +QK L+N E
Sbjct: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFE 1020

Query: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESIN 1080
            +D ELSS+ELKVIEE+LK TKLAL ENDTNM E  N                 +MEE+I+
Sbjct: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080

Query: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140
            EFKS+EIEMKNKLEKLNSLL +IK+EI QQ+K LN+LSIRDVTHTL MLD+N+MD V++ 
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140

Query: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200
            +K+ Q+ DQ+  S    DE +I++ + + +N+H MNIDE S E+SRGIP+L E+EL++LD
Sbjct: 1141 IKDEQDADQDKPSGIPDDE-KIQEKDDADNNHHSMNIDEMSSEISRGIPKLCEEELKDLD 1199

Query: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260
            +EL+ES I+ L+ Y+ ET+VDIGVLEEY RRL EFKRRKLDLN AVQKRDEVKEQL ILK
Sbjct: 1200 IELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILK 1259

Query: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            K RFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1260 KNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1319

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1320 TNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379

Query: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417
            ISLRNNMFELAQQL+G+YKRDNRTKSTT+KNIDIL R
Sbjct: 1380 ISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 2217 bits (5745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1099/1417 (77%), Positives = 1225/1417 (86%), Gaps = 2/1417 (0%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            M DSPLSKRQKRK+A+EPELS++ G+ E++ + E + + +E TP+PD  +LE+SY+KS+T
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNS T+SLHVPNLQPP+  SRGRD+K+Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQK+YD HQ S +QQ RLFI++LVLENFKSYAGKQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+LQSCSVAVHF+YV+
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240

Query: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGL+ITRKAF+NNSSKYYIN KES+YT+VTKLLKNEGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360
            LQGEVENIAQMK KAEKESDDGLLEYLEDIIGTANYKPLIE+R+ QIE LNE+CLEKENR
Sbjct: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360

Query: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420
            FEIV+REKNSLESGKETALEFLEKEKQLTLL+SKLFQFKLLQSNSKLASTLEK SS NKD
Sbjct: 361  FEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKD 420

Query: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480
             E EK KFQESLK+VDE+++QRKEIKDR+SSC+S+EKTL LE+RELE TRVSLEERTKNL
Sbjct: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480

Query: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540
            V+KM KAEK LKST HSISEAE++LEEL G+QTEHETE+KDL Q LE+ER ILDDIKLSL
Sbjct: 481  VNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSL 540

Query: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEKI 600
            KDKTK+ISAEII+HEK+LEPWDLQLQEK                   KLKKN E LEE I
Sbjct: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENI 600

Query: 601  LAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660
             AKK  KQE                  RSQGEK+F++AHLKLKEMQ +LNAHRQRAMEAR
Sbjct: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660

Query: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720
            SSLSKA+NKSKVLTALSRLQKSGRINGFHGRLGDLGVIDD+FDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQP+ TPENVPRLFDLVKPK+PKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840
            SVLRDTLVA++LKQANNVAYGK+RFRVVT+DGKLIDISGTMSGGGNHV KGLM++G NQS
Sbjct: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840

Query: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900
            D++DDYTPEEV+KIE ELSERE NFRVA+DTVHEME+ELKK+RD EPD+ESQI +AEMEA
Sbjct: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEA 900

Query: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960
            DSLASEL LAE+QVKEA+MAY K+V+D AQLN +MK LE LRGEY+DLQ+ETKTKKE+IK
Sbjct: 901  DSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960

Query: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSE 1020
             LQD+IMKIGG  LQ+QNSKVES+ Q++DI                     FQK L+N E
Sbjct: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVE 1020

Query: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESIN 1080
            RD+ELSS+ELKVIEE+ +  KL L +NDT++   LN                 +ME  I+
Sbjct: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080

Query: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140
            EFKS+E+EMKNKLEKLNSLLTYIKS+I QQEK LNELSIRDVTHTL +LD+N+MD + ++
Sbjct: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140

Query: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200
             ++ QE +QE  S E + E++ ++ +   D+ H MNIDETSDEVSRGIPRLSEDEL+EL+
Sbjct: 1141 GEDRQETNQEDISGEAKGETQGEEGDN--DDRHCMNIDETSDEVSRGIPRLSEDELKELN 1198

Query: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260
            +EL+E  I EL+ Y++ TNVDIGVLEEYARRLAEFKRRKLDLN AVQKRDEVKEQL ILK
Sbjct: 1199 IELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILK 1258

Query: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            KKRFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1259 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1318

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1319 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1378

Query: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417
            ISLRNNMFELAQQLVGVYKRDNRTKSTT+KNIDILNR
Sbjct: 1379 ISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1527 bits (3954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/1437 (56%), Positives = 1038/1437 (72%), Gaps = 43/1437 (2%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            MS +PLSK+QK  S +E  ++ +Q + + D               P++ A  +S+ KS+T
Sbjct: 1    MSHTPLSKKQKVVSDEE-RITPNQNEQDNDK------------THPEVTA--SSFLKSHT 45

Query: 61   PRKLVLSSGENRYAFSQPT----NSTTTSLHVPNLQPPKTS-SRGRDHKSYXXXXXXXXX 115
            PRKL+L S +N+Y  SQP     +  ++SL VPNLQPP +  SRGRD K+Y         
Sbjct: 46   PRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPG 105

Query: 116  XXXXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGP 175
                  LEL+QLSP+KN+R+ELQK+Y+   S ++ + RL+I++LVL++FKSYAG Q+VGP
Sbjct: 106  RSPVRKLELIQLSPIKNNRIELQKLYN---SKNQNKVRLYIDKLVLQDFKSYAGTQIVGP 162

Query: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVH 235
            F+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSEAFP++QSCSV VH
Sbjct: 163  FNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVH 222

Query: 236  FQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDH 295
            FQYVIDE+ GTS+I E++  L++ RKAFKNNSSKYYIN KES+YTEVT+LLK EGIDLDH
Sbjct: 223  FQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDH 282

Query: 296  KRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCL 355
            KRFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+ YK LIE++M +IE LNE+C+
Sbjct: 283  KRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICV 342

Query: 356  EKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKIS 415
            EKE RFEIV+ EKNSLES K+ ALEF+ KEKQLTLLRSKL Q+KL Q+N+KLA+TL+KIS
Sbjct: 343  EKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKIS 402

Query: 416  SSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEE 475
            +    L++E+ K+++   ++D+   + +E  ++I++  ++E+ LV ++RE +G  VS+EE
Sbjct: 403  NFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEE 462

Query: 476  RTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDD 535
            R KNL  K  KAEKTL   +  I + E++L++L+  Q  +++E  +L + L+KERS LDD
Sbjct: 463  RIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDD 522

Query: 536  IKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVET 595
            IKLSLKDKTK+IS++I  +EK++EPW  ++QEK                  AKLK+ + +
Sbjct: 523  IKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGS 582

Query: 596  LEEKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQR 655
            L+ +I   +                      E S GE   + A  K KEM+ +LN+HRQR
Sbjct: 583  LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642

Query: 656  AMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDD 715
            A++ARS+L  A+NKS VL+AL+RLQKSGRINGFHGRLGDLGVI D +D+AISTAC RLDD
Sbjct: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702

Query: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKF 775
            +VVD+VEC Q CI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFDLV+P + KF
Sbjct: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762

Query: 776  SNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKL 835
            SNAFYSVLRDTLVA +++QAN VAYGK+R+RVVT+DGKLIDISGTM+GGG+HV+KGLMKL
Sbjct: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822

Query: 836  GTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895
              +  + ++ Y   +V+KIER+L+ERENNF++A DT+ EM  ELK+L+D EP++E +I+K
Sbjct: 823  KNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAK 882

Query: 896  AEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955
              M+ DSL  +L L EQQ+KE E  Y   ++ K  L+     L+ LR E+  L+ ++++K
Sbjct: 883  LLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSK 942

Query: 956  KEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKL 1015
            KEKI  L++EIMKIGG +LQ+QNSKV S+ +++ I                      Q+L
Sbjct: 943  KEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRL 1002

Query: 1016 LQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDM 1075
             + +E D     ++L+ ++  +   +  L E +   +  LN                 DM
Sbjct: 1003 FKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDM 1062

Query: 1076 EESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDD---- 1131
            EES+NE+KS EIE+KNKLEKLNSLL Y K +I    + L    +RDVT +L  + +    
Sbjct: 1063 EESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENAN 1122

Query: 1132 ---------NKMDSVKEDVKNNQELDQEYRSCETQD---ESEIKDAETSCDNYHPMNIDE 1179
                     N +D       N  + D E  S E  D   ++EI++ E   D    M++D 
Sbjct: 1123 NSVGVKQSSNNLDVSSSHTPNVDKHDDEI-SMEDADNDSQNEIEEKEQDAD---IMDLDN 1178

Query: 1180 TSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRK 1239
             ++EVS+GIP+L++D+L+ +D++ +ES+IN+L  YVE +N DI +LEEY RRL EFK+RK
Sbjct: 1179 VTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRK 1238

Query: 1240 LDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSL 1299
            LDLN  V +RDEV+++L  LKK R DEFM GF+IIS+TLKEMYQMITMGGNAELELVDSL
Sbjct: 1239 LDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSL 1298

Query: 1300 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359
            DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1299 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1358

Query: 1360 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YKR N T+S T+KN DILN
Sbjct: 1359 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1503 bits (3891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/1426 (55%), Positives = 1011/1426 (70%), Gaps = 35/1426 (2%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            M D+PL+KRQ+    +  E                 VN S  +P        ++ + S+T
Sbjct: 1    MPDTPLTKRQRVNDNESREFEA--------------VNGSTKSPLTS----NSNSTISHT 42

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXXXX 120
            P+KLV+ + ++  + SQP  S++ SL  P+LQ P +SSRGR+ ++Y              
Sbjct: 43   PKKLVIGTNDDTTSQSQPIVSSS-SLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTR 101

Query: 121  XLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180
             LEL+++SPVK +R+ELQ++YD  QS  +  +RL IN+LVL++FKSYAG+QVVGPFH+SF
Sbjct: 102  KLELIKISPVKKNRLELQRLYDAEQSQ-RNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L+SCSV VHFQYV+
Sbjct: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220

Query: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE  GT+RIDEEKP L++TRKAFKNNSSKYY+N+KES+YTEVT+LLK EGIDLDHKRFLI
Sbjct: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360
            LQGEVENIAQM+PKAEKE +DGLLEYLEDI GTA YKP IE  + +IE LNE C+EKENR
Sbjct: 281  LQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENR 340

Query: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420
            F IVD+EK+SLE+GK+ ALEFLEKEK LTLLRSK+ Q+K+ Q++ KL STL+K S     
Sbjct: 341  FHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400

Query: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480
            L+ E  K+ E+LK+VD +K + K++  RI + + +EK L+ ++R L+  RV++EE+ K++
Sbjct: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460

Query: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540
              K  KAEK LKS +HS++  E  L ELR  Q ++E E++DL Q L  ER+ L+D+K+SL
Sbjct: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520

Query: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEKI 600
            K+KT NISA I ++EK+LEPWD QLQ+K                  A++ K++E L+ +I
Sbjct: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580

Query: 601  LAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660
                  K                   E        +SA  +LK+M ++L A RQR ++AR
Sbjct: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640

Query: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720
            ++ S AQNKS VLTAL++LQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+VV++
Sbjct: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780
            VEC Q CI+YLRKNKLGYARFILLD+LR+F+   I TPENVPRLFDLVKPK+ KF  AFY
Sbjct: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760

Query: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840
            SVLRDTL AQ+L QAN VAYGKKRFRVV++DGKLIDISGTMSGGG+HV +GLM+L  N S
Sbjct: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820

Query: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900
               D ++PEEV ++E EL+E+E +F++ASDT  EME++LKKL+D  P+++ ++SK  ME 
Sbjct: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880

Query: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960
            +S  SEL L E+ + E   A  KA     +  +    ++ L+ E   L  +T T ++KI 
Sbjct: 881  ESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940

Query: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSE 1020
             L+D+IM+IGG +LQ+QNSKV S  Q+++I                       K++ N++
Sbjct: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQ 1000

Query: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESIN 1080
            +D++L S E+  ++E   + +  L   + +++E  +                  ME    
Sbjct: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060

Query: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140
            EFKS++IE+ +KLEKLN+LL +I  E+ Q E  LN L IRDVT TL +LD+        +
Sbjct: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG-------E 1113

Query: 1141 VKNNQELDQEYR------SCETQDESEIKDA--ETSCDNYHPMNIDETSDEVSRGIPRLS 1192
              NN ++  E +      +  T+ E E  D   E    N   M +DE   E+  G+PR+S
Sbjct: 1114 STNNSKMPNELQEKRTEGADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGLPRVS 1173

Query: 1193 EDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEV 1252
            E EL+ LDVE + ++I +L  YV+  NVD+ +LEEYA+RLAE KRRK+DLN AV +RD +
Sbjct: 1174 EAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAM 1233

Query: 1253 KEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1312
            +E+LG LKK+RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP
Sbjct: 1234 REKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1293

Query: 1313 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1372
            PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1294 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1353

Query: 1373 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418
            TKNAQFIVISLRNNMFELAQQLVG+YK  N TKS ++KN DILNRT
Sbjct: 1354 TKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNRT 1399

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1477 bits (3825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/1445 (55%), Positives = 1039/1445 (71%), Gaps = 70/1445 (4%)

Query: 3    DSPLSKRQK-----RKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSK 57
            D  LSKRQK     +   + P + LDQG               EN   P   + + +++ 
Sbjct: 4    DDSLSKRQKVDGLNQIDGKHPTVDLDQG---------------ENLSLPTTSSSQNTFAH 48

Query: 58   SYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXX 117
            + TPRKLV+ +G+NRYA S   + +++SL VP LQPP TSSRGR  K+Y           
Sbjct: 49   AKTPRKLVVGNGDNRYAHSS-QSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGRS 107

Query: 118  XXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFH 177
                LEL+Q+SP+KNSR+ELQKIYD  Q+ ++  +RL I++L+L++FKSYAG+QVVGPF+
Sbjct: 108  PTRKLELIQISPLKNSRLELQKIYDAQQNQARH-TRLCIDQLILQDFKSYAGRQVVGPFN 166

Query: 178  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQ 237
            TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +PSL SCSV VHF+
Sbjct: 167  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFK 226

Query: 238  YVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKR 297
            YVIDE SG +RIDEEKP L++TRKAF+NN+SKYY+N++E++Y EVTKLLK EG+DLDHKR
Sbjct: 227  YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKR 286

Query: 298  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEK 357
            FLILQGEVENIAQMK KAE+E +DGLLEYLEDIIGTA YKPLIE+ +  +E+LN++C+EK
Sbjct: 287  FLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEK 346

Query: 358  ENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSS 417
            ENRF+IVDREKNSLE+GKE AL FLE E++LT+ +SKL+Q+ +L SN KL +TL+KI++ 
Sbjct: 347  ENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNL 406

Query: 418  NKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERT 477
            N+ LE E  K     K++D+++A   E++ ++ +C+++EK L+ ++REL+G  V  EE+ 
Sbjct: 407  NQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKI 466

Query: 478  KNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIK 537
            KN   K +KAEKTL S   SIS +E  L EL+  Q ++E  +K+L +  E E+  L+ IK
Sbjct: 467  KNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIK 526

Query: 538  LSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLE 597
             SLKDKT  IS EI + EKELEPW+ QLQEK                  AKL + ++  +
Sbjct: 527  FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFK 586

Query: 598  EKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAM 657
            ++I  +K    +                 E S GEK   +A ++LKEMQ +LN  RQ+A+
Sbjct: 587  QEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKAL 646

Query: 658  EARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVV 717
            +ARS+LS A+NKSKVLTALSRLQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+V
Sbjct: 647  DARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIV 706

Query: 718  VDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSN 777
            V+TVEC Q CI+YLRKNKLGYARFILLD+LR+FNL  I+TPE+VPRLFDL+ PK+PKFS+
Sbjct: 707  VETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSS 766

Query: 778  AFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGT 837
            AF+SVL +TLVA +LKQAN VAYGKKRFRVVT+DG LIDISGTMSGGG+ V++GLM++  
Sbjct: 767  AFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINR 826

Query: 838  NQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAE 897
            N+++ ++ Y+ EEV ++E  L ERE NF+VASDT+++MEE+LK L++ EP +E+ IS+  
Sbjct: 827  NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLT 886

Query: 898  MEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKE 957
            ME +S  SE+ + E Q+ E+E AY     +  +L   +++++ L+ E+  +Q++TK+KK 
Sbjct: 887  MEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKH 946

Query: 958  KIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQ 1017
            +I+ L++EIM+IGG +L++Q+SKV+SV Q++DI                       K+  
Sbjct: 947  RIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKL 1006

Query: 1018 NSERDVELSSDELKVIEEQL-----------------KHTKLALAENDTNMNETLNXXXX 1060
             + RD+E  + E++ ++  +                 +HTK  L E    + + LN    
Sbjct: 1007 ETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLN---- 1062

Query: 1061 XXXXXXXXXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIR 1120
                         D+ E I  FKS E+EMKN+LEKLNSL  ++K EI   E+ L +L IR
Sbjct: 1063 -------------DINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIR 1109

Query: 1121 DVTHTLGMLDD----------NKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCD 1170
            DVT  L  L D          N +  V+E   +  E   E +  + QD  +++DAE   D
Sbjct: 1110 DVTQILHDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLDAQD--QVQDAEKQGD 1167

Query: 1171 NYHPMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYAR 1230
            N   M++++  +   RG+ + SEDEL E+++E +E +I +L  +++ +N DI VLEEYAR
Sbjct: 1168 N--QMDVEDGGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYAR 1225

Query: 1231 RLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGN 1290
            RL EFK R+LDLN AV++R++VKE+L  LKKKRFDEFM GF IISMTLKEMYQMITMGGN
Sbjct: 1226 RLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGN 1285

Query: 1291 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1350
            AELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1286 AELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1345

Query: 1351 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIK 1410
            DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YKRDN+TKS TIK
Sbjct: 1346 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIK 1405

Query: 1411 NIDIL 1415
            NID +
Sbjct: 1406 NIDFV 1410

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1477 bits (3824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 796/1415 (56%), Positives = 1003/1415 (70%), Gaps = 18/1415 (1%)

Query: 5    PLSKRQKRKSAQEPEL-SLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPRK 63
            P +KRQK     EPE  + +QG   ED Q    +      PE        + SKS+TPRK
Sbjct: 4    PNTKRQK---VTEPESKTPEQGT--EDQQANASLRSPLQRPEHQQSISPINNSKSHTPRK 58

Query: 64   LVLSSGENRYAFSQPTNSTTTSLHVPNLQPP-KTSSRGR-DHKSYXXXXXXXXXXXXXXX 121
            L+L   +NRYA     + +++S  VP LQPP  +SSRGR D KSY               
Sbjct: 59   LILGQNDNRYA-FSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRR 117

Query: 122  LELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSFS 181
            LEL+QLSPVKN+R++L+++YD H S SK++ RLFIN+L L NFKSYAG+QVVGPFHTSFS
Sbjct: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVVGPFHTSFS 176

Query: 182  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVID 241
            AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP L SCSV V F Y ID
Sbjct: 177  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAID 236

Query: 242  ESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLIL 301
            E  G ++I E KP L+I+RKAFKNNSSKYYIN KES+YT+VTKLLK EGIDLDHKRFLIL
Sbjct: 237  EHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLIL 296

Query: 302  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRF 361
            QGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ + +IE+LNE+C+EKENRF
Sbjct: 297  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRF 356

Query: 362  EIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDL 421
            EIVDREKNSLESGK  ALEFLEKEKQLTL +SKL Q+ L Q+NSKL +TL+KIS+ N++ 
Sbjct: 357  EIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEY 416

Query: 422  EDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLV 481
              EK K Q    +++  K    E + +I     +EK  +  +R LEG  VSL+E+ KNL 
Sbjct: 417  NVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLT 476

Query: 482  SKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLK 541
             K  K EK + +T+ +IS   + ++EL   Q E+  E++ L Q L+ ER  L+ +KL LK
Sbjct: 477  QKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLK 536

Query: 542  DKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEKIL 601
            +KT  IS EI+ HE +LEPW++++QEK                   KLK +++ L +++ 
Sbjct: 537  EKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVS 596

Query: 602  AKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARS 661
             +   K +                 E S GE        KLKEM+ VLN  RQRA EAR 
Sbjct: 597  NQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656

Query: 662  SLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDTV 721
            +L+  QN+ KVLTAL +LQKSGRI GFHGRLGDLG ID+++DVA+STACPRLDD+VV+TV
Sbjct: 657  ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETV 716

Query: 722  ECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYS 781
            EC Q CI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFDL+KPK+ KF  AFYS
Sbjct: 717  ECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYS 776

Query: 782  VLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSD 841
            VLRDTLVA++LKQAN VAYG++R+RVVT+DGKLID+SGTMSGGGNHV+KGLM L     +
Sbjct: 777  VLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQN 836

Query: 842  KVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEAD 901
              DDY PE+V++IE++LS++E NF +A++  +EME EL+KL + +P++E +ISK  ME D
Sbjct: 837  YFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEID 896

Query: 902  SLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKG 961
            + ++E+   E+Q++E        + D  +L V ++NL++L+ E+  LQ +TK KK+KI  
Sbjct: 897  TYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIAS 956

Query: 962  LQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSER 1021
            L+++IMKIGGI+LQ+QNSKV S+ Q++DI                      +K L  S+ 
Sbjct: 957  LKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKN 1016

Query: 1022 DVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESINE 1081
            D+ L +D++K I E++     +L   D ++ E                    D+EE+INE
Sbjct: 1017 DITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINE 1076

Query: 1082 FKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDV 1141
            FKS EIE+ NKLEKLN LL +IK++I   E  L++L++R +   L  LD+      +   
Sbjct: 1077 FKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES----EAKA 1132

Query: 1142 KNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELDV 1201
             NN  L  E    +  D++  +   T+  +   M+ID  ++ +S G+P LS+DEL  LD+
Sbjct: 1133 PNNGTLSDE----QIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDI 1188

Query: 1202 ELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKK 1261
             L+E+++++L  Y+E T+ +I VLEEY +RL EFK RKLDLN+AV KR+ V++QL  LKK
Sbjct: 1189 TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK 1248

Query: 1262 KRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1321
             R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+
Sbjct: 1249 TRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS 1308

Query: 1322 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1381
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1309 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1368

Query: 1382 SLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            SLRNNMFELAQQLVG+YK +NRT S TIKN +ILN
Sbjct: 1369 SLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1451 bits (3755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 783/1431 (54%), Positives = 1005/1431 (70%), Gaps = 19/1431 (1%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            M  +PLSKR K     E  L+ ++ D  +D Q  NR  +  +    D  A+     KS T
Sbjct: 1    MPKTPLSKRPK---LVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQT 57

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPP-KTSSRGRDHKSYXXXX----XXXXX 115
            P+KL+L   ++           ++SL  P+L PP ++SSRGR  ++Y             
Sbjct: 58   PKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPARSPA 117

Query: 116  XXXXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGP 175
                  LEL+QLSPVKNSR+ LQKIY+    + KQ  RL I++LVL +FKSYAG QVVGP
Sbjct: 118  RSPTRKLELIQLSPVKNSRIALQKIYE--SKNEKQIERLCIDKLVLHDFKSYAGTQVVGP 175

Query: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVH 235
            FH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FP L+SCSV VH
Sbjct: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235

Query: 236  FQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDH 295
            F+YVID+  GT+ I+  K  L+ITRKAFKNN+SKYYIN KES+YT VTKLLK+EGIDLDH
Sbjct: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295

Query: 296  KRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCL 355
             RFLILQGEVENIAQMKPKAE + DDGLLEYLEDIIGTA YKPLIE++  +IE LNE+C+
Sbjct: 296  NRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICI 355

Query: 356  EKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKIS 415
            EKENRFEIVDREK SLESGK+ ALEFLEKEK+LTL++SKL+Q+KL Q N KL++TLEK+S
Sbjct: 356  EKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLS 415

Query: 416  SSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEE 475
            +  ++ E+ K K   +  +++EI     E+   I +   +EK L +++R  +  RVSLEE
Sbjct: 416  NIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEE 475

Query: 476  RTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDD 535
            + KN++ K +K EK L+    +IS  +  +E+L   ++E+E+++ +L   L+ ER +L++
Sbjct: 476  QRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEE 535

Query: 536  IKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVET 595
            IK+SLKDKT   S EI +HEKELEPW+LQLQ K                   KL+ ++E 
Sbjct: 536  IKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIEN 595

Query: 596  LEEKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQR 655
            L   I  K   K                   E S G+  +T+A  KL+EM+ VLN HRQ+
Sbjct: 596  LNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQK 655

Query: 656  AMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDD 715
            A++AR+SLS  +NK++VL +L RLQKSGRI+GF+GRLGDLG IDD +D+AISTACPRL+D
Sbjct: 656  AIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLND 715

Query: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKF 775
            +VV+TVEC Q CI+YLRKNKLGYARFILL++LR F++  ISTP NVPRLFDLV   +PKF
Sbjct: 716  LVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKF 775

Query: 776  SNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKL 835
              AFYSVLRDTLV  NLK AN VAYG KRFRVVT+ G+LID+SGTMSGGG   ++GLMKL
Sbjct: 776  LPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKL 835

Query: 836  GTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895
              + +     YT E+V+KIE+EL+ RE NF +A++T  EME EL++L+D +PD+E +ISK
Sbjct: 836  TKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISK 895

Query: 896  AEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955
             E+E  S  +E  L +QQ+ E + +  + +S+  +L+ +   L  L+ +Y  LQ ETK+K
Sbjct: 896  FELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSK 955

Query: 956  KEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKL 1015
            K++IK L+DEIMK+GGIKLQ+Q+SKV+S+ QK DI                       K 
Sbjct: 956  KDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKK 1015

Query: 1016 LQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDM 1075
                  D+  S+D+L+  + QL     +L+E +T ++E                    + 
Sbjct: 1016 QSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEF 1075

Query: 1076 EESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMD 1135
            EE++N FK  ++E +NK EKLN+LL +IK +I   +  L  L IRD+THTL  LD+  +D
Sbjct: 1076 EENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNID 1135

Query: 1136 SVKEDV--KNNQ---ELDQEYRSCETQDESEIK----DAETSCDNYHPMNIDETSDEVSR 1186
              +EDV  K+N      +    + E  +  EI+    D     +N   M IDE ++E+S+
Sbjct: 1136 QDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISK 1195

Query: 1187 GIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAV 1246
            GIPR+SEDE + +DVE +E++  +L  Y++  NV+I VLEEYARR+AE+KRRKLDLNNAV
Sbjct: 1196 GIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAV 1255

Query: 1247 QKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1306
             +R++V+E L  LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1256 DEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGV 1315

Query: 1307 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1366
            TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1316 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1375

Query: 1367 NYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417
            NYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N+TKS T++N DI+NR
Sbjct: 1376 NYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINR 1426

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1450 bits (3754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 785/1438 (54%), Positives = 1018/1438 (70%), Gaps = 40/1438 (2%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSK--- 57
            MSDSPL+K+QK ++        D+G  + +  V     +S ++    L A+++S ++   
Sbjct: 1    MSDSPLAKKQKTRTD-------DRGQIQSNPTVSPIPPVSGSS----LMAVKSSPTRQDR 49

Query: 58   --SYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKT-SSRGRDH--KSYXXXXXX 112
              S TPRKLVL S E +YA+S    ST++SL VPNLQPP    SRGR    +S       
Sbjct: 50   LPSPTPRKLVLGSPEKKYAYS--QPSTSSSLSVPNLQPPNVDGSRGRRFYSQSPPRSPHR 107

Query: 113  XXXXXXXXXLELLQLSPVKNSRVELQKIYD-RHQSSSKQQSRLFINELVLENFKSYAGKQ 171
                     LEL+QLSPVKN+R ELQKIYD +++  ++   RL I++L L NFKSYAG Q
Sbjct: 108  SPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQ 167

Query: 172  VVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCS 231
            ++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSEA+P+L+SCS
Sbjct: 168  IIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCS 227

Query: 232  VAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGI 291
            V +HF+YV+DES GT+R D+EKP ++ITRKAF+NNSSKYYI+ KES+YTEVT+LL+++GI
Sbjct: 228  VDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGI 287

Query: 292  DLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLN 351
            DLDHKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGTA YK  IE  + +I+ LN
Sbjct: 288  DLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLN 347

Query: 352  EVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTL 411
            +VC+EKENRFE+V++EKNSLESGK+ ALEFLEKEK LTLL+SKL Q+ + Q   KL+ TL
Sbjct: 348  DVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETL 407

Query: 412  EKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRV 471
             KIS  N+ L  EK K+ +  ++V +++ +  + K ++     + K L  +RR ++  + 
Sbjct: 408  GKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKT 467

Query: 472  SLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERS 531
            S+EE+ +NL  K  KAEK LKST++S++++++ LEEL   Q +++ ++  L + L +ERS
Sbjct: 468  SMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERS 527

Query: 532  ILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKK 591
             LD+IKLSL+DKT  ISAEI  HE++LEPW+ QLQEK                   K  +
Sbjct: 528  KLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQ 587

Query: 592  NVETLEEKI--LAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVL 649
            N+  L+ +I   A+K + QE                 +   GEK   SA  KL EM+ VL
Sbjct: 588  NIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRID--IGEKECGSASSKLGEMKNVL 645

Query: 650  NAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTA 709
             +HRQRAMEARS+LS  +NK+KVL+AL RLQ+SGRI GFHGRLGDLG IDD +DVAISTA
Sbjct: 646  ISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTA 705

Query: 710  CPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVK 769
            CPRLDD+VVD VEC Q CI++LRKNKLGYARFI+LD+LR+FNL PI TPE VPRLFDLV+
Sbjct: 706  CPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVR 765

Query: 770  PKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVA 829
             KN KF  AFYSVLRDTLV  +LKQAN VAYGK+RFRVVT+DGKLID SGT+SGGG HV 
Sbjct: 766  SKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVM 825

Query: 830  KGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDL 889
            KGLMK   ++      YTPEEV  IE+EL+ERE NF +A +T H+MEE LKK +D EP++
Sbjct: 826  KGLMK---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEI 882

Query: 890  ESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQ 949
            E +I+K  ++ +S ++EL L ++Q+KE E        +  +L      L+ L  EY++++
Sbjct: 883  EVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIE 942

Query: 950  SETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXX 1009
            +ETK K++ I  L+++IMKIGG KLQ+QNSKV S+ ++++I                   
Sbjct: 943  NETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDL 1002

Query: 1010 XXFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXX 1069
               +   + +  D+E  + E+  I       +  + + DT++NET +             
Sbjct: 1003 KRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVK 1062

Query: 1070 XXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGML 1129
                +   + ++FKS+EIE+ N+LEKLN L ++IK EI   +  LN L IRD+T TL  L
Sbjct: 1063 TNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL 1122

Query: 1130 DDNKMDSVKED--VKNNQELDQEYRSCETQDESEIKDAETSCDNYH---------PMNID 1178
            ++ K+    ED     ++E+ +E R   +   +   D E + + +           M+ID
Sbjct: 1123 NEGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDID 1182

Query: 1179 ETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRR 1238
            E  +E S G+P+ SE +L+ + +E +E +I+EL++YV+  +VDI VLEEYARRLAE+K+R
Sbjct: 1183 EYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKR 1242

Query: 1239 KLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDS 1298
            KLDLN AV KRDEV++    LKKKR D+FM GF+IISMTLKEMYQMITMGGNAELELVDS
Sbjct: 1243 KLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDS 1302

Query: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
            LDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALD
Sbjct: 1303 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1362

Query: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK +N T+STT++NIDILN
Sbjct: 1363 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1417 bits (3668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/1441 (52%), Positives = 1005/1441 (69%), Gaps = 33/1441 (2%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDA-EEDSQV---ENRVNLSENTPEPDLPALEASYS 56
            M D+P SK  KR++  E  ++  Q  A EED+      N+ N ++++    LP L++S S
Sbjct: 1    MLDTPSSK--KRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVS 58

Query: 57   -----KSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQ----PPKTSSRGRDHKSYX 107
                 K+ TPRKL++   EN+YA SQPT S ++SL VP LQ    P    SRGR  K Y 
Sbjct: 59   PLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYS 118

Query: 108  XXX----XXXXXXXXXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLEN 163
                              LEL+QLSP+KNSR+ELQK+YD H +   + +RL+I++LVL N
Sbjct: 119  QSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHN 178

Query: 164  FKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223
            FKSYAG+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 179  FKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSER 238

Query: 224  FPSLQSCSVAVHFQYVIDESSGTSRID--EEKPGLIITRKAFKNNSSKYYINEKESSYTE 281
            F +L  CSV VHF+YV DE +  +  D  E +  L+ITRKAFKNNSSKY+IN KES++TE
Sbjct: 239  FTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTE 298

Query: 282  VTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIE 341
            VTKLLK +GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT +YKPLIE
Sbjct: 299  VTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIE 358

Query: 342  ERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLL 401
            ++  +IE +NE+C+EKENRF IVD EKNSLE  K+ ALEFLEKEKQLTLL+SKL Q+ L 
Sbjct: 359  QKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLY 418

Query: 402  QSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVL 461
             +N K+ +TL +I S   D E EK +  + +K+V+ ++    E K+ ++S +++EK+L+ 
Sbjct: 419  VNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQ 478

Query: 462  ERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKD 521
             +RE+    VSLEE TKNL  K++KA+ T++S+K  IS+ E+ L+E    Q E+E E+ D
Sbjct: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVND 538

Query: 522  LTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXX 581
            L++  E E  IL DIKL LKDKT   S EI   EKELEP + ++QEK             
Sbjct: 539  LSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDL 598

Query: 582  XXXXXAKLKKNVETLEEKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLK 641
                  K+   +E+L+E++L  +   ++                 E+ +G+K    A +K
Sbjct: 599  IRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVK 658

Query: 642  LKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDS 701
            L EM+ +LN+HRQ+ MEARS++S AQNK+KVLT+L R+Q+SGRINGFHGRLGDLG+I D 
Sbjct: 659  LNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQ 718

Query: 702  FDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENV 761
            +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ PI TPENV
Sbjct: 719  YDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENV 778

Query: 762  PRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTM 821
            PRLFDLVKPK  +F+ A YSVLRDTLVA++LKQAN VAYGK+RFRVVT+DG+LIDISGTM
Sbjct: 779  PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTM 838

Query: 822  SGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKK 881
            SGGG+ V KGLM L T  S   + ++ E++ K+E EL+ RE  F VAS+T H ME+EL+K
Sbjct: 839  SGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRK 898

Query: 882  LRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERL 941
            L D EP LE +ISK  ++ D+L  ++ L   Q+ E    Y K++ D   L++++ NLE L
Sbjct: 899  LCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEAL 958

Query: 942  RGEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXX 1001
              E   LQ ++KT  E++  L+DEIM+IGG +LQ+QNSKV S+ Q++DI           
Sbjct: 959  NQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTV 1018

Query: 1002 XXXXXXXXXXFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXX 1061
                       +K L  S  +   S++E+   + + +  K +L + + ++    +     
Sbjct: 1019 VKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINL 1078

Query: 1062 XXXXXXXXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRD 1121
                        +  E++NEFK+I++E++NK+E+ NS+L+Y+K E  Q  + LN   +RD
Sbjct: 1079 EQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRD 1138

Query: 1122 VTHTLGMLDDNK-----------MDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCD 1170
            VTHTL +L + +            D    +V +N+ L       E  + S + ++     
Sbjct: 1139 VTHTLDLLREEEGTEANQQPTTGTDETTSNV-DNEMLGAADAGVENMNTSSLSNSVKVAS 1197

Query: 1171 NYHPMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYAR 1230
            +   M++D+  D VS+GIPRLS+ EL  +D + +  +IN+L  ++   +++I +LEEYA+
Sbjct: 1198 DEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAK 1257

Query: 1231 RLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGN 1290
            RL EFK+RK+DLNN+V +R+++   +  LKKKR++EFM GF+IISMTLKEMYQMITMGGN
Sbjct: 1258 RLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGN 1317

Query: 1291 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1350
            AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1318 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1377

Query: 1351 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIK 1410
            DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N TK+ TI+
Sbjct: 1378 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIR 1437

Query: 1411 N 1411
            N
Sbjct: 1438 N 1438

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1402 bits (3630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/1421 (53%), Positives = 986/1421 (69%), Gaps = 29/1421 (2%)

Query: 5    PLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPRKL 64
            P  KRQK   +  PE    + +  ED +   R    ++      PA+    SKS+TPRKL
Sbjct: 8    PSPKRQKVLESHTPEQQ--EENRREDDESPLRFEHQQSAVSLSPPAI----SKSHTPRKL 61

Query: 65   VLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSS---RGR-DHKSYXXXXXXXXXXXXXX 120
            +L   +NRYAFSQPT S + SL VP+LQPP+TSS   RGR D K Y              
Sbjct: 62   ILHQSDNRYAFSQPTVSAS-SLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRV-ELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTS 179
             LEL+QLSPVKN+R+ +LQ++Y+    S  ++ RLFIN+LVL NFKSYAG+QV+GPF+T+
Sbjct: 121  KLELIQLSPVKNNRIRKLQELYN----SQIKKERLFINKLVLNNFKSYAGEQVIGPFNTN 176

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYV 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L SCSV V FQYV
Sbjct: 177  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYV 236

Query: 240  IDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFL 299
            +D+S+G+S+ID+ KP LIITRKAFKNNSSKY+IN KESSYTEVTKLLK EGIDLDHKRFL
Sbjct: 237  VDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFL 296

Query: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKEN 359
            ILQGEVENIAQMKPKAE+E DDGLLEYLEDIIGTA+YK  IE+   +++ LNE+C+EKEN
Sbjct: 297  ILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKEN 356

Query: 360  RFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNK 419
            RFEIV+REKNSLES K  ALEF++KE++LTL +SKL Q+ +L+ + KLASTL+K+S   +
Sbjct: 357  RFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQE 416

Query: 420  DLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKN 479
            + ++E  KF+ + ++ ++++   K++  +I S     K    ++REL+  + SLEE+ K+
Sbjct: 417  EYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKS 476

Query: 480  LVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLS 539
               K EKA K++  +K  +    N +E L   Q E E+ ++ L   L+KE+++L++IKLS
Sbjct: 477  YTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLS 536

Query: 540  LKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEK 599
            LKDKT +IS EI +HE+ELEPW  QLQEK                  +KLK  +E L+  
Sbjct: 537  LKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKND 596

Query: 600  ILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEA 659
            +  +  +K+                  E  +GE    +A  K+K+MQ VL   RQ+ M+A
Sbjct: 597  LKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDA 656

Query: 660  RSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVD 719
            RS L+  +NKSKVL+AL +LQKSGRI+GF+GRLGDLGVID+ +D+AISTA  RLDD+VVD
Sbjct: 657  RSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVD 716

Query: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAF 779
            +VEC QHCI+YLRKNKLGYARFILL++LR   L+ I TPENV RLFDLVKP    F  AF
Sbjct: 717  SVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAF 776

Query: 780  YSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQ 839
            YSVLR+TLVA++LKQAN VAYG  RFRVVT+DGKLIDISGT++GGG   A+GLMKL    
Sbjct: 777  YSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKG 836

Query: 840  SDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEME 899
             + +D Y+ ++++KIE+EL ERENNF+ A+DT  EME+ L++L+D +P+LE +ISK  M+
Sbjct: 837  QENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMD 896

Query: 900  ADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKI 959
             D  + EL   + Q+K+    Y +   +K ++  +   L  L+ EY  L   TK   EKI
Sbjct: 897  TDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKI 956

Query: 960  KGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNS 1019
              L+  IM+IGGI LQMQNSKV S+ Q +DI                      +K L  +
Sbjct: 957  DKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGA 1016

Query: 1020 ERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEESI 1079
            E D +  S E+    ++++  + +L   D    +  N                 + E   
Sbjct: 1017 ELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEG 1076

Query: 1080 NEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLG-MLDDNKMDSVK 1138
             +FKS EI++K++LEKLN+LL +IK  I + ++ L  L +R+ T   G   D+N ++ V 
Sbjct: 1077 TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVD 1136

Query: 1139 EDVKNN----QELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSED 1194
                      Q+ ++  R    ++E    +AE        M ID+ +DE S GIPR+S+ 
Sbjct: 1137 RTSHGGGVPLQDQNKVVRENNMRNEKNSTEAE--------MEIDDVADEFSPGIPRISKA 1188

Query: 1195 ELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKE 1254
            +L ++DV+ +E++I +L  YV  TNV+I VLEEYARRLA++  RKLDLN AV++R+ +K+
Sbjct: 1189 KLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKK 1248

Query: 1255 QLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK 1314
             L  LKKKR+DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPK
Sbjct: 1249 LLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPK 1308

Query: 1315 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1374
            KSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK
Sbjct: 1309 KSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1368

Query: 1375 NAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDIL 1415
            NAQFIVISLRNNMFELAQQL+G+YKRDN+TKS  I+N D L
Sbjct: 1369 NAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1377 bits (3563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/1449 (52%), Positives = 976/1449 (67%), Gaps = 87/1449 (6%)

Query: 3    DSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPR 62
            DSPL+K+QK                   + V N    S     PD+       S+S TPR
Sbjct: 2    DSPLAKKQK-------------------THVSNESENSSTEESPDV----TRASRSRTPR 38

Query: 63   KLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPK---TSSRGRDHKSYXXXXXXXXXXXXX 119
            KLVL S + R+AFSQP +S+++  +VP+LQP K   +SSRGR    Y             
Sbjct: 39   KLVLGSPDKRFAFSQPVSSSSS--NVPHLQPLKNELSSSRGR---VYSQSPPRSPNRSPT 93

Query: 120  XXLELLQLSPVKNSRVELQKIYD-RHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHT 178
              LEL+QLSP+K SR+E QK  + R    S Q  RL I+ LVL NFKSYAG QVVGPFH 
Sbjct: 94   RKLELIQLSPMKKSRLESQKFQESRAMMGSIQ--RLCIDRLVLHNFKSYAGTQVVGPFHN 151

Query: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQY 238
            SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P L SC V + FQY
Sbjct: 152  SFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQY 211

Query: 239  VIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRF 298
            V DE  GT+ I ++KP ++I RKAF+NN+SKYY+N KESSYT +T+LL++EGIDLDHKRF
Sbjct: 212  VQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRF 271

Query: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKE 358
            LILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGTA YKPLIE  + +I  LN++C EKE
Sbjct: 272  LILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKE 331

Query: 359  NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN 418
            NRFEIV+REK+SLE GK  ALE+LEKEK LT+LRSKL Q+ L ++  KL ST EKI+ + 
Sbjct: 332  NRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQ 391

Query: 419  KDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTK 478
            + L  EK K  +  +++  +KA  + +K  +      EK L LE+R  +  RVSLEE+ K
Sbjct: 392  EKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLK 451

Query: 479  NLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538
            NL  K  K+ ++L+S   SIS  +  +EEL   Q +HE ++ +L   +++E+  LD+IK 
Sbjct: 452  NLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKS 511

Query: 539  SLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEE 598
            SLKDK   IS +I   EKELEPW+++LQEK                  AK+++++  + +
Sbjct: 512  SLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNK 571

Query: 599  KILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAME 658
             I   +    E                 + + G+    +A  K+KEM+ +L AHRQR+++
Sbjct: 572  GIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSID 631

Query: 659  ARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVV 718
            ARSSLS  +NK+KVL AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPRLDD+VV
Sbjct: 632  ARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVV 691

Query: 719  DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNA 778
            +TVEC Q CI+YLRKNKLGYARFILLD+LR FNL PI TPENVPRL+DLV+P NPKF NA
Sbjct: 692  ETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNA 751

Query: 779  FYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN 838
            FYSVLRDTLVA++LK+AN VAYGK+R+RVVT+DGKLID+SGTMSGGGN  A+G+MK    
Sbjct: 752  FYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMK-SEQ 810

Query: 839  QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEM 898
            QS+    +T EEV +I++ELSERE+NF++A+DT+HEMEE L+KL+D EP++E  ISK ++
Sbjct: 811  QSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKL 868

Query: 899  EADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEK 958
            + DSL+SE+  +E +++       +  S   +L+     L+ L+ EY +L++E ++KK++
Sbjct: 869  DIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKE 928

Query: 959  IKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQN 1018
            +K LQ++IMK+GG KLQMQ+S V+SV Q++ I                     +QK  + 
Sbjct: 929  MKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQ 988

Query: 1019 SERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDMEES 1078
               +++  S E  +IE  L  +   + E    ++E++N                   EES
Sbjct: 989  LAEELKSCSQEKSLIENNLDSSSKKVDE----LSESINKLKDELELTEERVRKA---EES 1041

Query: 1079 INE-------FKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDD 1131
            I+E       F+++EI+   +L+KL  L   +  E  +    LN L IRDVT TL  LD+
Sbjct: 1042 IDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDE 1101

Query: 1132 NKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDE------------ 1179
            +  +  K +V           + ET  E   +D E S   + PM++DE            
Sbjct: 1102 SLENESKNEV-----------AAETPGE---EDGEHSSSLHDPMDVDENQGESTSTTEAQ 1147

Query: 1180 ----------TSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYA 1229
                      T + +  G+P+L EDEL   +VE +E +I++L  YVE    DI +LEEYA
Sbjct: 1148 LQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYA 1207

Query: 1230 RRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGG 1289
            RRL E+K RK+DLN+AVQ+RD+V++    LKKKR DEFM GFN I M LKEMYQMITMGG
Sbjct: 1208 RRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGG 1267

Query: 1290 NAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1349
            NAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1268 NAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1327

Query: 1350 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGVYK  N TKS  +
Sbjct: 1328 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387

Query: 1410 KNIDILNRT 1418
            +N D+++R+
Sbjct: 1388 QNTDLIDRS 1396

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 752/1438 (52%), Positives = 974/1438 (67%), Gaps = 62/1438 (4%)

Query: 3    DSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPR 62
            +SPLSK+QK    ++          E+ SQ E  V+++               S+S TPR
Sbjct: 2    ESPLSKKQKTFVNRD----------EDFSQTEESVDVTR-------------ASRSRTPR 38

Query: 63   KLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKT---SSRGRDHKSYXXXXXXXXXXXXX 119
            KLVL S + R+AFSQP   T++S +VP LQP K+   SSRGR    Y             
Sbjct: 39   KLVLGSPDKRFAFSQPV--TSSSSNVPYLQPLKSELSSSRGR---VYSQSPPRSPTRSPT 93

Query: 120  XXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTS 179
              LEL+QLSP K +R+E QK  ++ +  ++   RL IN L L NFKSYAG QVVGPFH+S
Sbjct: 94   RKLELIQLSPTKKTRLESQKT-EQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSS 152

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYV 239
            FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSEA P+L SC V V FQYV
Sbjct: 153  FSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYV 212

Query: 240  IDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFL 299
             DE  G + + +++PGL++TRKAFKNN+SKYY+N KESSYT+VT+LL+ EGIDLDHKRFL
Sbjct: 213  QDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFL 272

Query: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKEN 359
            ILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGTA YKPLIE+ + QI+ LN+VC EKEN
Sbjct: 273  ILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKEN 332

Query: 360  RFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNK 419
            R+EIV+REK+SLESGK+ ALEFLEKEK+LT LRSKL Q KL +++ K  +T EKI +  +
Sbjct: 333  RYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEE 392

Query: 420  DLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKN 479
             L  E+ K+ E  +++ +++++ K +   I      E +L  E+R  +  RVSLEE+ KN
Sbjct: 393  KLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKN 452

Query: 480  LVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLS 539
            +  K  KAEKT  +T +SI+  +  LEEL   Q ++E E+ +L + L  E++ LD+IK+S
Sbjct: 453  ISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKIS 512

Query: 540  LKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEK 599
            LK KT  IS +I   E+ELEPW+++LQEK                  AK+ + +   E  
Sbjct: 513  LKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEND 572

Query: 600  ILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEA 659
            I   +    E                 +   G+    +A  K+KEM+ VL  HRQR+++A
Sbjct: 573  ISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDA 632

Query: 660  RSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVD 719
            +SSLS  +NK+KVL+AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPRLDDVVV+
Sbjct: 633  KSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVE 692

Query: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAF 779
            TVEC Q CI++LRKNKLGYARFILLD+LR FN+  I TP NV RLFDLV P + KF NAF
Sbjct: 693  TVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAF 752

Query: 780  YSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMK---LG 836
            YSVLRDTLVA++LK+AN VAYGK+RFRVVT+DGKLID+SGTMSGGGNH A G+MK   L 
Sbjct: 753  YSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLN 812

Query: 837  TNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKA 896
            T  S     +T EEV +I+ EL+ERE NF++A+DT+HEME+ L+ L+D EP++E+ ISK 
Sbjct: 813  TGAS-----FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKR 867

Query: 897  EMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKN--LERLRGEYNDLQSETKT 954
             ME DSL SE+ L E +   A +   + +++ +   ++  N  L+ L+ E   L+ E K+
Sbjct: 868  RMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKS 925

Query: 955  KKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQK 1014
            KK KIK LQ++IMKIGG KLQ+Q S V+S+ Q++ I                     ++K
Sbjct: 926  KKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEK 985

Query: 1015 LLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXD 1074
                   D++  ++EL+ I+E +  +   + E + ++++                    +
Sbjct: 986  QAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEE 1045

Query: 1075 MEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKM 1134
                  +F   E+++ N+LEKLN LL +I  +     K L  L IRDVT TL  L  NK+
Sbjct: 1046 KSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTL--NKL 1103

Query: 1135 DSVKEDVKNNQELDQEYRSCETQDES--EIKDAET--SCDNYHP--------MNIDETSD 1182
              +  + ++  EL  +     +Q+ S  ++ + +T   C    P        M++DE  +
Sbjct: 1104 --LLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEE 1161

Query: 1183 -EVSRG-IPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKL 1240
             E S   +P+L+E +L+EL+VE +E +I +L+ +VE    DI VLEEY +RL +F+ RKL
Sbjct: 1162 METSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKL 1221

Query: 1241 DLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLD 1300
            +LN AV++RD V++    L+KKR DEFM GFN ISMTLKEMYQMITMGGNAELELVDSLD
Sbjct: 1222 ELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLD 1281

Query: 1301 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1360
            PFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1282 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1341

Query: 1361 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK  N TKS  ++N D++NR+
Sbjct: 1342 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1333 bits (3451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1371 (51%), Positives = 937/1371 (68%), Gaps = 30/1371 (2%)

Query: 60   TPRKLVLSSGENRYAFSQPTN-STTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXX 118
            TP KL+ +S + +   S+ ++ STT  L  P+LQPP      R    Y            
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQYSQSPPRSPNRSP 73

Query: 119  XXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHT 178
               +EL+QLSP+KNSR+ELQ++YD  Q   K+  RL I  LVLENFKSYAG+QVVGPFH+
Sbjct: 74   GRAVELIQLSPIKNSRLELQRLYDTKQ---KKVERLCIRTLVLENFKSYAGRQVVGPFHS 130

Query: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQY 238
            SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE +P L  CSV + FQY
Sbjct: 131  SFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQY 190

Query: 239  VIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRF 298
            V+DE  GT+R+   KP L + RKAFKNN+SKYY+N KES+YTEVT+LL++EGIDLDHKRF
Sbjct: 191  VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRF 250

Query: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKE 358
            LILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT  YK  IE+ + ++++LN++C+EKE
Sbjct: 251  LILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKE 310

Query: 359  NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN 418
            NRF++V++EK SLE GK+ AL FL+KEK LTLL SK +Q+ L  + SKLA TL  +S++ 
Sbjct: 311  NRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370

Query: 419  KDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTK 478
              LE EK K  E+ K++ E+    +++ +R+ S ++  K  + + R+LE   VS EE+ K
Sbjct: 371  NKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQK 430

Query: 479  NLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538
            +L+ K  KAEKTL + + SI + EN +EE   Q  E+ET +  L   +   ++ L+ +KL
Sbjct: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490

Query: 539  SLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLE- 597
            +L DKT +I+ E+   EKELEPW  +++EK                   KL+  +  L  
Sbjct: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550

Query: 598  --EKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQR 655
              E++    +H++E                     GE+  TSA  KL+EM+KVL  HRQR
Sbjct: 551  EIEQLRGNISHREESIETLNVESSSIRDYIL---VGERECTSARSKLEEMKKVLVTHRQR 607

Query: 656  AMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDD 715
              +ARS++S A+NK+KVLTALSRLQKSGRI+G+HGRLGDLG IDD +D+AISTACPRLDD
Sbjct: 608  VNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDD 667

Query: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKF 775
            +VVDTVEC Q CI++LRKNKLGYARFILLD+LR+FNLQP  TPENVPRLFDLVKPK PKF
Sbjct: 668  IVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKF 727

Query: 776  SNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKL 835
            + AFYSVLRDTLV  +L QAN VAYGKKR+RVVT+DGKLIDISGTM+GGG+  A GLMK 
Sbjct: 728  APAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK- 786

Query: 836  GTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895
             T QS     YTPEEV ++E EL+ERE NF+VA +T  EME  L+   D +P++E ++SK
Sbjct: 787  STQQSSL---YTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSK 843

Query: 896  AEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955
             +M+ +++++EL    ++  E E +   ++ D ++L    + L  L  + N   S +++K
Sbjct: 844  QKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESK 903

Query: 956  KEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKL 1015
             ++IK L+ +IM+IGG++LQ  NSKV+S+ Q++ I                      +K 
Sbjct: 904  NQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQ 963

Query: 1016 LQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXXXXXXXDM 1075
               ++ D+E    E++ ++         + E    +++                      
Sbjct: 964  QITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQK 1023

Query: 1076 EESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKM- 1134
             E I+ + SIEIE+  +L+KL +L  Y+K E+ + +  L+ L +RD+   +  L++NK  
Sbjct: 1024 NEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSL 1083

Query: 1135 ---------DSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVS 1185
                     D+ +E+++++  + + + +  + +E +I  AE    N   M +DE +  + 
Sbjct: 1084 QSFSHSPTPDTKRENIQSS--MLETHLASPSPNERKISIAE----NNLSMEVDEQASVLE 1137

Query: 1186 RGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNA 1245
             G+P+L + EL  +D+E +E  I +L  Y++ + VDI +L+EYA+RLAE++RR++DLN A
Sbjct: 1138 NGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEA 1197

Query: 1246 VQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1305
            + KRDE +    +LKK+R DEFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1198 IMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEG 1257

Query: 1306 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1365
            V FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1258 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1317

Query: 1366 ANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            ANYIKERTKNAQFIVISLRNNMFELAQ+LVG+YK  N T+STT++N DI+N
Sbjct: 1318 ANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1310 bits (3390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/1377 (51%), Positives = 933/1377 (67%), Gaps = 37/1377 (2%)

Query: 60   TPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXXXXXXXXXXX 119
            TP KL+  S   ++  SQ ++++TT+L  P+LQPP  S   R    Y             
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNRSPA 74

Query: 120  XXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTS 179
              +EL+QLSP+KNSR+ELQKIYD  Q+++K   RL I  L+L NFKSYAG QVVGPFH+S
Sbjct: 75   RRIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYAGVQVVGPFHSS 131

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYV 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L  CSV + FQYV
Sbjct: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191

Query: 240  IDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFL 299
            +D++ G +++  +   L + RK FKNN+SKYYIN KESSYTEVT+ L+NEGIDLDHKRFL
Sbjct: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251

Query: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKEN 359
            ILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGTA YK  I + + +++ LN++C+EKE 
Sbjct: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311

Query: 360  RFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNK 419
            RFE+V++EK SLE+GKE ALEF+ KEKQLTLL+SK  Q+ + +   KLA TL+KIS+  +
Sbjct: 312  RFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTE 371

Query: 420  DLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKN 479
             LE+E+ K+ E  K++ +++     ++++I+  ++++  LV ++ +L+   VS EE+ K+
Sbjct: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431

Query: 480  LVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLS 539
            L  K  KAEKTL+  + +I   EN +  L   QTE E  + +L + L  ERS LD IK+S
Sbjct: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMS 491

Query: 540  LKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEEK 599
            L+DKT +IS E+   EKELEPW  +L+ K                   KL++ +  L + 
Sbjct: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551

Query: 600  ILAKK----THKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQR 655
            I + K     HK++                   +QGE +  SA  KL +M++VL  HRQR
Sbjct: 552  IESYKDRIENHKKKINKLEKESAAITSFIST--AQGECD--SAKKKLVDMKQVLTNHRQR 607

Query: 656  AMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDD 715
              +AR +LS  +NK+KVL AL RLQKSGRI+GFHGRLGDLG IDD +D+AIS ACPRLDD
Sbjct: 608  MTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDD 667

Query: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKF 775
            +VV+TVECAQ CI++LRKNKLGYARFILLD+L++FN+  ++TPENVPRLFDL  PKN  F
Sbjct: 668  IVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIF 727

Query: 776  SNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKL 835
            + A YSVLRDTLVA++L QAN VAYG +RFRVVT+DGKLIDISGTMSGGG+ V KGLMK 
Sbjct: 728  APALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKS 787

Query: 836  GTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895
                +D    YT EEV ++E EL++RE NF++A+DT  EME  L+K +D +P+++ +ISK
Sbjct: 788  KQRSNDM---YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISK 844

Query: 896  AEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955
             +++ D+L+SEL   +  + E E        D   L  +   L  L  E   L+ E+K K
Sbjct: 845  HKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVK 904

Query: 956  KEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKL 1015
             E+I  L+ +IMKIGG+KLQ QNSKV+S+ Q+L I                       K 
Sbjct: 905  NEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQ 964

Query: 1016 LQNSERDVELSSDEL-------KVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXXX 1068
               +E D+     EL       + ++E L+ T+  L E   +  E LN            
Sbjct: 965  KLGAENDINHCEIELSKTNNSHEALQEGLRETE-HLIEVIEDKKEQLN------QEHETA 1017

Query: 1069 XXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGM 1128
                 D    + +FKS EIEM   LEKL +L  +IK+EI++ ++ LN L +RDV   L  
Sbjct: 1018 KKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQK 1077

Query: 1129 LDDNKMD----SVKEDVKNNQ---ELDQEYRSCETQDESE--IKDAETSCDNYHPMNIDE 1179
            LD++ +     + +    +NQ   E+  E    +  D     I +   S ++   M++D+
Sbjct: 1078 LDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQ 1137

Query: 1180 TSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRK 1239
             +  +  G+P+L+E EL  +D+E +  +I +L  Y++    DI +LEEYA RLAE+KRRK
Sbjct: 1138 DASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRK 1197

Query: 1240 LDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSL 1299
            LDLN +V+KR+E++ +  +LKK R +EFM GF IISMT+KE+YQMITMGGNAELELVDSL
Sbjct: 1198 LDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSL 1257

Query: 1300 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359
            DPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1258 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1317

Query: 1360 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+G+YK  N TKSTT++NIDILN
Sbjct: 1318 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1288 bits (3333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/1390 (50%), Positives = 937/1390 (67%), Gaps = 49/1390 (3%)

Query: 49   PALEASYSKSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXX 108
            P  +  + +S TPRKL++SS ++R+  SQP N  +     P+LQ P  S+ GR+HK Y  
Sbjct: 59   PQSQDRHGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPSVST-GREHKFYSQ 116

Query: 109  XX----XXXXXXXXXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENF 164
                             LEL+QLSP+KN+R ELQK+Y+  Q+  K+  RL I  LVL NF
Sbjct: 117  SPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNF 175

Query: 165  KSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAF 224
            KSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +
Sbjct: 176  KSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKY 235

Query: 225  PSLQSCSVAVHFQYVIDE-SSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVT 283
            P L SCSV +HFQYVID+ + G S+IDE K  L++ RKAFKNNSSKYYIN+KESS+T+VT
Sbjct: 236  PELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVT 295

Query: 284  KLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER 343
             LLKNEGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGT++YK  IE  
Sbjct: 296  TLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHN 355

Query: 344  MGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQS 403
            + ++E LNE+C+EKENRF IV++EK+SL  GK  AL++L  EK L L +SK +Q +L   
Sbjct: 356  LSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYID 415

Query: 404  NSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLER 463
            N KL STL KI+ + ++ + E  K+    K++  ++ +   +  R++     E+ L+  +
Sbjct: 416  NKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQ 475

Query: 464  RELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLT 523
            R+     +S +E  KN+  K + AEK + +T+ SI++  N LE L  QQ ++  +I++L 
Sbjct: 476  RKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELN 535

Query: 524  QLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXX 583
            + L+ E+S L++IK+SLK KT+  S EI+++EKELEP+ +QLQEK               
Sbjct: 536  EKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLN 595

Query: 584  XXXAKLKKNVETLEEKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLK 643
                 L   + ++++ I  KK                      E   G+  F     K++
Sbjct: 596  ENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQ 655

Query: 644  EMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFD 703
            EM+  L++HRQ+A ++R+SLS  QNK+ VLTAL +LQKSGRI+GF+GRLGDLGVID+ +D
Sbjct: 656  EMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYD 715

Query: 704  VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPR 763
            VAISTACPRL+D+VVD+V+C Q CIDYLRKN+LGYARFILLD+LR+FNL  I TP+N PR
Sbjct: 716  VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPR 775

Query: 764  LFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSG 823
            LFDL++ +  KF  AFYSVLRDTLVA NL  AN VAYGK+RFRVVT+DGKLIDISGTMSG
Sbjct: 776  LFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSG 835

Query: 824  GGNHVAKGLMKLGTN-QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKL 882
            GGN+V +GLMKLG +   +  +  +PEEV K+EREL   E NF+VA +++ EM +E+  +
Sbjct: 836  GGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHM 895

Query: 883  RDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLR 942
            ++  P  E  ISK  +E +   +E+     Q+KE +  + +  ++  ++ V    L+ L+
Sbjct: 896  KEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALK 955

Query: 943  GEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXX 1002
             EY  L  +TK  K++I+ L+ +IM  GGI+L+MQNSKV S+  +L I            
Sbjct: 956  KEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAI 1015

Query: 1003 X--------------XXXXXXXXFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAEND 1048
                                   F+  L+NS++ V L S+EL  +E              
Sbjct: 1016 KKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLE-------------- 1061

Query: 1049 TNMNETLNXXXXXXXXXXXXXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEIT 1108
            +++N+T N                 ++EE    FKS E+E+KNKL+KL  L  +++ +I 
Sbjct: 1062 SDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIG 1121

Query: 1109 QQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDV-KNNQELDQEYRSCETQDESEIKDAET 1167
            + +  LN L+IR+++  L   D+ +++  K D+ KN    D ++ S      S I     
Sbjct: 1122 KLDTELNALTIREISQNLESFDE-RLE--KYDISKNGATEDTQHTSSALNSVSNI----- 1173

Query: 1168 SCDNYHPMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEE 1227
               N   M+ID T +E++ GI RLSE E+ ELD+E ++++I  L   +E +  +I +LEE
Sbjct: 1174 ---NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEE 1230

Query: 1228 YARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITM 1287
            Y RRL+E+K+RK DL+ ++ +++  KE+  +LKKKR +EF  GF+IIS+TLKEMYQMITM
Sbjct: 1231 YVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITM 1290

Query: 1288 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1347
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1291 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1350

Query: 1348 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKST 1407
            YVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVG+YK +N T+S 
Sbjct: 1351 YVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSA 1410

Query: 1408 TIKNIDILNR 1417
            T+ N D+LNR
Sbjct: 1411 TLVNNDMLNR 1420

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1288 bits (3332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1370 (51%), Positives = 938/1370 (68%), Gaps = 31/1370 (2%)

Query: 57   KSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYXXXX----XX 112
            KSYTP K+++S+  +      P+   ++S   P+LQ P +SSRGR  K+Y          
Sbjct: 45   KSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDR 104

Query: 113  XXXXXXXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQS---RLFINELVLENFKSYAG 169
                     LEL+QLSP+KNSR ELQKIY     SSKQ+    R+ +N+LVL NFKSYAG
Sbjct: 105  SPVRSPTRKLELIQLSPIKNSRSELQKIY-----SSKQEEKIERICLNKLVLHNFKSYAG 159

Query: 170  KQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQS 229
             Q +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +P L S
Sbjct: 160  TQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTS 219

Query: 230  CSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNE 289
            C+V VHF+Y+ID    T++I+  K  LIITR+AFKN++SKYY+N KES+Y  +T LLK E
Sbjct: 220  CAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEE 279

Query: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIEN 349
            GIDLDH RFLILQGEVENIAQMKPKAEKE DDGLLEYLEDIIGT  YK LI+++  +IE 
Sbjct: 280  GIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEA 339

Query: 350  LNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLAS 409
            LN++C+E+ENRF+I+DREK SLES KE+ALE+L KEK+  +++SKL Q+K+ Q+N KL++
Sbjct: 340  LNDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSN 399

Query: 410  TLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGT 469
            TLEKI+    +   EK K  E   K+DE++    + +D + +    EK LV  +R L+  
Sbjct: 400  TLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSD 459

Query: 470  RVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKE 529
             VS  E+ KN+  K++K  K ++    +IS +   L+     +   ET++ +L   L  E
Sbjct: 460  NVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTE 519

Query: 530  RSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKL 589
              +L++IKL LKDKT  +S EI++ EK+LEPW+++L E                    KL
Sbjct: 520  SQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKL 579

Query: 590  KKNVETLEEKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVL 649
            K N+E LE+ +  K    ++                 E   G      A+ KL EMQK+L
Sbjct: 580  KANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKIL 639

Query: 650  NAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTA 709
               RQ+A +AR+SLS  +N+SKVL AL +LQKSGRINGFHGRLG+LGVID+ +DVAISTA
Sbjct: 640  IQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTA 699

Query: 710  CPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVK 769
            CPRL+D+VVD+VEC Q CI+YLRKN LG+ARFILLD+L +F+++ ISTP NVPRLFDL+K
Sbjct: 700  CPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIK 759

Query: 770  PKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVA 829
              + KF  AFYSVLR+TLVA +LK+AN VAYGK R+RVVT+ G LIDISGTMSGGGN  +
Sbjct: 760  VNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQAS 819

Query: 830  KGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDL 889
            KG M+L  + S +   Y+ EEV +IE+ELS RE N++ A +TV EME EL+ L++ EP +
Sbjct: 820  KGAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKI 879

Query: 890  ESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVV-MKN-LERLRGEYND 947
            E +ISK   E DSL +E +L  +Q+ E   ++  ++ D    ++  M N L  L  +   
Sbjct: 880  ELEISKLNFEIDSLENECSLKRKQLNEPNASF--SIEDNMSADITEMDNALYTLNEKQKL 937

Query: 948  LQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXX 1007
            ++S+ K+KK++IK LQD+IMKIGGIKLQMQNSKV+S+ ++  I                 
Sbjct: 938  IESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIES 997

Query: 1008 XXXXFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXXXXXXXXXX 1067
                  K L+ SE D    +++   +E +LK+ +  LA+N+ NMN   +           
Sbjct: 998  DVRKLSKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEI 1057

Query: 1068 XXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLG 1127
                  +ME  ++EFK++E+E K K EKL SLL  IK  +   E+  + LSIR+V + L 
Sbjct: 1058 TMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLD 1117

Query: 1128 MLDDNKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRG 1187
            +L+      +KE         QE +  +T+  ++ +  +++      M I++ ++E+++G
Sbjct: 1118 LLN------IKE---------QEAQKIKTELYADFEQNQSNDVINDEMIIEDNNNEIAKG 1162

Query: 1188 IPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQ 1247
            IP   E + ++ D+  +E+++ +L  Y E   VD+ +LEEY RR+ E+++RK DLN +V+
Sbjct: 1163 IPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVE 1222

Query: 1248 KRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1307
            +RD+V+++L  LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVT
Sbjct: 1223 QRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVT 1282

Query: 1308 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1367
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1283 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1342

Query: 1368 YIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417
            YIKERTKNAQFIVISLRNNMFELA+QLVG+YK  N+TKS T+KN DIL R
Sbjct: 1343 YIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1440 (48%), Positives = 937/1440 (65%), Gaps = 64/1440 (4%)

Query: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60
            MSD P+SKRQK                     V       +    P     E S  ++ T
Sbjct: 1    MSDRPVSKRQK---------------------VTEEDEEEDVIHTPKAVTFEQS-PRAIT 38

Query: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKT--SSRGRDHKSYXXXXXXXXXXXX 118
            PR L+ S  ENR     PT  +  +L +P+L PP++  S+RGRD KSY            
Sbjct: 39   PRNLLGS--ENRNVL--PTGGSQ-NLQIPSLLPPESLGSARGRDFKSYSQSPPRSPGRSP 93

Query: 119  XXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHT 178
               L+L++LSP+KNSR ELQK+Y+  +   K++ RLFI++LVL +FKSYAG+QV+GPFHT
Sbjct: 94   TRRLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLNDFKSYAGRQVIGPFHT 152

Query: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQY 238
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP L+SCSV VHF+Y
Sbjct: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212

Query: 239  VIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRF 298
            VID+  G++ IDE K  L++TRKAFKNN+SKY++N KES+YTEVT LLK EGIDLDHKRF
Sbjct: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272

Query: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKE 358
            LILQGEVENIAQMK KAEKE+DDGLLEYLEDIIGT+ YK  IE+   +IE+LNE+C+EKE
Sbjct: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332

Query: 359  NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN 418
            NRF IV+REKNSLESGKE AL+FL KEK+L L +SKL+Q+ L+Q N KL   L K ++  
Sbjct: 333  NRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQ 392

Query: 419  KDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTK 478
            ++   ++ +F+++   + +I A    +K  +    ++E  L   +R LE  +V  E+   
Sbjct: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452

Query: 479  NLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538
            NL SK ++ E+  K  +  I+  +  ++ +  +Q+        L+  L+ E+  L++IKL
Sbjct: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKL 512

Query: 539  SLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXAKLKKNVETLEE 598
             L++KT++++ +I  +EKEL PW+ Q Q+                     L+ ++  LE 
Sbjct: 513  KLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572

Query: 599  KILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLKLKEMQKVLNAHRQRAME 658
             IL++K   +                  ER  GE+   +A   L  +++ + A RQ+A+E
Sbjct: 573  AILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIE 632

Query: 659  ARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVV 718
             RS+ S  +N +KVL+AL RLQKSGR+NGFHGRLGDL VID  +DVAISTACPRL+D+VV
Sbjct: 633  IRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVV 692

Query: 719  DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNA 778
            DTVE  Q CI+YLRKNKLGYARFILLD+L  FN   I TP+   RLFDL+  K  +F+NA
Sbjct: 693  DTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNA 752

Query: 779  FYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN 838
            FYSVLRDTLV QN++QAN VAYGKKR+RVVT+DG LID+SGTM+GGG +V+KGLMKL  +
Sbjct: 753  FYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKS 812

Query: 839  QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEM 898
             S     ++PEEV  IE EL+++EN ++ A D  HEMEEEL++LRD  P++++ +SK EM
Sbjct: 813  SSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEM 872

Query: 899  EADS----LASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKT 954
            + ++    + S + + E++ K+ E   +K  +D +    ++  L+ L+ + +D+  +TK+
Sbjct: 873  DIETAHNDINSNINVLEEKRKKLE--SMKNQNDPSI--TLLAKLKELKSKLDDIDVQTKS 928

Query: 955  KKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQK 1014
             K+KIK ++D+I+++GG +L+ Q+  V  +  K+                       F K
Sbjct: 929  TKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNK 988

Query: 1015 -------LLQNSERDVELSSDELKVIEEQLKHTKLA---LAENDTNMNETLNXXXXXXXX 1064
                    L N  ++ E +  E K IE +L   K +   L EN+  +   +         
Sbjct: 989  ELTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEI--------- 1039

Query: 1065 XXXXXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTH 1124
                       ++ ++++KSI +E  NKLEKL +    +K  I +    L+EL+IRDVT 
Sbjct: 1040 -EMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQ 1098

Query: 1125 TLG--MLDDN----KMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNID 1178
             L   M ++N    K D   E+       D +  S  ++++S   + E    + + M ID
Sbjct: 1099 VLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEID 1158

Query: 1179 ETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRR 1238
                 ++ GIP LS  EL ++D + +E  I  L  ++  +  ++ VLEEYA R  EF +R
Sbjct: 1159 SQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKR 1218

Query: 1239 KLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDS 1298
            K DLN+AVQ RD VK++L  +K+KR+DEFM GF IISMTLKEMYQMIT+GGNAELELVDS
Sbjct: 1219 KNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDS 1278

Query: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
            LDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1279 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1338

Query: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418
            FRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVG+YK +N TKS  + N D++ R 
Sbjct: 1339 FRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1197 bits (3096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1377 (49%), Positives = 915/1377 (66%), Gaps = 26/1377 (1%)

Query: 46   PDLPALEASYSKSYTPRKLVLSSGENRYAFS--QPTNSTTTSLHVPNLQPPKTSS-RGRD 102
            P++     S S + TPRKLVL S E +YA S  Q T + + ++  P+LQPP   + RGR+
Sbjct: 14   PEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGRE 73

Query: 103  H-KSYXXXXXXXXXXXXXXXLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVL 161
            + +S                LEL++LSP K++R+ELQK+   H+++++   RL I++LVL
Sbjct: 74   YSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVL 130

Query: 162  ENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKS 221
             NFKSYAG Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKS
Sbjct: 131  NNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKS 190

Query: 222  EAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTE 281
            E FPSL SCSV +HF YV D  +G ++I      +++ R+AFKNNSSKYY+N KES+YTE
Sbjct: 191  EQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTE 250

Query: 282  VTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIE 341
            VT+LLK EGIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGTA +KP IE
Sbjct: 251  VTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIE 310

Query: 342  ERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLL 401
            + + +IE LNEVC+EKENRFE+VD+EK +LESGKE ALEFL+KE++ T+L+++L Q ++ 
Sbjct: 311  KCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIY 370

Query: 402  QSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVL 461
             SN KLA++ +KIS+ N + ++EK +++   K+ + +  +    K   ++  ++ K +  
Sbjct: 371  DSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNS 430

Query: 462  ERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKD 521
            ++R LE   ++ +E+ K++  K++ AEK    ++ +   A N +E L+    + E E+ +
Sbjct: 431  KKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHN 490

Query: 522  LTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKXXXXXXXXXXXXX 581
            L   +  E+  L++IK+ L +KTK++S E+   E++LEP+  Q+QEK             
Sbjct: 491  LNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITM 550

Query: 582  XXXXXAKLKKNVETLEEKILAKKTHKQEXXXXXXXXXXXXXXXXXERSQGEKNFTSAHLK 641
                 + L K   T+E KI   +  + +                   S  +K    A  +
Sbjct: 551  LKSSHSNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQ 610

Query: 642  LKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDS 701
              EM+ VL   RQ   EA+++L+  QNK++VL AL++LQ SGRI GFHGRLGDLG IDD 
Sbjct: 611  TNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQ 670

Query: 702  FDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENV 761
            +D+AISTACPRLDD+VV+TVEC Q CID+LRKNKLGY RFILLD+LR+ NL  I+TPENV
Sbjct: 671  YDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENV 730

Query: 762  PRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTM 821
            PRLFDL+ P    F  AFYSVLRDTLVA++L+QAN VAYGK+RFRVVT+DGKLIDISGTM
Sbjct: 731  PRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTM 790

Query: 822  SGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKK 881
            SGGG+    GLM+   +++     Y+ +EV+K+E +LS +E N+R A   VHEME  L+K
Sbjct: 791  SGGGSSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQK 847

Query: 882  LRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVV--MKNLE 939
            L D  P+++ QISK ++E  S  +E+    Q++  +++A   ++++K Q  ++   K L+
Sbjct: 848  LTDRLPEIDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEKKLD 905

Query: 940  RLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDIXXXXXXXXX 999
             LR         +K  ++KI  L+D IM+ GGI+L+MQ +KV S+ Q ++I         
Sbjct: 906  ILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEK 965

Query: 1000 XXXXXXXXXXXXFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNXXX 1059
                          +       +V + + ++ ++ EQL+  +L     +  + E      
Sbjct: 966  TRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKA 1025

Query: 1060 XXXXXXXXXXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSI 1119
                           +E   NEFK+ E+E  ++LEKL+ L  Y+K ++   E  L  L I
Sbjct: 1026 ELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKI 1085

Query: 1120 RDVTHTLGMLDDNKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDE 1179
            RDV+  L  L+D  ++S  +        D      +TQ       + T   N   M  D 
Sbjct: 1086 RDVSKLLSQLNDGIIESCTDVTAKVMNGD----IVQTQ-------SITDVGNNDAME-DS 1133

Query: 1180 TSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRK 1239
                   G+P L+E EL  LD+E +E ++++L  Y++  N DI VLEEYARRLAE++RRK
Sbjct: 1134 GEAATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRK 1193

Query: 1240 LDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSL 1299
            LDLN AV KR+EV+ +    K +R ++FM GF IISMTLKEMYQMITMGGNAELELVDSL
Sbjct: 1194 LDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSL 1253

Query: 1300 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359
            DPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1254 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1313

Query: 1360 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVG+YK +N TKSTT++NIDIL+
Sbjct: 1314 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  190 bits (482), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 218/769 (28%), Positives = 362/769 (47%), Gaps = 113/769 (14%)

Query: 687  GFHGRLGDLGVID-DSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
            G  G + DL     D + +A+ST   +  D ++VD +  AQ CI + +K + G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 745  DRLRQFNLQPISTPENVPRLFDLVKPKN-----PKFSNAFYSVLRDTLVAQNLKQANNVA 799
            D +   + QP     N+P   D +   N     P++  A   V  D+++  +L  A ++ 
Sbjct: 594  DTIS--SEQPTL---NLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLK 648

Query: 800  YGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEV--DKIER 856
            + K  R ++VT++G LI  +G M+GG       + K   N+ DK ++Y       DK+  
Sbjct: 649  WNKGVRSKLVTIEGALIHKAGLMTGG-------ISKDSNNRWDK-EEYQSLMTLKDKLLL 700

Query: 857  ELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASEL----TLAEQ 912
            ++ E     R++S    ++E EL  L      L  Q+S+ +   D   +E+    TL +Q
Sbjct: 701  QVEEISTKSRLSSTRARDVEIELSTLNAEISSLRMQLSQVQRSLDENKTEINHQNTLLDQ 760

Query: 913  QVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGI 972
            Q                  N  +K+L+    E++   +E K+ KEK   LQ+EI K    
Sbjct: 761  QY-----------------NPKLKSLKEKVDEFDKSWNELKSNKEK---LQNEIFKELTD 800

Query: 973  KLQMQNSKVESVCQKLDIXXXXXXXXXXXXXXXXXXXXXFQKLLQNSERDVELSSDELKV 1032
            K+     + E    +L                         K LQ  ++++    ++L+ 
Sbjct: 801  KVGFTIEEYERHSGEL--------------------LRKQSKELQQLQKEILNIENKLQF 840

Query: 1033 IEEQLKHTKLALAENDTNM---NETLNXXXXXXXXXXXXXXXXXDMEESINEFKSIEIEM 1089
              E+L++T+  L   ++N+   +ETL                  D  E   + K IE E+
Sbjct: 841  EIERLENTQKRLTSAESNLEKAHETL-------------KSLQKDENELAEQVKQIESEI 887

Query: 1090 ---KNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDV-KNNQ 1145
               +N+L+ +N + T  + +I + E+ L EL+  D + TL        D +KED+ KN+ 
Sbjct: 888  NSARNELDSVNKVFTAQQLDINRMEESLGELN--DNSQTLK----RNRDEIKEDIAKNDL 941

Query: 1146 ELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELDVELIE 1205
            E     ++ +  +      +ET+  +     IDE +  VS  I         +   E+  
Sbjct: 942  ERIGILKNAKVTNIDIPVISETNLSDLPIDRIDEDTISVSNEIDVDYTALPAKYKEEMGS 1001

Query: 1206 SKINELSYYVEETNVDIGVLEEYAR---RLAEFKRRKLDLNNAVQK-----RDEVKEQLG 1257
            +  NEL   ++     + VL+  AR   R  E + R   ++   +K     R  +++ L 
Sbjct: 1002 ATKNELDTKIKNVEDLLDVLQPNARAADRFTEAQERFEIIDGETEKIKTTERKALQQFLK 1061

Query: 1258 ILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1308
            I KKKR + F   F+ +S  L  +Y+ +T          GGNA L L D  +PF+ GV +
Sbjct: 1062 I-KKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRY 1120

Query: 1309 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1368
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1121 HATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAY 1180

Query: 1369 IKER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            I+     N QFIVISL+N MFE +  LVGV+ R  +  S+ I  +D+ N
Sbjct: 1181 IRRHGNPNLQFIVISLKNTMFEKSDALVGVF-RQQQENSSKIVTLDLRN 1228

 Score =  109 bits (273), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 111/406 (27%), Positives = 198/406 (48%), Gaps = 45/406 (11%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R + + DLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 219 HK--------SEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKY 270
           ++        +     + S  V   ++    +       D+E+P + + R    N  + Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAISTNGDTTY 125

Query: 271 YINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            IN K  +Y E ++ L+ E I +  K FL+ QG+VE IA   P         L +  E++
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 331 IGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEF---LEKEKQ 387
            G+  YK   +E   QIE LN+   E       +  E  + + G     E+   +EK K+
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEYKNNIEKRKK 238

Query: 388 --LTLLRSKLFQFK---------LLQSNSKLASTLEKISSSNKDLEDEKMKF-QESLKKV 435
             + L+  +L+  +         L  + S+++    KI++  K+L+  K  F +E+LK  
Sbjct: 239 YYMYLVLWQLYHLENEKKKSLDNLKNAKSEISQLKNKITNEEKNLQRSKSSFLKENLK-- 296

Query: 436 DEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRV---SLEERTKNLVSKMEKAEKTLK 492
             +  +R+++  ++     KEK  +LE  +L   ++   +  +R  N+  ++E  +K ++
Sbjct: 297 --VNKKREQLNYQL-----KEKDKLLE--DLNSIKIPQRAASKRINNIEKRIESIQKDIE 347

Query: 493 STKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538
             +  I+  EN L+ +   +   E EIK+  Q   K     DD+KL
Sbjct: 348 RQQGYINTFENQLKVVTKAKESFEREIKESAQNSNKYSLSDDDLKL 393

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  150 bits (378), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 113/170 (66%), Gaps = 12/170 (7%)

Query: 1252 VKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1302
            V EQ   +++ R D F + F+ +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1303 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1363 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGVYK--RDNRTKSTTI 1409
              +A YI++R   N QFIVISL+N MFE +Q LVGV++  RDN +++ T+
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 108/238 (45%), Gaps = 19/238 (7%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RQFNLQPISTP 758
           + VA+ST   +  D V+VD    AQ C+ +L+K + G   FI LD +   + ++  + T 
Sbjct: 548 YTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALDT- 606

Query: 759 ENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVTVDGKLIDI 817
           +      D +  +      A   V  D+++  +L  A ++ + +  R ++V++DG ++  
Sbjct: 607 KGCTLAIDAIDYERD-LERAMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSIVHK 665

Query: 818 SGTMSGG-----GNHVAK----GLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVA 868
           +G M+GG     GN   K    GLM L      ++ + +       ER +   EN     
Sbjct: 666 AGLMTGGTTKSSGNRWDKEEYQGLMSLKDTLLGEISELSSANTIDSER-IRSTENELSFL 724

Query: 869 SDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVS 926
           +  V  +  +L +++    + E++I   + + + +  E     Q +KEA  A+ K  +
Sbjct: 725 NSDVMSLRTQLNQVKRSLNEKETEI---QYQQELIKGEFEPKIQSLKEAMTAHAKTTA 779

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  142 bits (357), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 116/375 (30%), Positives = 193/375 (51%), Gaps = 46/375 (12%)

Query: 1076 EESINEFKSIEIEMKN-----------------KLEKLNSLLTYIKSEITQQEKGLN--E 1116
            E++ N+ KS +IEMK+                 KLE+    L  ++ + T ++  LN  E
Sbjct: 852  EKAQNDLKSAQIEMKSLEEQEEAAEMKIKSLESKLEENKIHLEGLQRKFTAKQSDLNSNE 911

Query: 1117 LSIRDVTHTLGMLDDNKMDSVKEDV-KNNQELDQEYRSCETQD-------ESEIKDAETS 1168
              + D+   L +L   + D +KED  K + E     ++C+  +       E+ I D   +
Sbjct: 912  DVLEDMNSNLQILKRER-DGIKEDTEKFDLERVTALKNCKISNINLPILSETTIDDLPIA 970

Query: 1169 CDNYHPMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEY 1228
              +   ++I    D   +G+P+  ++   +   + ++ KI E+   + E   +    E Y
Sbjct: 971  SGDSEAISISNKIDVDYKGLPKKYKESNTDSAKKGLDEKIREVEEILNELQPNARAEERY 1030

Query: 1229 ARRLAEFKRRKLDLNNAVQ--KRDEVK--EQLGILKKKRFDEFMAGFNIISMTLKEMYQM 1284
                 E + R   +NN  +  K +E K   Q   +K+KR + F   F+ +S  L  +Y+ 
Sbjct: 1031 D----EAEERFEVINNETEELKAEEKKILSQFLKIKRKRKELFEKTFDYVSDHLDAIYRE 1086

Query: 1285 IT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLAL 1335
            +T          GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL
Sbjct: 1087 LTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALAL 1146

Query: 1336 VFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQL 1394
            +FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  L
Sbjct: 1147 LFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDAL 1206

Query: 1395 VGVYKRDNRTKSTTI 1409
            VGVY++     S TI
Sbjct: 1207 VGVYRQQQENSSKTI 1221

 Score = 99.8 bits (247), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 143/304 (47%), Gaps = 55/304 (18%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 219 HKS-------------------EAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIIT 259
           ++                        + +S  V   +Q       G   ++       + 
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLVE-------LM 113

Query: 260 RKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKES 319
           R   +N  + Y I+ K  SY + +  L+NE I +  K FL+ QG+VE IA   P      
Sbjct: 114 RIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE---- 169

Query: 320 DDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEK-ENRFEIVDREKNSLE--SGKE 376
              L +  E++ G+  YK   +E   +IE L +   E  +NR  I    K   E  +  E
Sbjct: 170 ---LSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNE 226

Query: 377 TALEFLEKEKQLTLLRSKLFQF------------KLLQSNSKLASTLEKISSSNKDLEDE 424
             ++ ++K+ +L   ++ L+Q             KL  SNS+++S  EKI++  K L+  
Sbjct: 227 EYIKQVDKKNELQRFQA-LWQLYHLEQQKEELMDKLSASNSEVSSLKEKINNEMKSLQRS 285

Query: 425 KMKF 428
           K  F
Sbjct: 286 KSSF 289

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  141 bits (356), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 114/174 (65%), Gaps = 12/174 (6%)

Query: 1248 KRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1298
            K  +V E    +K+ R + F   F+ +S ++ E+Y+ +T          GGNA L L D 
Sbjct: 1045 KEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDE 1104

Query: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD
Sbjct: 1105 DEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALD 1164

Query: 1359 FRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGVYK--RDNRTKSTTI 1409
              NV  VA+YI+ +   + QFIVISL+N MFE +Q LVGV++  ++N +K+ T+
Sbjct: 1165 ISNVERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 75/159 (47%), Gaps = 10/159 (6%)

Query: 687 GFHGRLGDLG-VIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     + F VA+ST   +  D V+VD    AQ C+ +L+K + G   FI L
Sbjct: 529 GVRGLVHDLCHPKKEKFAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPL 588

Query: 745 DRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK- 803
           D +    +  I++      L        P    A   V  D+++   L+ A ++ +    
Sbjct: 589 DTVDVSKVPMIASEFKGCILAIDAIDYEPDLERAMQYVCSDSIICDTLQIAKDLKWKHNI 648

Query: 804 RFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDK 842
           R ++V+++G ++  +G M+GG    +KG    G N+ DK
Sbjct: 649 RSKLVSINGSIVHRAGLMTGGA---SKG----GNNRWDK 680

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  140 bits (353), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 108/168 (64%), Gaps = 11/168 (6%)

Query: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1309
            +KK+R + F   F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
            +     + QFIVISL+N MFE +  LVGVY R  +  S+ I  +D+ N
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVY-RQQQENSSKIVTLDLRN 1220

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 183/391 (46%), Gaps = 59/391 (15%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 219 HK------SEAFP----SLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSS 268
           ++      SE  P         S  V   Y +D      ++ E      + R    N  +
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMD-----GKVVE------LMRTININGDT 115

Query: 269 KYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 328
            Y I+ K  SY +    L+ E I +  K FL+ QG+VE IA        +S   L +  E
Sbjct: 116 TYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QSALDLSKLFE 168

Query: 329 DIIGTANYKPLIEERMGQIENLNEVCLEK-ENRFEI------------VDRE-KNSLESG 374
           +I G+  YK   +    ++E L +   E   NR  I             D E KN++E  
Sbjct: 169 EISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNNVEKK 228

Query: 375 KETALEF-LEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKF--QES 431
           K+  + F L K   L   R + F+ KL Q+ ++++   EKI++  K L   K  F  + S
Sbjct: 229 KKYEMYFTLWKLFHLDAQRIQ-FKDKLKQAKTEMSKLKEKINNEEKHLTRSKSAFLKENS 287

Query: 432 L--KKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEK 489
           +  KK  ++    KE +  IS C+S +  L          R S  +R  N+  ++E  ++
Sbjct: 288 ILTKKRSQLDYTVKEKEKVISQCNSIKIPL----------RAS-SKRIMNIEKRIESFKR 336

Query: 490 TLKSTKHSISEAENMLEELRGQQTEHETEIK 520
            ++  K  +S  EN L+ +   +   E EIK
Sbjct: 337 DIERQKDYVSTFENQLKVVTKAKELFEVEIK 367

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 111/172 (64%), Gaps = 10/172 (5%)

Query: 1248 KRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1298
            K  +++EQ   +K+ R + F   +N +S  + ++Y+ +T          GG+A L L D 
Sbjct: 1048 KEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDE 1107

Query: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
             +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1108 DEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1167

Query: 1359 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409
              NV  +A YIK   + N QFIVISL+N+MFE +Q LVGV+++     S  I
Sbjct: 1168 NTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 107/165 (64%), Gaps = 10/165 (6%)

Query: 1255 QLGILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEG 1305
            Q   +KKKR + F   F+ +S  ++ +Y+ +T          GGNA L L D  +PF  G
Sbjct: 1046 QFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAG 1105

Query: 1306 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1365
            + +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +
Sbjct: 1106 IKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERI 1165

Query: 1366 ANYIKERT-KNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409
            ANYI++ +  + QFIVISL+N+MFE +  LVG++++     S  +
Sbjct: 1166 ANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 86/159 (54%), Gaps = 11/159 (6%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 219 HKSEAFPSLQSCSVAVHFQYVID-ESSGTSRIDEEKPGLII--TRKAFKNNSSKYYINEK 275
           ++          + A   ++  D E S   +   EK G ++   R       S Y I+ K
Sbjct: 67  YR--------DIASADENEFGEDGERSAYVKAFYEKDGTVVELMRAITAGRDSVYKIDNK 118

Query: 276 ESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPK 314
            ++Y   +  L  E I +  + FL+ QG+VE IA   P+
Sbjct: 119 TTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  135 bits (340), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 109/169 (64%), Gaps = 13/169 (7%)

Query: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +KKKR + F   F  ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1370 KERTKNA--QFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416
             +R  N   QFIVISL+N+MFE ++ LVG+Y R  +  S+ I  +++ N
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIY-RHQKENSSRIITLNLTN 1218

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 84/163 (51%), Gaps = 27/163 (16%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 219 HKS------------EAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNN 266
           ++             +  P+  S  V   +Q             +E     + R    + 
Sbjct: 67  YRGFLSGDDEDNNNEDVNPN--SAYVKAFYQ-------------KEDVTHELMRSISNSG 111

Query: 267 SSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIA 309
            S Y IN K  SY + T  L++E I +  K FL+ QG+VE IA
Sbjct: 112 DSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  134 bits (338), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 112/180 (62%), Gaps = 14/180 (7%)

Query: 1248 KRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1298
            K  + KE+   +K KR + F A F  +   + ++Y+ +T          GGNA L + + 
Sbjct: 1062 KERKAKEKFLEVKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENE 1121

Query: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD
Sbjct: 1122 DEPYLGGIKYFATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALD 1181

Query: 1359 FRNVSIVANYIKERTK-NAQFIVISLRNNMFELAQQLVGVYK--RDN--RTKSTTIKNID 1413
              NV  +A+YIK     NAQFIVISL+N MFE +Q LVG+++   DN  R  S  ++N D
Sbjct: 1182 ITNVERIAHYIKRNANPNAQFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score = 92.0 bits (227), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 100/202 (49%), Gaps = 34/202 (16%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 219 HK----------------------SEAFPSLQSCSVA-VHFQYVIDESSGTSRIDEEKPG 255
           ++                      SEA P   + S       YV   S    + D ++P 
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYV---SCVYQKDDLDEPT 123

Query: 256 LIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKA 315
              TR    +  S Y IN++  SY +  + L++E I +  K FL+ QG+VE IA   P++
Sbjct: 124 KF-TRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPES 182

Query: 316 EKESDDGLLEYLEDIIGTANYK 337
                  L   LE + G+ NYK
Sbjct: 183 -------LTLLLEQVSGSINYK 197

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  134 bits (336), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 109/163 (66%), Gaps = 12/163 (7%)

Query: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1309
            +KKKR + F + F+ ++  ++ +Y+ +T          GG A L L D  +PF+ GV + 
Sbjct: 1063 IKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYH 1122

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1123 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYI 1182

Query: 1370 -KERTKNAQFIVISLRNNMFELAQQLVGVYKR--DNRTKSTTI 1409
             K   K+ QFI+ISL+N MFE +  LVGV+++  +N +K+ T+
Sbjct: 1183 RKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/336 (26%), Positives = 154/336 (45%), Gaps = 58/336 (17%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 219 HK----SEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
           H+    S++     + +    F  V D S  T           + R    +  + Y IN 
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITE----------LMRIVNLSGETIYKING 116

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
           K +S+   +  L  E I +  K FL+ QG+VE IA        +S   L +  E + G+ 
Sbjct: 117 KTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGSI 169

Query: 335 NYKP---LIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLL 391
            YK    L++E + +I  L    ++   R   ++ E    + G +   ++ E+   +  L
Sbjct: 170 QYKKEYDLLKEDLNKINRLTNDAIKNRRR---INGELKIYKEGIKKNNQYNEQINNIIQL 226

Query: 392 RSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKV----DEIKAQRKEIKD 447
           +      +L                    L +EK  F+++LKK+    DE+    KE + 
Sbjct: 227 KKFFVLLQLYH------------------LSNEKSTFEKNLKKILVDFDELNDTNKEFQS 268

Query: 448 RISSCSS---KEKTLVLERRELEGTRVSLEERTKNL 480
            +S+      KE  L++++  L      ++++ KNL
Sbjct: 269 NLSNLKKIFIKEDLLIIKQNSL------IDQKLKNL 298

 Score = 65.9 bits (159), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 111/228 (48%), Gaps = 29/228 (12%)

Query: 687 GFHGRLGDLG-VIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     D + +AI T   +  + V+VD++  AQ CI YL+K + G   FI L
Sbjct: 522 GVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPL 581

Query: 745 DRLRQFNLQPISTP---ENVPRL---FDLVKPKN-----PKFSNAFYSVLRDTLVAQNLK 793
           D +     Q  S P   +N P+     + +   N     P+F  A   +  ++++  NL 
Sbjct: 582 DTIEA---QIPSLPTIIQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLD 638

Query: 794 QANNVAYGK--KRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEV 851
            A ++ + +  K  + VT+DG +I  S  M+GG    +K  M+   N+ DK D+Y+    
Sbjct: 639 IAKDLKWNQNVKNVKFVTLDGSIIHKSNLMTGGA---SKNSMQ-SNNRWDK-DEYSSLMT 693

Query: 852 DK----IERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895
            K    +E E   +EN  ++AS    E+E E+  L     +L++Q+++
Sbjct: 694 LKDNLILEIETISKEN--KLASINSRELETEISLLNSEITNLKTQLTQ 739

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  131 bits (329), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 102/161 (63%), Gaps = 10/161 (6%)

Query: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +K+KR + F+A FN +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409
            +   +   QFIVISL++N+F  ++ + GV++  +   S  I
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 108/176 (61%), Gaps = 14/176 (7%)

Query: 1248 KRDE--VKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELV 1296
            K+DE  V  Q   +K+KR   F   F  ++  +  +Y+ +T          GG+A L L 
Sbjct: 1040 KKDEKKVLAQFIKIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLE 1099

Query: 1297 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAA
Sbjct: 1100 DEDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAA 1159

Query: 1357 LDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGVYKRD--NRTKSTTI 1409
            LD  NV  VA YI+     + QFIVISL+N MFE +  LVGVY++   N +K  T+
Sbjct: 1160 LDTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 133/272 (48%), Gaps = 17/272 (6%)

Query: 687 GFHGRLGDLGVID-DSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     + + +A+ST   R  D ++VD +  AQ CI YL+K + G A FI L
Sbjct: 525 GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 745 DRLR-QFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK 803
           D +  + +  P S         + ++  +P++  A   V  D+++   L+ A ++ + + 
Sbjct: 585 DTIEVETSTLPASESSGCILAINAIEY-DPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 804 -RFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEV--DKIERELSE 860
            R ++VT++G LI  +G M+G       G+ K  +N+ DK ++Y       DKI  ++ E
Sbjct: 644 VRSKLVTLEGTLIHRAGLMTG-------GISKDSSNRWDK-EEYQSLMTLKDKILVQIEE 695

Query: 861 RENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMA 920
             ++ R  S    E+E  +  +      + +QIS+ +   +   +++   +  +K+    
Sbjct: 696 VGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIEYHQNLIKQEYDP 755

Query: 921 YVKAVSDKAQLNVVMKNLERLRGEYNDLQSET 952
            ++ +  K  L ++  + ++L  E + LQ++T
Sbjct: 756 KIQELEQK--LAIINDSRKQLEEEKDSLQTQT 785

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 115/201 (57%), Gaps = 32/201 (15%)

Query: 1245 AVQKRDEVKEQLGI---------------------LKKKRFDEFMAGFNIISMTLKEMYQ 1283
            AV++ DE KEQ  +                     +K+KR   F++ F  ++  +  +Y+
Sbjct: 1016 AVERFDEAKEQFSVAIDESEKLKEIERESKEKYLKIKEKRVKTFLSCFQHVTDHIDRIYR 1075

Query: 1284 MIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLA 1334
             +T          GG+A L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LA
Sbjct: 1076 ELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPPMKRFKDMDYLSGGEKTMAALA 1135

Query: 1335 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQ 1393
            L+FA++ Y+P+P +++DE+DAALD  NV  +A YIK   +   QFIVISL++N+F  +Q 
Sbjct: 1136 LLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIKRHASPKFQFIVISLKSNLFGKSQS 1195

Query: 1394 LVGVYKRDNRTKSTTIKNIDI 1414
            + GV+ R+ +  S+ +   D+
Sbjct: 1196 MAGVF-RNQQANSSMVITTDL 1215

 Score = 89.4 bits (220), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 92/186 (49%), Gaps = 22/186 (11%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 219 HKS-------EAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYY 271
           ++        E   S +S  V     Y+ D++       E+   +   R       S Y 
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAF--YLKDDNG------EQGTKIEFMRIIQNTGDSVYR 118

Query: 272 INEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 331
           I+ K  S+    + L+ E I +  + FL+ QG+VE IA        +S   L +  E + 
Sbjct: 119 IDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVS 171

Query: 332 GTANYK 337
           G+  Y+
Sbjct: 172 GSVQYQ 177

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 103/163 (63%), Gaps = 12/163 (7%)

Query: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +KKKR   F   F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1370 -KERTKNAQFIVISLRNNMFELAQQLVGVYK--RDNRTKSTTI 1409
             +   ++ QFIVISL+N MFE +  LVGVY+  ++N +K  T+
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  129 bits (323), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 103/333 (30%), Positives = 165/333 (49%), Gaps = 59/333 (17%)

Query: 1134 MDSVKEDVKNNQELDQEYR----SCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIP 1189
             DS ++D    +++  EY     S E+ D +EIKD  T  D    M+I +        +P
Sbjct: 893  FDSKQKDASATEDIISEYNNRLASIES-DRNEIKDDITRLD-LEKMSILKNCQVSGIIVP 950

Query: 1190 RLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKR 1249
             +SE  L EL    ++ +  E++  +E   +D   L    +  A     K DLNN ++  
Sbjct: 951  VVSEVGLEELPASKVDDEAIEIAKKIE---IDFSKLPRKYKE-ATSAAVKQDLNNQIRDI 1006

Query: 1250 DEVKEQL-------------------------GILKKKR--FDEFMA-----------GF 1271
            D+V E+L                         G+  ++R  FDEF+             F
Sbjct: 1007 DDVLEELQPNARAVERFDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAF 1066

Query: 1272 NIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1322
              I+  L  +Y  +T          GG+A + + D  +PF+ G+ +   PP K ++++  
Sbjct: 1067 EKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEY 1126

Query: 1323 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVI 1381
            LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVI
Sbjct: 1127 LSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVI 1186

Query: 1382 SLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDI 1414
            SL+N MFE +  LVGV+ R  +  S+ I  +D+
Sbjct: 1187 SLKNTMFEKSDALVGVF-RQQQENSSKIVTLDL 1218

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 105/213 (49%), Gaps = 38/213 (17%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   V    ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 219 HKS----EAFPSL--------QSCSVAVHFQY---VIDESSGTSRIDEEKPGLIITRKAF 263
           ++     E  P+         ++  V   ++Y   V++     SR+ +            
Sbjct: 67  YRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLISRLGD------------ 114

Query: 264 KNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGL 323
               + Y ++    +Y E ++ L+++ I +  K FL+ QG+VE IA   P        GL
Sbjct: 115 ----TSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GL 163

Query: 324 LEYLEDIIGTANYKPLIEERMGQIENLNEVCLE 356
            + +E++ G+  YK   EE   Q + + +   E
Sbjct: 164 TKLIEEVSGSMQYKKEYEELKDQYDKICQASTE 196

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  104 bits (260), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 103/369 (27%), Positives = 176/369 (47%), Gaps = 39/369 (10%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I EL+++ FKSYA + V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F  +  + S      E  P L +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFSNLDPKCSPIGF--ENSPKLSVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEERMGQIENL---NEVCLEKENRF---EIVDREKNSLESGKETALEFLEKEKQL 388
               + E+R G+ E      E+ L KENR    E ++ +   L + K   LEF E +  L
Sbjct: 172 ---KMFEDRKGKAERTMGKKELKL-KENRTLLQEEIEPQLEKLRNEKRIFLEFQEIQTDL 227

Query: 389 TLLRSKLFQFK---LLQSNSKLASTLEKISSSNKDLE-------DEKMKFQESLKKVDEI 438
             ++  +  ++   L+   S +  TL+   S   +L        +E M   E L +++  
Sbjct: 228 EKIQRIVLAYEYHSLVGKQSSIKETLDTGESRMAELHGLISKTGEEVMHLTEDLNRINYE 287

Query: 439 KAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSI 498
           K +  +   ++     +E TL+     L   R S +   +N+     +  K L+STK +I
Sbjct: 288 KQKELDSDGKLGKLEKQESTLM---NNLSRLRASFDICVENI----NETAKNLESTKANI 340

Query: 499 SEAENMLEE 507
              +  LEE
Sbjct: 341 KTNKGKLEE 349

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  104 bits (260), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 99/346 (28%), Positives = 170/346 (49%), Gaps = 39/346 (11%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV V F      +S     +  K  + +TR+     SSKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDNSDKSNSPIGFTNSAK--ISVTRQVMLGGSSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKPK        +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEERMGQIENL---NEVCLEKENR---FEIVDREKNSLESGKETALEFLEKEKQL 388
               + E+R  + E      E  LE ENR    E ++ +   L S KE  ++F E + +L
Sbjct: 172 ---KMFEDRKDKAERTMAKKEAKLE-ENRALLVEEIEPKLGKLRSEKEIFIKFQETQSEL 227

Query: 389 TLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDR 448
                 ++ F      +K +S  + ++SSN              K+ +++K       D 
Sbjct: 228 EKTERVVYAFDYHNMINKSSSLKQHLNSSN--------------KRSEQLKELISRTSDE 273

Query: 449 ISSCSSK-EKTLVLERREL--EGTRVSLEERTKNLVSKMEKAEKTL 491
           ISS +   E+T   +++E+  +GT  +LEER   L++++ + +  L
Sbjct: 274 ISSLNEDLEETKRNKQKEIDEQGTLANLEEREGQLLNEISRIQTQL 319

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1303 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1363 SIVANYIKERTKNAQFIVISLRNNMF 1388
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 139/301 (46%), Gaps = 36/301 (11%)

Query: 685 INGFHGRLGDLGVIDDSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
           + G   +L  L   +D++D A +    A  RL +VVVD    A   ++  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 742 ILLDRL--RQFNLQPI-----STPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQ 794
           I L+R+  R  N Q +     + P  V    +LV  +  + S A   +  ++L+ ++ + 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYE-EEVSRAMEFIFGNSLICKDAET 637

Query: 795 ANNVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDK 853
           A  + +  + R R +T+ G + D  GT+SGG  +    L+         +D    ++ +K
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLL---------ID---VQKYNK 685

Query: 854 IERELSERENNFRVASDTVHEMEEELKKLRDHEPDL-----ESQISKAEMEADSLASELT 908
             + + E E   +  +  + E E +L+K R    DL     +  +++  +E++  A  + 
Sbjct: 686 TAKRIEELELKLKSITRDLEEQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQAAHIIR 745

Query: 909 LAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKGLQDEIMK 968
             E+ +KE + +  +  S ++ ++   K ++R++    D+Q  +  K  K+K L+DE+ K
Sbjct: 746 KNEELIKEIDESQKEIASKRSSISDCEKEIQRIQ---TDIQEFSTDKGSKLKQLKDEVSK 802

Query: 969 I 969
           +
Sbjct: 803 L 803

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 97/362 (26%), Positives = 182/362 (50%), Gaps = 37/362 (10%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV V F     ++S     +   P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDNSDRDNSPIGFTN--SPKISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSK 394
               + E+R  + E       +KE + +     +  L    E  LE L  EK++ L    
Sbjct: 172 ---KMFEDRREKAE---RTMAKKETKLQ---ENRALLAEEIEPKLEKLRSEKRIFL---- 218

Query: 395 LFQFKLLQSNSKLASTLEKISSSN-KDLEDEKMKFQESLK----KVDEIKAQRKEIKDRI 449
              F+  Q++  L  T   +S+ N  +++  +  F+++L+    K + +K + +++ + I
Sbjct: 219 --DFQTTQTD--LERTSRVVSAFNYYNMKHRQSSFEQTLQDSEDKCNHLKEEIEKVSEEI 274

Query: 450 SSCSSKEKTLVLERR---ELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLE 506
            S +   + L L+++   + EG  V+ E+   +L+ ++ + + TL     SI EAE  L+
Sbjct: 275 KSLNEDLEELKLQKKNEMDNEGRLVNFEKEESDLLKQISRIKTTLSIKNDSIDEAEKELQ 334

Query: 507 EL 508
           +L
Sbjct: 335 KL 336

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 65/156 (41%), Gaps = 15/156 (9%)

Query: 690 GRLGDLGVIDDS-FDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD 745
           G    L  +D   FD AI+    A  RL +++VD    A   ++  R  K      I L 
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 746 RL--RQFNLQPIS-----TPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNV 798
           ++  R  N   ++      P  V    +L+   + + S A   +  + LV ++   A  V
Sbjct: 583 KIATRTLNKNTLALAKELAPGKVELALNLI-GYDDEVSKAMEFIFGNGLVCKDADTAKKV 641

Query: 799 AYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLM 833
            +    R R +T  G + D  GT+SGG  +  + L+
Sbjct: 642 TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL 677

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
           (REAL)
          Length = 1228

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 106/382 (27%), Positives = 182/382 (47%), Gaps = 34/382 (8%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 219 HKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDE--EKPGLII--TRKAFKNNSSKYYINE 274
           ++                  V   +  ++ +    +K   ++   R   +N  + Y I+E
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
           K  SY + +  L+NE I +  K FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 335 NYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEF---LEKEKQLTLL 391
            YK   +E   +IE L++   E       +  E  + + G     E+   +EK+ +L   
Sbjct: 180 QYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKKSELQKF 239

Query: 392 RSKLFQF------------KLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIK 439
           ++ L+Q             KL  SNS+++S  EKI+   K L+  K  F   +K+   I 
Sbjct: 240 QA-LWQLYHLEQQKEELTDKLSASNSEISSLKEKINHEMKSLQRSKSSF---VKESAVIS 295

Query: 440 AQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSIS 499
            Q+ ++   I     KEK LV + R ++  + +  +R  ++  ++E  ++ L+  K  + 
Sbjct: 296 KQKSKLNYII---KDKEK-LVSDLRLIKVPQQAAGKRVLHIEKRIESLQRDLQRQKAYVE 351

Query: 500 EAENMLEELRGQQTEHETEIKD 521
             E  L+ +   +   E EIK+
Sbjct: 352 RFETQLKVVTKSKKTFEEEIKE 373

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 76/142 (53%), Gaps = 5/142 (3%)

Query: 687 GFHGRLGDLG-VIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     + + +A+ST   +  D V+V+ +  AQ CI +L+K + G A FI L
Sbjct: 531 GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 590

Query: 745 DRLRQFNLQPISTPENVPRLFDL-VKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK 803
           D + +  L  +S P++   +  +      P++  A   V  D+++  +LK A  + + K 
Sbjct: 591 DTI-ETELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNKG 649

Query: 804 -RFRVVTVDGKLIDISGTMSGG 824
            R ++VT++G LI  +G M+GG
Sbjct: 650 VRAKLVTIEGALIHKAGLMTGG 671

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 100/372 (26%), Positives = 175/372 (47%), Gaps = 36/372 (9%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F    D+S+      E  P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNS-DKSNAPIGF-ESSPTISVTRQVALGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 335 NY---KPLIEERMGQIENLNEVCLEKENRF---EIVDREKNSLESGKETALEFLEKEKQL 388
            +   +   E  MG+ E        +ENR    E ++ +   L S K   LEF E +K L
Sbjct: 173 MFEDRREKAERTMGKKE-----AKLQENRTLLNEEIEPKLEKLRSEKRIFLEFQETQKDL 227

Query: 389 TLLRSKLFQFK---LLQSNSKLASTLEKISSSNKDLE---------DEKMKFQESLKKVD 436
                 +  F    L+Q  + +  TL+  +S N+ +E         DE     E L+++ 
Sbjct: 228 EETHRVVSAFDYNYLVQKQTSVVETLQ--TSENRIIELKELITKVTDELGSLNEDLEQIQ 285

Query: 437 EIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKH 496
             K    +   +++   S E  L+ E   L+ +    E+   + +SK++   K L++ K 
Sbjct: 286 VQKKNELDKNGKLAKLESNESKLMNEISRLKTSYKISEDNLSDTLSKLKSKGKNLEANKQ 345

Query: 497 SISEAENMLEEL 508
            +S    M E++
Sbjct: 346 ELSNKSKMFEKI 357

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 69/158 (43%), Gaps = 12/158 (7%)

Query: 685 INGFHGRLGDLGVIDDSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFIL 743
           + G   RL  L   + S   A+   A  RL +VVVD  + A   +   R  K      I 
Sbjct: 523 VKGVAARLFHLNENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTIIP 580

Query: 744 LDRL-------RQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQAN 796
           L+++       +  N+    +P NV    +L+  +    + A   +   +L+ ++ + A 
Sbjct: 581 LNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAETAK 639

Query: 797 NVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLM 833
            V +  + R R +T+ G + D  GT+SGG  ++   L+
Sbjct: 640 KVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLL 677

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 110/411 (26%), Positives = 204/411 (49%), Gaps = 56/411 (13%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F     + S T     E P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNT--DKSNTPIGFSEYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  I  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSK 394
               + E+R  + E   +   +KE + +     +  L+   +  LE L  EK+L L    
Sbjct: 172 ---KMFEDRKEKAERTMQ---KKETKLQ---ENRTLLKEEIDPQLEKLRNEKRLFL---- 218

Query: 395 LFQFKLLQSNSK------LASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDR 448
             +F+ +Q++ +      +A+  +K+ +S   +   K   + S  K+DE++ +   +   
Sbjct: 219 --EFQTIQADLETTEKVVIATDYQKMLNSRDSI---KTVLETSNSKMDELQKKIDLVNRE 273

Query: 449 ISSCSSK-EKTLVLERRELEG-TRV-SLEERTKNLVSKMEKAEKTLKSTKHSISEAENML 505
           IS+ +   ++T+  +++ELE  T + ++E +   L+S++ K +  LK    +I       
Sbjct: 274 ISNLNEDLQQTMKQKKKELENDTNIKAMESKEDKLLSEIAKLKANLKINGDNI------- 326

Query: 506 EELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKD---KTKNISAEIIR 553
             L G+Q +     K LT  +EK + +LD     L+D   K++N  A++ R
Sbjct: 327 --LDGKQKQ-----KRLTVKIEKSKQLLDSKSQLLEDSKSKSRNCEADLTR 370

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 174/373 (46%), Gaps = 41/373 (10%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRI--DEEKPGLIITRKAFKNNSSKYYI 272
            DLI+K       Q+  +      V D S  +S     E  P + +TR+     +SKY I
Sbjct: 63  QDLIYKRG-----QAGVIKASVTIVFDNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V  L ++  +++++  FLI+QG++  +  MKP       D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 333 TANY---KPLIEERMGQIEN-LNEVCLEKENRFEIVDREKNSLESGKETALEFLEK---- 384
           T  +   +   E+ M + E  L E+   +    E ++ + N L + K   LEF +     
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEI---RALLLEEIEPKLNRLRNEKRAFLEFQQTQTDL 227

Query: 385 EKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLE-------DEKMKFQESLKKVDE 437
           EK   ++ +  +Q  L+Q  S +   L+      KDLE       DE     E  + +  
Sbjct: 228 EKTSRIVNTYDYQ-TLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEISTLTEDFESIRR 286

Query: 438 IKAQRKEIKDRISSCSSKEKTLVLERRELEG----TRVSLEERTKNLVS---KMEKAEKT 490
            K ++ +    + +  +KE +L  E   +      TR  L +  +NL +    + K+E+ 
Sbjct: 287 QKEKQLQKDTTLQTLEAKENSLSTELSRVTAALGITRDDLADEQRNLSALNLSIAKSEQE 346

Query: 491 LKSTKHSISEAEN 503
           L S   + SE EN
Sbjct: 347 LTSLSKTYSETEN 359

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 87/188 (46%), Gaps = 17/188 (9%)

Query: 700 DSFDVAISTACPRLDDVVVDTVECAQHCIDY--LRK-------NKLGYARFILLDRLRQF 750
           DS +     A  RL +V+VD  + A   ++   LRK       NK+  AR I  D L   
Sbjct: 539 DSANALQVCAGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDAL--- 594

Query: 751 NLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVT 809
           N      P  V    +L+  +  + + A   +   +L+ ++   A  V +  + R R +T
Sbjct: 595 NKAKSLAPGAVELALNLIGYE-AEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSIT 653

Query: 810 VDGKLIDISGTMSGGG-NHVAKGLMKL-GTNQSDKVDDYTPEEVDKIERELSERENNFRV 867
           +DG + D  GT+SGG  +H +  L+ +   N++ K      +E+ +++  +SE EN  R+
Sbjct: 654 LDGDIYDPEGTLSGGSRSHTSSLLIDIQKYNEAAKQMMVLEKELYQVQANISEHENASRM 713

Query: 868 ASDTVHEM 875
                +E+
Sbjct: 714 TKSLQNEL 721

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
           YFL008W
          Length = 1226

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 107/203 (52%), Gaps = 17/203 (8%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 219 HKSEAFP-----SLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273
           ++    P              H  YV   S+  S+  +E   + + R   KN  S Y I+
Sbjct: 67  YRG-VVPEEEDDGEGEGDGDAHRAYV---SAFYSKGPQEST-VELKRTISKNGDSTYQID 121

Query: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            ++ +Y + ++ L+++ I +  K FL+ QG+VE +A   P         L +  E++ G+
Sbjct: 122 RRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSGS 174

Query: 334 ANYKPLIEERMGQIENLNEVCLE 356
           A YK   +    Q+E L+    E
Sbjct: 175 AQYKKEYDLLKDQLEQLSHSATE 197

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 97/221 (43%), Gaps = 27/221 (12%)

Query: 687 GFHGRLGDLG-VIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     D + V+++T   +  D V+VD++  AQ CI YL+K + G   FI L
Sbjct: 528 GVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPL 587

Query: 745 D-------RLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANN 797
           D        L   N+Q     +N             ++  A   V  D ++   L  A  
Sbjct: 588 DTVDSAVATLPSVNIQGYLLAKNAMEY-------ESQYERAINYVCGDAIICDTLDLAKK 640

Query: 798 VAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEV--DKI 854
           + +    + +++ +DG LI  +G M+G       G+ K G N+ DK ++Y       DKI
Sbjct: 641 LKWDHGFKNKLIALDGSLIHRAGLMTG-------GISKDGNNRWDK-EEYQSLMTLKDKI 692

Query: 855 ERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895
            +++ +     R AS    E+E  +  L      + +Q+++
Sbjct: 693 LQQIEDTAAYGRSASIQARELESNISLLNAEIASIRTQLTQ 733

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 152/304 (50%), Gaps = 31/304 (10%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F    D+SS      E  P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNT-DKSSSPIGF-ESYPKISVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTR 172

Query: 335 NY---KPLIEERMGQIEN-LNEV--CLEKENRFEIVDREKNSLESGKETALEFLEK---- 384
            +   +   E+ M + E  L E+   LE+E     ++ +   L + K   LEF E     
Sbjct: 173 MFEDRREKAEKTMAKKETKLQEIRTLLEEE-----IEPKLEKLRNQKRAFLEFQETQTDL 227

Query: 385 EKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDE----IKA 440
           EK L +L +  + + +   NS +  TL+  ++  ++L +   K +  +  +DE    IK 
Sbjct: 228 EKTLRILNAYEY-YDMATKNSTIKETLQNSTARVEELNNFIQKTKNEISNLDEDLKTIKI 286

Query: 441 QRKE 444
           Q++E
Sbjct: 287 QKQE 290

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 97/229 (42%), Gaps = 44/229 (19%)

Query: 700 DSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RQFN--- 751
           ++FD A +    A  RL +VVVD    A   ++  R  K      I L+++  R  N   
Sbjct: 536 ENFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENA 593

Query: 752 --LQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVV 808
             L     P NV    +L+  ++ + S A   +   +L+ ++ + A  V +  + R R +
Sbjct: 594 LKLAKSVAPGNVELALNLIGYED-EVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSI 652

Query: 809 TVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVA 868
           T+DG + D  GT+SGG  +    L+         +D  T                 F  A
Sbjct: 653 TLDGDIYDPEGTLSGGSRNTKNSLL---------IDIQT-----------------FNAA 686

Query: 869 SDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEA 917
           S  ++EME ELK++     + E    K +    SL +EL LA  ++  A
Sbjct: 687 SKRLNEMELELKQINSKIAEYEQTSQKTK----SLQNELNLATHKLSLA 731

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit
           of the multiprotein cohesin complex, essential protein
           involved in chromosome segregation and in double-strand
           DNA break repair; SMC chromosomal ATPase family member,
           binds DNA with a preference for DNA with secondary
           structure
          Length = 1225

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 87/169 (51%), Gaps = 27/169 (15%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 219 HK--------------SEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFK 264
           ++                A  + QS  V   +Q       G   ++       + R   +
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQ------KGNKLVE-------LMRIISR 113

Query: 265 NNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP 313
           N  + Y I+ K  SY + +  L+NE I +  K FL+ QG+VE IA   P
Sbjct: 114 NGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPEN 760
           + +A+ST   +  D V+V+ +  AQ CI +L+K + G A FI LD + +  L  +S P++
Sbjct: 544 YGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDS 602

Query: 761 VPRLFDL-VKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVTVDGKLIDIS 818
              +  +      P++  A   V  D+++   L  A ++ + K  R ++VT++G LI  +
Sbjct: 603 QDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKA 662

Query: 819 GTMSGG 824
           G M+GG
Sbjct: 663 GLMTGG 668

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 96/182 (52%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F    D+ + +    E  P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 15/181 (8%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESS-GTSRIDEEK-PGLIITRKAFKNNSSKYYI 272
            DLI+K       Q+  +      V D S   +S I  E+ P + +TR+     +SKY I
Sbjct: 63  QDLIYKRG-----QAGVIKASVTIVFDNSDIKSSPIGFERYPKISVTRQIALGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 T 333
           T
Sbjct: 171 T 171

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409
            +QFIV+SL+  MF  A ++     +D  +  + I
Sbjct: 1137 SQFIVVSLKEGMFNNANRVFKTRFQDGTSAVSVI 1170

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 136/327 (41%), Gaps = 65/327 (19%)

Query: 685 INGFHGRLGDLGVIDDSFDVAIS---TACPRLDDVVVDTVECAQHCID--YLRKNKLGYA 739
           + G   ++  LG   D+FD A +    A  RL +++VD  + A   ++   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----V 576

Query: 740 RFILLDRL-------RQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNL 792
             I L+++           L     P  V    +L+  +    S A   +   +L+  + 
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSKAMQYIFGGSLICADA 635

Query: 793 KQANNVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEV 851
           + A  + +  + R R +T+DG + D  GT+SGG ++    L+K        +  Y     
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLK-------DIQKYN---- 684

Query: 852 DKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAE 911
                E S R  +F        E E  L + +  E +  SQ++K      SL +EL LAE
Sbjct: 685 -----EASRRSKSF--------ESELSLIQQQIMECERASQLTK------SLQNELDLAE 725

Query: 912 QQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKGLQDEIMKI-- 969
            + + ++    KA+       ++ KN E L  E    +++   +K     LQ E+++I  
Sbjct: 726 HKFQLSQ----KALVSNPAAQIIKKNDEML-NEIETCKTDIDLQKISTAELQAEVVRIQK 780

Query: 970 --------GGIKLQMQNSKVESVCQKL 988
                    G KL+  N +V ++ +++
Sbjct: 781 DMQEFNTDKGSKLKQLNKEVSTLAKQI 807

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 96/183 (52%), Gaps = 13/183 (7%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRID-EEKPGLIITRKAFKNNSSKYYIN 273
            DLI+K      +   SV + F    +     S I  E  P + +TR+     +SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFA---NSDKNNSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 334 ANY 336
             +
Sbjct: 172 KMF 174

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409
            +QFIV+SL+  MF  A ++     +D  +  ++I
Sbjct: 1137 SQFIVVSLKEGMFTNANRVFRTRFQDGTSVVSSI 1170

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 23/205 (11%)

Query: 709 ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD-----RLRQ--FNLQPISTPENV 761
           A  RL +VVV+    A   ++  R  K      I L+     RL Q   N      P++V
Sbjct: 548 AGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSV 605

Query: 762 PRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVTVDGKLIDISGT 820
               +L+  ++ + + A   +   +L+ ++ + A  V +  K R R +T+ G + D  GT
Sbjct: 606 ELALNLIGYED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGT 664

Query: 821 MSGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELK 880
           +SGG  +          N S  +D    ++ +   R LSE E      +  + +  E L+
Sbjct: 665 LSGGSRN---------NNSSILID---IQKYNAYSRNLSESEAKLADVTKRIKQYSEVLQ 712

Query: 881 KLRDHEPDLESQISKAEMEADSLAS 905
           K ++ + +L     K  +   +LA+
Sbjct: 713 KTKNLQNELNLATHKFHLAERNLAN 737

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 95/182 (52%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F      +S     +   P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFTN--SPQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 74/169 (43%), Gaps = 29/169 (17%)

Query: 684 RINGFHGRLGDLGVIDDS---FDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYA 739
           + N  +G +G L  +DD    +  A+ T A  RL +VVV   + A   ++  R       
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGR------- 571

Query: 740 RFILLDRLRQFNLQPISTPENVPRLFDLVKPKNP----------KF----SNAFYSVLRD 785
              L  R+    L  IST    P++ +L K   P          KF    + A   +  +
Sbjct: 572 ---LRKRVTIIPLNKISTRPISPQVLELAKKIAPGKVELAINLIKFDKSVTKAMEFIFGN 628

Query: 786 TLVAQNLKQANNVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLM 833
           +L+ ++ + A  + +  K R R +T+ G + D  GT+SGG  + +  L+
Sbjct: 629 SLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLL 677

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 96/182 (52%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F      +S     +   P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFTNS--PQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 96/182 (52%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F      +S     +  K  + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGITKASVTIVFDNTDKTNSPIGFNNSAK--ISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKPK        +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 101/396 (25%), Positives = 187/396 (47%), Gaps = 41/396 (10%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F      +S     D  K  + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNSDKSNSPIGFNDSLK--ISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  M+P         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEERMGQIENL---NEVCLEKENR---FEIVDREKNSLESGKETALEFLEKEKQL 388
               + E+R  + E      E  LE ENR    E ++ + N L   K   LEF   +  L
Sbjct: 172 ---KMFEDRREKAERTMSKKETKLE-ENRTLLAEEIEPKLNKLRGEKRIFLEFQVTQTDL 227

Query: 389 TLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLE----------DEKMKFQESLKKVDEI 438
             +   +  F     +++  S  +K+SS+ + +E          DE +  +E L   ++I
Sbjct: 228 EKISRVVTAFDYHNMSTRRDSARDKVSSNERRMEELKTLISKTTDEIISLKEDL---EQI 284

Query: 439 KAQRKEIKDR---ISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTK 495
           K Q+K+  D+   +     +E   + +   +  T+    +  +    K++K + TL+S  
Sbjct: 285 KTQKKDELDKNGVLPKLEKQEGDFLNQISRINATKQICSQNLEENKKKIQKLQNTLESLS 344

Query: 496 HSISEAENMLEELRGQQTEHETEIKDLTQLLEKERS 531
             + E    L+  R  +T ++ +   L QL E+ +S
Sbjct: 345 RELQEK---LDRYREIETAYKQDESTLNQLKEEHKS 377

 Score = 91.7 bits (226), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 172/706 (24%), Positives = 293/706 (41%), Gaps = 128/706 (18%)

Query: 708  TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQ-------FNLQPISTPEN 760
             A  RL +VVVD    A   ++  R  K   A  I L+++          N+     P  
Sbjct: 547  CAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLNKIAARTLNDNIVNMAKSVAPGR 604

Query: 761  VPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVTVDGKLIDISG 819
            V    +L+  +  +   A   +   +LV ++ + A  V +  K R R +T+DG + D  G
Sbjct: 605  VELALNLIGYE-EEVRRAMEFIFGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYDPEG 663

Query: 820  TMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEEL 879
            T+SGG  +    L+                 +D       +R NN     + V E+E   
Sbjct: 664  TLSGGSRNNTSSLL-----------------ID------IQRYNN---NCNLVKELE--- 694

Query: 880  KKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLE 939
             KL D    +  Q   +  +  +L  EL LA+ ++K +E    + +       ++ KN E
Sbjct: 695  TKLNDIAKKIAIQFEISN-KTKNLQKELELAQHKLKLSE----RNLQSNTAAQLIRKN-E 748

Query: 940  RLRGEYNDLQSETKTKKEKIKGLQDEIMKI----------GGIKLQMQNSKVESVCQKLD 989
             L  E    + E K K  +IK L+ +I KI           G KL     +VES+  ++ 
Sbjct: 749  ELESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDADEFSHDKGSKLDELRREVESMSVQIS 808

Query: 990  IXXXXXXXXXXXXXXXXXXXXXFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDT 1049
                                  FQ  ++    D++ S D L+  E  +K  +  ++E+D 
Sbjct: 809  -------EEEQRCETQYDAYQNFQLEIEQLGGDIDSSKDTLEQAELTVKKLQTEVSEHDM 861

Query: 1050 NMNETLNXXXXXXXXXXXXXXXXXDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQ 1109
            N+ + LN                 ++EE  N    I+ E+K ++E L    T IK+    
Sbjct: 862  NLRD-LNQALQDKQV---------ELEEERNRLMGIDDELK-EIEALIKSKTDIKNNA-- 908

Query: 1110 QEKGLNELSIRDVTHTLGMLDDNKMDSVKEDVKNN--QELDQ-EYRSCETQDESEI-KDA 1165
                  EL I+ + H L     NK+ S     ++   Q LD+ E+ S E+Q    I + A
Sbjct: 909  ------ELDIQKINHEL-----NKLRSTSNSFESELAQLLDEHEWLSDESQVAYIIEQHA 957

Query: 1166 ETSCDNYH--PMNIDETSDEVSRGI-PRLSEDELRELDVELIESKINELSYYVEETNVDI 1222
              +   Y      + E  D++ R + P +         +E +E K + L   +     D 
Sbjct: 958  SINLAEYRERGAQLQERFDDMKRKVNPNIMSM------IESVEKKESALKTMIRTIEKDK 1011

Query: 1223 GVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMY 1282
              ++E   +L E+KR  L     ++  ++V E  G              N+ +  L   +
Sbjct: 1012 VKIQETITKLNEYKRETL-----IKTWEKVTEDFG--------------NVFADLLPNSF 1052

Query: 1283 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1342
                    A+L   +  D  +EG+   V        ++  LSGG+++L +L+L+ AL ++
Sbjct: 1053 --------AKLVPCEGKD-ITEGLEVKVKLGSIWKESLIELSGGQRSLIALSLIMALLQF 1103

Query: 1343 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1388
            +P P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+  MF
Sbjct: 1104 RPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 36.2 bits (82), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 108/220 (49%), Gaps = 36/220 (16%)

Query: 350 LNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLAS 409
           LN++  +   +FEI ++ KN            L+KE +L   + KL + + LQSN     
Sbjct: 697 LNDIAKKIAIQFEISNKTKN------------LQKELELAQHKLKLSE-RNLQSN----- 738

Query: 410 TLEKISSSNKDLEDEKMKFQESLK-KVDEIKAQRKEI----KDRISSCSSKEKTLVLERR 464
           T  ++   N++LE E  + +E +K K  +IK  +K+I    KD       K   L   RR
Sbjct: 739 TAAQLIRKNEELESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDADEFSHDKGSKLDELRR 798

Query: 465 ELEGTRVSLEER----------TKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTE 514
           E+E   V + E            +N   ++E+    + S+K ++ +AE  +++L+ + +E
Sbjct: 799 EVESMSVQISEEEQRCETQYDAYQNFQLEIEQLGGDIDSSKDTLEQAELTVKKLQTEVSE 858

Query: 515 HETEIKDLTQLLEKERSILDDIK---LSLKDKTKNISAEI 551
           H+  ++DL Q L+ ++  L++ +   + + D+ K I A I
Sbjct: 859 HDMNLRDLNQALQDKQVELEEERNRLMGIDDELKEIEALI 898

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 96/182 (52%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F      +S     +   P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNNTDKLNSPIGFTNS--PQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 23/181 (12%)

Query: 681 KSGRINGFHGRLGDLGVIDDSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYA 739
           K+  ++G  G+L  L   +  +  A+ T A  RL +VVV   + A   ++  R  K    
Sbjct: 519 KANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RV 576

Query: 740 RFILLDRLRQFNLQP-------ISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNL 792
             I LD++    + P          P  V    +L+K  +   + A   +  ++L+ ++ 
Sbjct: 577 TIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIKF-DKTVTKAMEFIFGNSLICEDP 635

Query: 793 KQANNVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLM-----------KLGTNQS 840
           + A  + +  K R R +T+ G + D  GT+SGG  + +  L+           K+GT Q+
Sbjct: 636 ETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLLVDIQKYNQIQKKIGTLQA 695

Query: 841 D 841
           D
Sbjct: 696 D 696

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 106/207 (51%), Gaps = 26/207 (12%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 219 HK---------SEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
           ++         S+   S+ + S A    YV       +  ++E   + + R   +N  + 
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTA----YV------KAFYEKENKTIELMRTISRNGDTN 116

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y I  K  SY + +  L++E I +  K FL+ QG+VE IA   P         L    E+
Sbjct: 117 YKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLFEE 169

Query: 330 IIGTANYKPLIEERMGQIENLNEVCLE 356
           + G+  YK   ++   ++E L++   E
Sbjct: 170 VSGSIQYKKEYDQLKEKMEQLSKAATE 196

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 700 DSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL-RQFNLQPIST 757
           D + +A+ST   R  D V+VD    AQ CI YL+K + G A FI L+ +  +     +S 
Sbjct: 540 DKYSLAVSTCLGRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETIDSEIPTLSVSN 599

Query: 758 PENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVTVDGKLID 816
            +      + ++  +P++  A   V  DT++   L  A  + + +  + ++VT++G LI 
Sbjct: 600 SQGCILAINAIEY-DPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALIH 658

Query: 817 ISGTMSGG 824
            +G M+GG
Sbjct: 659 KAGLMTGG 666

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 97/184 (52%), Gaps = 15/184 (8%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGT-SRIDEEKPGLI-ITRKAFKNNSSKYYI 272
            DLI+K      +   SV +    V D S  T S I       I +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTI----VFDNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L ++  +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 14/136 (10%)

Query: 700 DSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RQFNLQP 754
           D FD A +    A  RL +VVVD  + A   ++  R  K      I L+++  R  N + 
Sbjct: 536 DHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNART 593

Query: 755 IS-----TPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVV 808
           +       P  V    +L+   + + S A   +   +LV Q+   A  V +  + R R +
Sbjct: 594 LQMAKDIAPGKVELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSI 652

Query: 809 TVDGKLIDISGTMSGG 824
           T+DG + D  GT+SGG
Sbjct: 653 TLDGDVYDPEGTLSGG 668

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 116/442 (26%), Positives = 199/442 (45%), Gaps = 84/442 (19%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 219 HKS----------------EAFPS-LQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRK 261
           ++                  A  S   S  V   +Q       G   ++       +TR 
Sbjct: 103 YRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQ------KGNKLVE-------LTRL 149

Query: 262 AFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDD 321
             +N  + Y I+ K  +Y + +  L+NE I +  K FL+ QG+VE IA   P        
Sbjct: 150 ISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT------- 202

Query: 322 GLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEF 381
            L    E++ G+  YK   +E   +IE L++   E       +  E  + + G     E+
Sbjct: 203 DLSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEY 262

Query: 382 ---LEKEKQLTLLRS--KLFQF---------KLLQSNSKLASTLEKISSSNKDLEDEKMK 427
              ++K+ +L   ++  KL+           KL  SNS++ S  E+I++  K L+  K  
Sbjct: 263 RKQVDKKNELQKFQALWKLYHLEQKKEELTDKLSASNSEIMSLKERINNETKSLQRSKSS 322

Query: 428 FQESLKKVDEIKAQRKEIKDRISSCSSKEKT-----LVLERRELEGTRVS-LEERTKNLV 481
           F   +K+   I  Q+ ++ D I     KEK      L+   ++  G R+S +E+R  +L 
Sbjct: 323 F---VKESTVISKQKSKL-DYI--VKDKEKLMSDLRLIKVPQQAAGRRISHIEKRIGSLQ 376

Query: 482 SKMEKAE--------------KTLKSTKHSISEAENMLE-------ELRGQQTEHETEIK 520
             +E+ E              K+ K+ +  I E+    +       +L+   + HE  + 
Sbjct: 377 RDLERQESYVERFETQLKVITKSKKTFEEEIKESARNYDKFKLNESDLKTYDSLHEKYLT 436

Query: 521 DLTQLLEKERSILDDIKLSLKD 542
               +LE++ S+ ++ K  + D
Sbjct: 437 QGGSILEEKISLSNNDKQEIVD 458

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPEN 760
           + +A+ST   R  D V+V+ +  AQ CI +L+K + G A FI LD + +  L  +S P++
Sbjct: 583 YGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDS 641

Query: 761 VPRLFDL-VKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-RFRVVTVDGKLIDIS 818
              +  +      P++  A   V  D+++   L  A ++ + K  R ++VT++G LI  +
Sbjct: 642 QDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGVRAKLVTIEGALIHKA 701

Query: 819 GTMSGG 824
           G M+GG
Sbjct: 702 GLMTGG 707

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 95/179 (53%), Gaps = 11/179 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F    D+S+     +   P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNT-DKSNSPIGFNTS-PRISVTRQIVIGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
             +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGT 171

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 72/163 (44%), Gaps = 21/163 (12%)

Query: 686 NGFHGRLGDLGVIDDSFDVAISTA-----CP--RLDDVVVDTVECAQHCIDYLRKNKLGY 738
           N   G    L  I+D+   AI +A     C   RL +VVVD    A   ++  R  K   
Sbjct: 525 NSVKGVAATLFTINDN---AIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--R 579

Query: 739 ARFILLDRL--RQFNLQPIS-----TPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQN 791
              I L+++  R+ N   ++      P  V    +L+   + + S A   +   +L+ ++
Sbjct: 580 VTIIPLNKIASRRLNENTVNFAKQLAPGKVDLALNLIGYSD-ELSRAMEFIFGTSLICKD 638

Query: 792 LKQANNVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLM 833
            + A  V + +  R R +T++G + D  GT+SGG  +    L+
Sbjct: 639 SETAKKVTFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLL 681

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 95/182 (52%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            DLI+K      +   SV + F    D+S       E    + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNS-DKSKAPIGF-ETSLTISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1315 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1373
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1374 KNAQFIVISLRNNMFELAQQL 1394
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 87/196 (44%), Gaps = 20/196 (10%)

Query: 685 INGFHGRLGDLGVIDDSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
           + G   RL    +   ++D A +    A  RL +VVVD    A   ++  R  K      
Sbjct: 523 VKGVAARL--FTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRK--RVTI 578

Query: 742 ILLDRL-------RQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQ 794
           I L+++          N      P  V    +L+  ++ + + A   +   +L+  + + 
Sbjct: 579 IPLNKISARTIDNNTLNYAKQLAPGKVELALNLIGYED-EVAKALQFIFGSSLICNDAET 637

Query: 795 ANNVAYGKK-RFRVVTVDGKLIDISGTMSGGGNHVAKGLM---KLGTNQSDKVDDYTPEE 850
           A  + +  K R R +T+DG + D  GT+SGG       ++   +     ++K+++Y   E
Sbjct: 638 AKKITFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQKYNESTEKINNY-QNE 696

Query: 851 VDKIERELSERENNFR 866
           +  I ++LSE+E+ ++
Sbjct: 697 LKSIRKKLSEQEDIYK 712

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/336 (26%), Positives = 165/336 (49%), Gaps = 51/336 (15%)

Query: 1106 EITQQEKGLNELSIRD--VTHTLGMLDDNKMDSVKEDVKNNQEL----DQEYRSCETQDE 1159
            E++Q    L +L+ R+  +  +L  + DN + S+ E+ +NNQ++    + + R+   + +
Sbjct: 866  ELSQISTELEKLASREHELQTSLQGISDN-IASLNEEKENNQQILEKANSQQRALLKKLD 924

Query: 1160 SEIKDAETSCDNYHPMNIDETSDEVSRGIPR---LSEDEL---RELDVELIESKINELSY 1213
               KDAE S        +    DEV + I     LSE+ L   + LD E +  ++NE++ 
Sbjct: 925  GYQKDAEKSV--IRKTTLVSRRDEVQQKISEIGLLSEESLDRHQNLDSEEVLRRLNEVND 982

Query: 1214 YVEET-NVDIGVLEEYARRLAEFKRRKLDLNNAVQK----RDEVKEQLGILKKKRFDEFM 1268
             + +T NV+   +E + +    F  ++ +L N  ++    ++ ++E +  LKK++ +   
Sbjct: 983  KISKTSNVNRRAIENFRK----FNEKREELENRAEELARSKESIEELVDSLKKQKIEAVE 1038

Query: 1269 AGFNIISMTLKEMYQMITMGGNAELELV-------------------------DSLDPFS 1303
            A F+ ++     +++ +   G  +L +                          DS++   
Sbjct: 1039 ATFSKVANNFTHIFEKLVPAGVGKLVIHRNESTRNASGGRGPQQGSGASGNEDDSIETMY 1098

Query: 1304 EGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361
             GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD + 
Sbjct: 1099 SGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQY 1158

Query: 1362 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
             + VAN IKE + +AQFI  + R++M ++A     V
Sbjct: 1159 RTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRV 1194

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 91/198 (45%), Gaps = 9/198 (4%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y     V      F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273
              LIH+     S+ S  V + F     +   TS I   +  ++  R+       +Y +N
Sbjct: 61  RQGLIHQGTG--SVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSVN 118

Query: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K    ++++++ ++ G    +   ++ QG +  +   K       D   L  LE+++G 
Sbjct: 119 GKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEEVVGA 171

Query: 334 ANYKPLIEERMGQIENLN 351
            +++  + E   ++E  N
Sbjct: 172 KSFEIKLRESAKKMEATN 189

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 117/280 (41%), Gaps = 64/280 (22%)

Query: 686 NGFHGRLGDLGVIDDSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           +  HG LG+L  +++ +   A +     L  VVVDT E A   ++ L   K G   FI L
Sbjct: 533 DSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPL 592

Query: 745 DRLRQFNLQPISTPEN-----VPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVA 799
           +R+   N  P++ P+N      P ++ +   K  +F  A   V   T+V +++   + +A
Sbjct: 593 NRIADSN--PVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGTGSKLA 648

Query: 800 YGKKRFRV--VTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERE 857
              K F +  VT+DG   D  G ++GG +   K       N+ D +     +E+   +R+
Sbjct: 649 ---KSFNLDAVTLDGDRTDKRGLITGGYHDYHK------RNRLDCL-----KEMSAAKRQ 694

Query: 858 LSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEA 917
           L E   N   A   +  ++ E+ ++ D   ++++Q S+ E                    
Sbjct: 695 LLEATKNLDAARGQITAIDTEIDQIND---EIKTQSSRKE-------------------- 731

Query: 918 EMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKE 957
                           ++ N+E +R + N   +E   KKE
Sbjct: 732 ---------------AILSNIENMRAKLNKKTAERALKKE 756

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 5/118 (4%)

Query: 1298 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1355
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1356 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNID 1413
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +    Y+     K +T+  +D
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF---YRVKYENKISTVIEVD 1210

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y  + ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F      +I  S    R ++E    +  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSGIPPRENDE----VFVRRTVGLKKDD 114

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  + ++V ++L++ G  + +   ++ QG +  +   K       D   L  LE+
Sbjct: 115 YQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEE 167

Query: 330 IIGTANY 336
           ++G  ++
Sbjct: 168 VVGAKSF 174

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 67/141 (47%), Gaps = 11/141 (7%)

Query: 690 GRLGDLGVIDDSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  ++D +   A       L  +VVDT E A   I  L + K G   F+ L+R+ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV- 595

Query: 749 QFNLQPISTPEN-VPRLFDLVKP--KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRF 805
            ++   I+ P N       L+K    + +F  A   V   T+V ++L     +A   KRF
Sbjct: 596 -YSDPNITYPPNEQASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRF 651

Query: 806 RV--VTVDGKLIDISGTMSGG 824
           R+  +T+DG   D  G ++GG
Sbjct: 652 RLNAITLDGDRADKKGALTGG 672

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1301 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKST 1407
             +  + VAN +KE +KNAQFI  + R +M ++A +   V K +N+  S 
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 118/257 (45%), Gaps = 50/257 (19%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y  + ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHK-SEAFPSLQSCSVAVHFQ------YVIDESSGTSRIDEEKPGLIITRKAFKNN 266
              LIH+ +    S+ SCSV + F        +   +S   R + E    +  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNE----VFIRRTVGLK 116

Query: 267 SSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 326
              Y IN++  + +++ ++L+  G  + +   ++ QG++  +   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 327 LEDIIGTANY-----------------KPLIEERMGQIEN-LNEVCLEK----------E 358
           LED++G  ++                 K  I++ + +++N LNE+  EK          +
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKIKETEFKKSTIDKELSELKNKLNEMEWEKLELEKFNKFDK 229

Query: 359 NR----FEIVDREKNSL 371
           NR    F + DRE N L
Sbjct: 230 NRKVLQFTLYDRELNDL 246

 Score = 39.3 bits (90), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 76/156 (48%), Gaps = 20/156 (12%)

Query: 716 VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTP--ENVPRLFDLVKP--K 771
           ++VDT E A   +  L + K G   FI L+++  +N   I+ P  +       L+K    
Sbjct: 570 IIVDTEETASLLMQELYRMKGGRVTFIPLNKI--YNDPNITYPPADQYSSFTPLIKKLKY 627

Query: 772 NPKFSNAFYSVLRDTLVAQNLKQANNVAYG---KKRFRV--VTVDGKLIDISGTMSGG-G 825
             KF  A   +   T+V ++L      +YG    K+F++  +T+DG   D  G ++GG  
Sbjct: 628 ESKFEGAMKHIFGKTIVVKDL------SYGLKLAKKFKLNAITLDGDRADKRGVLTGGYF 681

Query: 826 NHVAKGLMKLGTNQSDKVDDY--TPEEVDKIERELS 859
           ++  +  ++   N SD  D +  T  +++ ++REL+
Sbjct: 682 DYHKRTRLESLKNLSDARDSHAQTTADLETVKRELA 717

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 1296 VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1353
             D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1354 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     V
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV 1217

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 134/293 (45%), Gaps = 38/293 (12%)

Query: 143 RHQSSSKQQSR----LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSM 198
           R+QS +  ++R    ++I  ++++ FK+Y     V  F   F+ V+G NGSGKSN   ++
Sbjct: 10  RNQSRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAV 69

Query: 199 LFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLII 258
            FV     + ++++    LIH+     S+ S  V + F    D+   TS I   +  ++ 
Sbjct: 70  RFVLSDDYSSLKREERQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVR 127

Query: 259 TRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKE 318
            R+       +Y +N K    ++++++ ++ G    +   ++ QG +  +   K K    
Sbjct: 128 VRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-- 185

Query: 319 SDDGLLEYLEDIIGTANYKPLIEERMGQIENLNE-------VCLEKENRFEIVDREKNSL 371
                L  LED++G  +++  + E   ++E  N           E + R E +D E+  L
Sbjct: 186 -----LLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKARLEELDEERQEL 240

Query: 372 ESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDE 424
           E  +E     LE+++       ++FQF L          L +++S  + LEDE
Sbjct: 241 EKYQE-----LERDR-------RIFQFVLYDRE------LNEVTSQIESLEDE 275

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 1300 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1358 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1391
            D +  + VAN IKE + NAQFI  + R++M  +A
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVA 1191

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (45%), Gaps = 16/201 (7%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  + ++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSG---TSRIDEEKPGLIITRKAFKNNSSKY 270
              LIH+     S+ S  V +    V D S G    +      P  ++ R+       +Y
Sbjct: 61  RQGLIHQGSG--SVMSAYVEI----VFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 271 YINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N K  S  E+  LL++ G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 331 IGTANYKPLIEERMGQIENLN 351
            G  +++  + + + +++  N
Sbjct: 168 TGANSFEKKLRDSLNKMDATN 188

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 62/142 (43%), Gaps = 5/142 (3%)

Query: 686 NGFHGRLGDLGVIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           N  +G LG+L  +++ +     T     L  VVVDT + A   +  L   K G   F+ L
Sbjct: 532 NAVYGPLGELIKVNEKYKTCAETVGGNSLFHVVVDTEDTAGLLMQELYNVKGGRVTFMPL 591

Query: 745 DRLRQFN--LQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGK 802
           +RL   N    P +   N   L   +K  + KF  A   V   T+V ++L     +A   
Sbjct: 592 NRLHADNNVTYPSNEQSNCTALIKKIKY-DEKFERAVKHVFGKTIVVRDLTLGTKLARQY 650

Query: 803 KRFRVVTVDGKLIDISGTMSGG 824
           K    +T+DG   D  G ++GG
Sbjct: 651 K-LNAITLDGDRADKRGVLTGG 671

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 1294 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1351
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1352 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   V
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV 1197

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 69/144 (47%), Gaps = 9/144 (6%)

Query: 686 NGFHGRLGDLGVIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           +   G LG+L  +++ + +         L  +VVDT E A   +  L K K G   FI L
Sbjct: 535 DSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPL 594

Query: 745 DRLR-QFNLQ-PISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGK 802
           +R+    N+Q P +   +   L + +K  + +F  A   +   T+V ++L     ++   
Sbjct: 595 NRIYLDANIQYPPNDQTSFTPLINKIKY-DQRFDKAVRHIFGKTIVVKDLTTGLRIS--- 650

Query: 803 KRFRV--VTVDGKLIDISGTMSGG 824
           K+F++  +T+DG   D  G ++GG
Sbjct: 651 KKFKLNSITLDGDRADKRGVLTGG 674

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (58%), Gaps = 5/117 (4%)

Query: 1299 LDPFSEGVTFSV-MPPKKSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            L+    GV+ SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1357 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNID 1413
            LD +  + VAN IK+ +KNAQFI  + R +M  +A +    Y+     K +TI  I+
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF---YRVKYENKISTIIEIN 1208

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F      +I  S    R ++E    +  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILSSGVIPRPNDE----VFVRRTVGLKKDD 114

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y IN++  + +++ ++L++ G  +     ++ QG +  +   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 330 IIGTANY 336
           +IG  ++
Sbjct: 168 VIGAKSF 174

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 24/185 (12%)

Query: 1227 EYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMIT 1286
            E   R AE    K+ + N ++K          LK+++     + F  +S     +++ + 
Sbjct: 1007 ELNERAAELDDSKVSIQNLIEK----------LKQQKVTAVDSTFKKVSENFSTVFEKLV 1056

Query: 1287 MGGNAELEL------------VDSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSS 1332
              G A+L +             +S +    G++ SV     K    ++  LSGG+KT+ +
Sbjct: 1057 PRGTAKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCA 1116

Query: 1333 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ 1392
            +AL+ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A 
Sbjct: 1117 IALILAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVAD 1176

Query: 1393 QLVGV 1397
            +   V
Sbjct: 1177 KFFRV 1181

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 95/187 (50%), Gaps = 17/187 (9%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I+ +V++ FK+Y  + V+  F  +++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQ----YVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F+     +I  S    R ++E    I  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFRDPGHRMILPSGVVPRENDE----IFIRRTVGLKKDD 114

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  + ++V ++L++ G  + +   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLED 167

Query: 330 IIGTANY 336
           ++G  ++
Sbjct: 168 VVGAKSF 174

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 111/238 (46%), Gaps = 37/238 (15%)

Query: 1210 ELSYYVEETNVDIGVLEEYARRLAE----FKRRKLDLNNAVQKRDEVKEQLG----ILKK 1261
            EL   +   N DI  L+   ++  E    F  +KL+L +  ++ DE K  +      LK+
Sbjct: 972  ELLRKLNAVNEDISGLKNVNKKAFENFKKFHEKKLELEDRSKELDESKTSIQNLIVKLKQ 1031

Query: 1262 KRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDP-------------------- 1301
            ++     + F  +S    E+++ +   G A+L +  S D                     
Sbjct: 1032 QKVAAVDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDDDGT 1091

Query: 1302 ----FSEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1355
                   GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1092 QTESMYTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDA 1151

Query: 1356 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNID 1413
            ALD +  + VA  IK  + NAQFI  + R +M ++A +   V K +N  K +T+  +D
Sbjct: 1152 ALDKQYRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYEN--KISTVVEVD 1206

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 14/148 (9%)

Query: 683 GRINGFHGRLGDLGVIDDSFDV-AISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
           GR+    G LG+L  +++ + + A       L  +VVDT E A   I  L + + G   F
Sbjct: 533 GRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTF 589

Query: 742 ILLDRLRQFNLQPISTPENV-PRLFDLVKPKNPKFSNAFYSVLRD----TLVAQNLKQAN 796
           + L+R+  +N   I+ P N       L+K    KF   F SV+++    T+V ++L   +
Sbjct: 590 MPLNRI--YNDPNITYPPNAQSSCTPLIKK--IKFDAQFESVVKNVFGKTIVVRDLAAGS 645

Query: 797 NVAYGKKRFRVVTVDGKLIDISGTMSGG 824
            +A   K    +T+DG   D SG ++GG
Sbjct: 646 KIAKHYK-LDAITLDGDRADKSGLLTGG 672

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 1299 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1357 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            LD +  + VA  I++ + NAQFI  + R +M E+A     V
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV 1199

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 123/253 (48%), Gaps = 25/253 (9%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     ++ S SV + F      +I  S    R ++E    +  R+        
Sbjct: 61  RQGLIHQGSG-GAVMSASVEIVFHDPNHKIILPSGVVPRENDE----VYIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  +V ++L++ G  +++   ++ QG++  +   K K         L  LED
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLED 168

Query: 330 IIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESG-KETALEFLEKEKQL 388
           ++G  +++  ++  + +++       E E +   +D E N L S  KE   E  E EK  
Sbjct: 169 VVGAKSFELKLKASLKKMD-------ETEQKRNQIDMEMNELNSKLKEMNQERKELEKFN 221

Query: 389 TLLRS-KLFQFKL 400
           +L ++ K+FQF L
Sbjct: 222 SLDKNRKVFQFTL 234

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 136/312 (43%), Gaps = 27/312 (8%)

Query: 690 GRLGDLGVIDDSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  ++  +           L  V+VDT E A   +  L + K G   FI L+++ 
Sbjct: 538 GTLGELVSVNSKYKTCAEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKVY 597

Query: 749 QFNLQPISTPENVPRLFDLVKP--KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFR 806
            F+      PE+      L+K    + KF  A   V   T+V ++L     +A  K +  
Sbjct: 598 -FDNSITFPPEDQSSYTPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA-KKYKLS 655

Query: 807 VVTVDGKLIDISGTMSGG--GNHVAKGLMKLGT-NQSDKVDDYTPEEVDKIERELSEREN 863
            +T+DG   D  G ++GG    H    L  L + N S         E+D+I ++L E ++
Sbjct: 656 AITLDGDRADKRGVLTGGYHDQHKKTRLDSLKSLNSSRTKHKAVTAELDQITQQLEEMDS 715

Query: 864 NFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVK 923
                   +  +   ++KL  ++  + S I    ++ ++  SE  L E+ +   +   VK
Sbjct: 716 G-------IDALNGSMRKLVSNKDSIVSNIQSMRIKLNAKKSEKLLLEESL---DAFAVK 765

Query: 924 AVSDKAQLNVVMKNLERLRGEYNDLQSE-----TKTKKEKIKGLQDEIMKIGGIKLQMQN 978
           +    AQL    +  E++     D+  E     ++++K ++  L D+I  I   KL +  
Sbjct: 766 SERLTAQLT---QTKEKITAYKEDMTKEFDSELSQSEKTELLTLNDDIHTIQK-KLTLTT 821

Query: 979 SKVESVCQKLDI 990
             +ES+  ++DI
Sbjct: 822 EALESITGEMDI 833

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 2/100 (2%)

Query: 1300 DPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1358 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            D +  + VA  IKE +KNAQFI  + R +M ++A +   V
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV 1199

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 99/199 (49%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F      +I  S   SR D+E    +  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERMGQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 75/177 (42%), Gaps = 22/177 (12%)

Query: 667 QNKSKVLTALSRLQKSGRIN-------------GFHGRLGDLGVIDDSFDVAIST-ACPR 712
           QN+  V   +SR   +G IN                G LG+L  ++D +           
Sbjct: 502 QNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDKYKACAEVIGGNS 561

Query: 713 LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVP---RLFDLVK 769
           L  VVVDT E A   ++ L + K G   FI L+RL   +   +  P N     +   L+K
Sbjct: 562 LFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS--DVKFPSNTTTQIQFTPLIK 619

Query: 770 P--KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGG 824
                P+F  A   V   T+V ++L Q   +A  K +   +T+DG   D  G ++GG
Sbjct: 620 KIKYQPRFEKAVKHVFGRTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 82/152 (53%), Gaps = 5/152 (3%)

Query: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS-- 1316
            LK+++ +     FN +S    ++++ +   G  EL +      +S GV+  V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1317 WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1376
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1377 -QFIVISLRNNMFELAQQLVGVYKRDNRTKST 1407
             QFI+ + R++M E+A  ++ + K  N+  S 
Sbjct: 1074 TQFILTTFRSDMIEIA-DMIYMVKYHNKVSSV 1104

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 70/143 (48%), Gaps = 9/143 (6%)

Query: 687 GFHGRLGDLGVIDDSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD 745
             +G LG+L  + + +   +   A   L +++VDT E A   ++ L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 746 RLRQ-FNLQ-PISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK 803
           R+    N+  P +   N   L   +K  + KF     +V   T+V ++L+  N +    K
Sbjct: 520 RIENGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC---K 575

Query: 804 RFRV--VTVDGKLIDISGTMSGG 824
            F++  +T+DG  ID  G +SGG
Sbjct: 576 EFKLQAITLDGDRIDSKGVVSGG 598

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074c SMC3 required for structural maintenance of
           chromosomes
          Length = 1219

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 85/351 (24%), Positives = 161/351 (45%), Gaps = 81/351 (23%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y  + ++G F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVID----ESSGTSRIDEEKPGLIITRKAFKN 265
              LIH+  A  S+ S SV + F      +I      S+G+S  DE     +  R+    
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSS--DE-----VRIRRTVGL 112

Query: 266 NSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 325
               Y +N++  +  ++ ++L++ G  + +   ++ QG + ++   K K         L+
Sbjct: 113 KKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQ 165

Query: 326 YLEDIIGTANYKPLIEERMGQIE------------------NLNEV-----CLEKEN--- 359
            LE+++G  +++  ++  M Q++                   LNE+      LEK N   
Sbjct: 166 LLEEVVGAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLE 225

Query: 360 ------RFEIVDRE---------------KNSLESGKETALEFLEKEKQLTLLRSKLFQF 398
                 R+ + DRE                ++L S K+  LE    EK+  +++    + 
Sbjct: 226 RDRKVLRYTLHDRELQDIISQIESLDGDYNDTLGSSKKYILEL---EKRENMIKEVNEEI 282

Query: 399 KLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRI 449
           K LQ + KL +T+        DLE  K   +ESL++ + IK Q K+IK++I
Sbjct: 283 KNLQKSLKLKATV--------DLEQAKAILEESLERSEAIKLQLKDIKEKI 325

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 122/248 (49%), Gaps = 30/248 (12%)

Query: 1186 RGIPRLSEDEL---RELDVELIESKINELSYYVEET-NVDIGVLEEYAR---RLAEFKRR 1238
            R +  +SED L   + L  E +  K+NE +  +    N++    E Y +   + +E + R
Sbjct: 955  REVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRER 1014

Query: 1239 KLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELV-- 1296
              +L+++ Q    +++ +  LK+++ +     F+ +S     +++ I   G A L +   
Sbjct: 1015 ATELDDSKQS---IQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRI 1071

Query: 1297 ------DSLDPFS---------EGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFAL 1339
                  D+ + F+         EGV+ SV    K      +  LSGG+KT+ ++AL+ A+
Sbjct: 1072 NLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAI 1131

Query: 1340 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYK 1399
               +P P Y+ DEIDAALD +    VA  I + + NAQFI  + R++M + A +   V K
Sbjct: 1132 QMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-K 1190

Query: 1400 RDNRTKST 1407
             +N+  S 
Sbjct: 1191 YENKQSSV 1198

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 68/140 (48%), Gaps = 8/140 (5%)

Query: 690 GRLGDLGVIDDSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  +++ + V         L  VVVDT E A   ++ L + K G   F+ L++L+
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 749 QFNLQPISTPE--NVPRLFDLVKPK-NPKFSNAFYSVLRDTLVAQNLKQANNVAYGKK-R 804
             N Q I  P   N+P    + K K + +F      V    LV ++L   N ++  K+ +
Sbjct: 599 NGN-QNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYK 655

Query: 805 FRVVTVDGKLIDISGTMSGG 824
              +T+DG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 75.9 bits (185), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1305 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            + VA+ IK  + NAQFI  + R +M ++A +   V
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV 1186

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 68/145 (46%), Gaps = 19/145 (13%)

Query: 690 GRLGDLGVIDDSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  + + +   A       L ++VVDT E A   +D L + K G   F+ L+R+R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 749 ---QFNLQPISTPENVPRL----FDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYG 801
               F   P       P +    FD+      ++  A   V   T+V ++L + + +A  
Sbjct: 597 MDSNFTYPPNDQASCTPLIKKIKFDV------RYEKAVMHVFGKTIVVKDLGEGSKLA-- 648

Query: 802 KKRFRV--VTVDGKLIDISGTMSGG 824
            KRF++  +T+DG   D  G ++GG
Sbjct: 649 -KRFKMNAITLDGDRADKRGELTGG 672

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.5 bits (184), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1305 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            + VA  +KE +KNAQFI  + R +M ++A +   V
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 99/199 (49%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F      +I  S   SR D+E    +  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERMGQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 75/177 (42%), Gaps = 22/177 (12%)

Query: 667 QNKSKVLTALSRLQKSGRIN-------------GFHGRLGDLGVIDDSFDVAIST-ACPR 712
           QN+  V   +SR   +G IN                G LG+L  ++D +           
Sbjct: 502 QNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDKYKTCAEVIGGNS 561

Query: 713 LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVP---RLFDLVK 769
           L  +VVDT E A   ++ L + K G   FI L+RL   +   +  P N     +   L+K
Sbjct: 562 LFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS--DVKFPSNTTTQIQFTPLIK 619

Query: 770 P--KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGG 824
                P+F  A   V   T+V ++L Q   +A  K +   +T+DG   D  G ++GG
Sbjct: 620 KIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 1297 DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1354
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1355 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   V
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV 1195

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 96/195 (49%), Gaps = 12/195 (6%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y  K  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273
              LI++  +  S+ S  V + F    D  + T     +  G I  R+       +Y IN
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFH---DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K SS ++V +LL++ G    +   ++ QG + ++   K       D   L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVGA 168

Query: 334 ANYKPLIEERMGQIE 348
            +++  ++E + +++
Sbjct: 169 KSFERKLKESLQRMD 183

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 102/218 (46%), Gaps = 37/218 (16%)

Query: 1217 ETNVDIGVLEEYARRLAE----FKRRKLDLNNAVQKRDEVKEQLG----ILKKKRFDEFM 1268
            + N +I  L+   +R  E    F  ++ DL+    + DE K+ +      LK+++     
Sbjct: 983  DMNTEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVD 1042

Query: 1269 AGFNIISMTLKEMYQMITMGGNAELELV----DSLDPFSE-------------------- 1304
            + F  +S   K +++ +   G A+L +     DS+D  ++                    
Sbjct: 1043 STFQKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGET 1102

Query: 1305 ---GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359
               GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD 
Sbjct: 1103 VYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDK 1162

Query: 1360 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            +  + VA  IKE + NAQFI  + R +M ++A +   V
Sbjct: 1163 QYRTAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 99/199 (49%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F      +I  S   SR D+E    +  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERMGQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 76/177 (42%), Gaps = 22/177 (12%)

Query: 667 QNKSKVLTALSRLQKSGRIN-------------GFHGRLGDLGVIDDSFDVAIST-ACPR 712
           QN+  V   +SR   +G IN                G LG+L  ++D +           
Sbjct: 502 QNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDKYKACAEVIGGNS 561

Query: 713 LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR-----QFNLQPISTPENVPRLFDL 767
           L  +VVDT E A   ++ L + K G   FI L++L      +F     +  +  P L   
Sbjct: 562 LFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKLSLDADVKFPSNSTTQIQFTP-LIKK 620

Query: 768 VKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGG 824
           +K + P+F  A   V   T+V ++L Q   +A  K +   +T+DG   D  G ++GG
Sbjct: 621 IKYQ-PRFEKAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 1298 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1355
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1356 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +   V
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y  K  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273
              LI++        S  ++ + + V   +   + +  +  G+I  R+       +Y IN
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K +S ++V +LL++ G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 334 ANYKPLIEERMGQIE 348
            +++  ++E + ++E
Sbjct: 168 KSFERKLKESLQKME 182

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 90/192 (46%), Gaps = 15/192 (7%)

Query: 643 KEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQK-SGRIN----GFHGRLGDLGV 697
           +++Q VL +       A  +LS+  ++S + T L  + + + R+N       G LG+L  
Sbjct: 482 QKIQSVLESLVDDVKRAEGTLSETMDRS-LATGLKNVSEIAQRLNLPEGSVFGPLGELIK 540

Query: 698 IDDSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFN--LQP 754
           I + +   A       L  VVVDT   A   +  L  +K G   FI L+R+   +  + P
Sbjct: 541 ISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYP 600

Query: 755 ISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRV--VTVDG 812
            +   +   L   +K  +PKF  A   V   T+V ++L Q   +A   K+FR+  +T+DG
Sbjct: 601 SNDEHHCTPLIKKIKY-DPKFERAIKHVFGKTIVVKDLNQGTKLA---KQFRLNAITLDG 656

Query: 813 KLIDISGTMSGG 824
              D  G ++GG
Sbjct: 657 DKADSRGVLTGG 668

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 1305 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397
            + VA  IKE + +AQFI  + R +M ++A +   V
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV 1200

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 98/199 (49%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
              LIH+     S+ S SV + F      +I  S   SR D+E    +  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  + +   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERMGQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 75/177 (42%), Gaps = 22/177 (12%)

Query: 667 QNKSKVLTALSRLQKSGRIN-------------GFHGRLGDLGVIDDSFD-VAISTACPR 712
           QN+  V   +SR   +G IN                G LG+L  ++D +   A       
Sbjct: 502 QNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDKYKACAEVVGGNS 561

Query: 713 LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVP---RLFDLVK 769
           L  +VVDT E A   ++ L + K G   FI L+RL  F    +  P N     +   L+K
Sbjct: 562 LFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL--FLDSDVKFPSNTTTQIQFTPLIK 619

Query: 770 P--KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGG 824
                P+F  A   V   T+V + L Q   +A  K +   +T+DG   D  G ++GG
Sbjct: 620 KIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KKHKLNAITLDGDRADKRGLLTGG 675

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1320 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1379
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1380 VISLRNNMFELAQQLVGVYKRDNRTKSTT 1408
              + R +M  +A     V K +N+  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 91/195 (46%), Gaps = 12/195 (6%)

Query: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           + I  +++  FK+Y  + VV  F    + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273
               I++      + S  V + F    +      R D    G +  R+       +Y IN
Sbjct: 62  RKGFIYQGAG--QVMSAFVEIIFDDPENLMLAPLRND---TGEVRIRRTVGLKKDEYMIN 116

Query: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
           +K S+  +V ++L+N G    +   ++ QG + ++   K       D   L  LED++G 
Sbjct: 117 DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVVGA 169

Query: 334 ANYKPLIEERMGQIE 348
            +++  ++E + ++E
Sbjct: 170 KSFENKLKESLKKME 184

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 116/274 (42%), Gaps = 36/274 (13%)

Query: 690 GRLGDLGVIDDSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  + D + +         L +VVVD  E A   I  L   K G   FI L++L 
Sbjct: 534 GPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH 593

Query: 749 QFNLQPISTPENVPR--LFDLVKP--KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKR 804
                  + P N+ +     L+K    + KF      V   TLV ++L    ++A  + +
Sbjct: 594 VDT--NFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYK 650

Query: 805 FRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSDKVDDY--TPEEVDKIERELSERE 862
              +T+DG   D  G +SGG       L +  +N+ D + D+  +  E  KI+ EL    
Sbjct: 651 LNAITLDGDRADSKGVLSGG------YLDQYKSNRLDTLRDFKQSKREYKKIQVEL---- 700

Query: 863 NNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYV 922
                      E+++ L+ +      L + +  A  E D+  + +  A  Q+K A+++  
Sbjct: 701 ----------QEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLK-AKLSQK 749

Query: 923 KAVSD-----KAQLNVVMKNLERLRGEYNDLQSE 951
             + D     KA+LN +   LE+ R   N   ++
Sbjct: 750 ITIDDSIKALKARLNKIDTELEQCRERTNAFAAD 783

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 55/75 (73%), Gaps = 1/75 (1%)

Query: 1315 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1373
            K W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1374 KNAQFIVISLRNNMF 1388
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 99/392 (25%), Positives = 170/392 (43%), Gaps = 43/392 (10%)

Query: 156 INELVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I ++ L+NF +YA    +  FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 213 RLSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNS-SKYY 271
           R+ D I   E       C + +  +    +  G + +      + ITR   ++   S Y+
Sbjct: 104 RVEDFIKNGE-----DECEIEITLKNN-SKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 272 INEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 331
           IN++ +S   V  ++    I LD+    + Q  VE  A++K      SD  L E +   I
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK------SDKLLFETIRS-I 210

Query: 332 GTANYKPLIEERMGQIENL---NEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQL 388
            T     L E +  Q E L    EV   K+ R + +  EK  LE+      EF  K+ QL
Sbjct: 211 DTDLITVLEELKELQGEELAEEKEVSF-KQQRLQELTAEKERLETSVRVLEEFQRKKDQL 269

Query: 389 TLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEI--- 445
             +  KL  +       K+    EKI +S K  ED K   +  L+        ++++   
Sbjct: 270 E-IHKKLLPY------VKIKDHKEKIRASKKCYEDAKRNLKALLQDKKPFSHAKRQLERA 322

Query: 446 -KDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENM 504
            +D + S ++KE+     + + +   VSLE+    +  +++K    +   +   ++ +  
Sbjct: 323 TEDALESKNNKEREYRENQVKFKSIPVSLEK----IREEIQKNSAQINYYRGRSAKLKQG 378

Query: 505 LEELRGQQTEHETEIKDLTQLLEKERSILDDI 536
           +EEL  Q    E + +DL  L E E+   D I
Sbjct: 379 IEELESQL---ENQREDLNGLKEPEQGEFDSI 407

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 111/444 (25%), Positives = 188/444 (42%), Gaps = 62/444 (13%)

Query: 139 KIYDRHQSSSKQQSRLFINELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDS 197
           + YD+ Q  S       I ++ L+NF +Y   +  + P   S + ++GPNGSGKS  + +
Sbjct: 28  RTYDQFQPGS-------IVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCA 77

Query: 198 MLFVFGFRANKM-RQDRLSDLIHKSEAFPS----LQSCSVAVHFQYVIDESSGTSRIDEE 252
           +      +   + R  R+ D I   E        L++       Q  ++     +  D  
Sbjct: 78  VCLGLAGKPEFIGRAKRVDDFIKNGEDTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLL 137

Query: 253 KPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
           K   +I R   K  S  Y+IN+K  +   +  L+K   I LD+    + Q  VE  A++K
Sbjct: 138 KVTRLIQRDGNKCKSD-YFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLK 196

Query: 313 P-----KAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDRE 367
                 +  +  D  LL+ L+D+  + N +  +E         NEV + K+ RF  ++ +
Sbjct: 197 SDKLLVETVRSIDAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETD 246

Query: 368 KNSLESGKETALEFLEKEKQLTLLRSKLFQF----------KLLQSNSKLA-STLEKISS 416
           +N LE+   +  EF E  K+   +  KL  +          + L+ + +LA   L  +  
Sbjct: 247 RNKLEASVRSLKEF-ETMKEDIEIHKKLLPYVKVKDHKENLQRLKGDYELAKQNLRALLK 305

Query: 417 SNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEER 476
             K   D K+  +    KVDE    ++          SKE+ L L R +L      L+  
Sbjct: 306 DKKPFVDTKLDME---TKVDEFAENKR----------SKEEELKLTRNKLMNVFNDLKVV 352

Query: 477 TKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTE-HETEIKDLTQL--LEKERSIL 533
            +N++ K  +       TK    E     E L   QT+  +  + D T L  +EK+RS L
Sbjct: 353 RENIIKKQTQTAYYKTRTKKLHEEMAKTKETLEANQTKLTQIALPDATLLEEIEKKRSAL 412

Query: 534 DDIKLSLKDKTKNIS--AEIIRHE 555
            D   ++++K  +I   A  I HE
Sbjct: 413 LDEDSNVRNKMGDIDNKANSINHE 436

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1381 IS 1382
            I+
Sbjct: 1050 IT 1051

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 20/158 (12%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + SD  
Sbjct: 60  LRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRSDSF 117

Query: 219 HKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNN--SSKYYINEKE 276
            K+ A     S  + V   ++  E  GT+        L ++R   +N+  +S YY++  E
Sbjct: 118 IKNGA----DSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVDGVE 162

Query: 277 SSYTEVTKLLKNE-GIDLDHKRFLILQGEVENIAQMKP 313
           +S   V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 163 TSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 84/185 (45%), Gaps = 46/185 (24%)

Query: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRR------KLDLNNAVQK--RDEV 1252
            VE +ES+I  +++  +E++  I +L+E  R+LA+ K R      KLD   A     + E+
Sbjct: 886  VERLESEIRMINH--DESS--IAILQEVERKLADVKARLPAMVRKLDAATASMSTMQAEL 941

Query: 1253 KEQLGILKKKRFDEFMAGF------NIISMTLKEMYQ------MITMGGNAELELVDSLD 1300
            + +L  + +K  + F   F        I ++   +YQ      M+    NA L+ +DS  
Sbjct: 942  EPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS-- 999

Query: 1301 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1360
                                   SGGE+ +S++  + AL ++   P  V+DEI+  +D R
Sbjct: 1000 --------------------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQR 1039

Query: 1361 NVSIV 1365
            N  IV
Sbjct: 1040 NERIV 1044

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 175/373 (46%), Gaps = 44/373 (11%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNS-SKYYI 272
           + D I   E   S++   + +     ++   G   +D E   + ITR+  K+ S S+Y I
Sbjct: 93  VEDFIKNGEDRGSIE---ITLKNSPKVE---GMPGVDSEADTIKITRELIKSKSKSRYMI 146

Query: 273 NEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK-----PKAEKESDDGLLEYL 327
           N++  S  +V  L+    I LD+    + Q  VE  A++K      +  +  D  LL+ L
Sbjct: 147 NDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVL 206

Query: 328 EDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQ 387
           E          L + +  +I +  E+ L K+   E++ +++   ES K  A + LE +K 
Sbjct: 207 E---------LLKDLQAKEISSQRELDLNKQKYDELLVQKEKLSESVK--AFKELESKKS 255

Query: 388 LTLLRSKLFQF-KLLQSNSKLAST---LEKISSSNKDLEDEKMKF---QESLKKVDEIKA 440
              L  +L  + KL     KLA     L++  ++ K L  +K  F   +++L++  EI +
Sbjct: 256 ELELHLQLLPYAKLKDHKEKLADYKRDLDQAKANLKSLRKDKKPFSNAKQNLEERLEILS 315

Query: 441 QRKEIKDRISSCSSKEKTLVLER--RELEGTRVSLEERTKNL---VSKMEKAEKTLKSTK 495
            ++++KD+      KE      R  +ELE  R  +E++ + +    ++ +K E+T   T+
Sbjct: 316 NKRDLKDK----QLKEDQASYRRVEQELESIREEIEKKEQQIEYYRNRTKKLEETAAKTR 371

Query: 496 HSISEAENMLEEL 508
             +     +LE +
Sbjct: 372 EELENKYKLLETI 384

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1379 IVIS 1382
             +I+
Sbjct: 1039 FLIT 1042

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 84/204 (41%), Gaps = 23/204 (11%)

Query: 1189 PRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQK 1248
            P L ED+      + I+ ++  +S  +     ++GV +E A  L E  R K +      K
Sbjct: 881  PHLPEDQ------DGIKREVERVSNMILRAERNVGVSKESASELLETSRAKYEAGYGTYK 934

Query: 1249 RDEVKEQLGILKKK---RFDEFMAGFNIISMT----LKEMYQMITMGGNAELELVDSLDP 1301
              E+   L IL      R     A      +      +   ++    GN    +     P
Sbjct: 935  --EIDGALKILTHSIDVRVQNLQAAQKSTCLDADLDFRSSLKVRGFSGNLAFSI-----P 987

Query: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361
              + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N
Sbjct: 988  AKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVN 1047

Query: 1362 VSIVANYIKERTKN---AQFIVIS 1382
              +    I E+ KN    Q I+I+
Sbjct: 1048 RKMGTRLILEKLKNNSRTQTIIIT 1071

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 96/428 (22%), Positives = 181/428 (42%), Gaps = 58/428 (13%)

Query: 156 INELVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I +L LENF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 213 RLSDLIHKSEAF----------PSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKA 262
           R+   I   E            P      VAV          GT+++         +R  
Sbjct: 125 RVDSFIKNGENRGLIEVTLKRDPGRTGSFVAV---------DGTTKV---------SRVL 166

Query: 263 FKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDG 322
           +    S+YY+N++  S   V  L+    I LD+    + Q  VE  A++K      SD  
Sbjct: 167 WVGKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKL 220

Query: 323 LLEYLEDII-----GTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKET 377
           L+E +  +         N K L EE   QI    E+ L K ++   ++  ++ L S  + 
Sbjct: 221 LMETVRSVNVNLLESFKNLKTLQEE---QITEAKELEL-KTSKLRDLNETRDKLVSSVQ- 275

Query: 378 ALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD----LEDEKMKFQESLK 433
           ALE  +++KQ   +  KL  +  ++ + +  +  +K     +D    L  +K   +++ +
Sbjct: 276 ALEAFKRKKQELDINEKLLPYVKIKDHKRKCAQYKKKYQEARDQLKALITDKEPMRQAQQ 335

Query: 434 KVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKS 493
            +D   A++++IK   S   +K + L  E +     +  LEE+ +    K++  E+    
Sbjct: 336 AIDAEAAEKQDIK---SGLETKFQHLQSEFKVYPKKQQELEEKVREKQGKIKYYEQRTFK 392

Query: 494 TKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIR 553
            K +IS  +  L   R + T       +L   ++ ER  +    L L+ + ++++     
Sbjct: 393 VKEAISGIKEQLSNERNKLTTLPAPDNNLFDEIDTERKRVSIQNLELEQEVRDLNTRSYN 452

Query: 554 HEKELEPW 561
             + ++ W
Sbjct: 453 LGRNIQNW 460

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1381 IS 1382
            ++
Sbjct: 1072 VT 1073

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 76/164 (46%), Gaps = 22/164 (13%)

Query: 156 INELVLENFKSYAGKQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I  L LENF +YA    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 213 RLSDLIHKSEAFPSLQSC---SVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNN-SS 268
           ++ D I   E    ++           +YV   S GT+++         TR   +N  +S
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVA--SDGTTKV---------TRVLHRNRKAS 151

Query: 269 KYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
           +Y++N +  + + V +L+    I LD+    + Q  VE  A++K
Sbjct: 152 EYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1381 IS 1382
            ++
Sbjct: 1049 VT 1050

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 88/211 (41%), Gaps = 46/211 (21%)

Query: 1204 IESKINELSY-------------YVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRD 1250
            IES IN LS               +++TN DI +LE+    L    R KL  N   Q   
Sbjct: 893  IESIINRLSSELSMINNDTSVIDILKKTNEDISILEKTLPHL----RAKLASN--AQTIL 946

Query: 1251 EVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1310
            E++  L    + R D+ +     IS     ++  +   G  EL+  DS + +        
Sbjct: 947  EIRNSL----EPRLDDIVKQ---ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------C 992

Query: 1311 MPPKKSWRNITNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            +  K  +R+ + L        SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N 
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNE 1052

Query: 1363 SIVA-----NYIKERTKNAQFIVISLRNNMF 1388
             IV      N   E T     I   L  N+F
Sbjct: 1053 RIVHRIMVENACAENTSQYFLITPKLLTNLF 1083

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 115/255 (45%), Gaps = 32/255 (12%)

Query: 159 LVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 215
           L L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++ 
Sbjct: 63  LKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVE 118

Query: 216 DLIHKS--EAFP--SLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRK-AFKNNSSKY 270
           + I     E     +L++ S  +H        S  + I+ +   + + R  + +   SKY
Sbjct: 119 EYIKNGTDEGVIEITLKNSSALLH--------SDFNMINTDDDVVHVKRVLSMEKKKSKY 170

Query: 271 YINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
           YIN K  +   V  +++   I LD+    + Q  VE  A++KP       D LL      
Sbjct: 171 YINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP-------DTLLNETIRS 223

Query: 331 IGTANYKPLIEERMGQIENLNEVCLE---KENRFEIVDREKNSLESGKETALEFLEKEKQ 387
           I     + L E +  Q E  NE+ ++   KEN+ + +   + +LES +  ALE  E++ +
Sbjct: 224 IEAGLLEKLSELKSLQAEG-NELQIDLGAKENKLKELTSSRAALES-QAHALELYEEKAR 281

Query: 388 LTLLRSKLFQFKLLQ 402
              +  KL  +  L+
Sbjct: 282 ELDIHQKLLNYTYLK 296

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1308 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1367
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1368 YIKERTKN---AQFIVIS 1382
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 155 FINELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 212
           +I ++VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 213 RLSDLI 218
            L DLI
Sbjct: 131 SLKDLI 136

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 111/270 (41%), Gaps = 59/270 (21%)

Query: 141 YDRHQSSSKQQSRLFINELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSML 199
           YD+ Q +S       I ++ LENF +Y   +  + P   S + ++GPNGSGKS  + +  
Sbjct: 44  YDKFQPAS-------IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAAC 93

Query: 200 FVFGFRANKM-RQDRLSDLIHKSEAFPSLQSCSVAVHFQYV------------------- 239
                +   + R  R+ D I   E         + +  + V                   
Sbjct: 94  LGLAGKPEYIGRSKRVDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNN 148

Query: 240 ---IDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHK 296
              +D   G  ++D  K   II R   K   S YYIN+K  S   V  L+K   I LD+ 
Sbjct: 149 GAQVDLKCG--QLDLIKFTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNL 203

Query: 297 RFLILQGEVENIAQMKP-----KAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLN 351
              + Q  VE  A++K      +  +  D  LL+ LE++    N +  +E+ +       
Sbjct: 204 CQFLSQERVEEFARLKSDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDEL------- 256

Query: 352 EVCLEKENRFEIVDREKNSLESGKETALEF 381
           E+   K+ R+  +  E+  LE+  ++  EF
Sbjct: 257 EI---KQKRYTELCNERTKLEASVQSLKEF 283

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1381 IS 1382
            I+
Sbjct: 1074 IT 1075

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 83/189 (43%), Gaps = 39/189 (20%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I +L L+N  +Y+  +  + P   S + +VGPNGSGKS  + ++      +   + R  +
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLI------ITRKAFKN-N 266
           + + I   E                       T++ID    G +      ITR   +N  
Sbjct: 94  IDNFIKNGE----------------------NTAQIDTFLRGHMPNEVIKITRIMTRNKK 131

Query: 267 SSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDD 321
            S+YYI++  S+ T V KL     I LD+    + Q  VE+ A++K      +  +  + 
Sbjct: 132 KSEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINP 191

Query: 322 GLLEYLEDI 330
            LLE LED+
Sbjct: 192 SLLETLEDL 200

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1381 IS 1382
            I+
Sbjct: 1035 IT 1036

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 16/142 (11%)

Query: 1249 RDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEG--- 1305
            R ++KE   +L+ K  D+ +A    IS     ++  +   G   LE       +SE    
Sbjct: 915  RAKLKENHAVLEPK-LDDIVAK---ISTRFARLFNNVGSAGAVRLE---KPKDYSEWKIE 967

Query: 1306 --VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1363
              V F    P K   + T  SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  
Sbjct: 968  IMVKFRDNAPLKKLDSHTQ-SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNER 1026

Query: 1364 IVANYIKERT---KNAQFIVIS 1382
            IV   + E       +Q+ +I+
Sbjct: 1027 IVHKAMVENACAENTSQYFLIT 1048

 Score = 39.7 bits (91), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 90/403 (22%), Positives = 170/403 (42%), Gaps = 63/403 (15%)

Query: 161 LENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 218
           L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 219 HKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEE-KPGLIITRKAFKNNSSKYYINEKES 277
              +    ++   + +     +++    +  DE  K   IITR   +   S Y IN+ E 
Sbjct: 104 KNGQDVSRIE---ITLKNSPKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEV 157

Query: 278 SYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLLEYLEDIIG 332
           S + V  L+    I LD+    + Q  VE  A++K      +  +  D  LL+ L++   
Sbjct: 158 SESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLDVLDE--- 214

Query: 333 TANYKPLIEERMGQIENLNEVCLEKE-----NRFEIVDREKNSLESGKETALEFLEKEKQ 387
                  + E  G     NE CL+K+     ++   + +E + L    E+  +F +K+ +
Sbjct: 215 -------LRELQG-----NEQCLQKDLDVKKSKILHLRQESDKLRKSVESLRDFQKKKGE 262

Query: 388 LTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKD 447
           +  L S+L  +       K+    EK++   ++ E  K   +  LK        +K +++
Sbjct: 263 IE-LHSRLLPY------VKVKDHKEKLNVYKEEYERAKANLRAILKDKKPFAHTKKTLEN 315

Query: 448 RI----SSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAE----KTLKSTKHSIS 499
           R+      CS K    +  + ++      L     +++ K  + E    +T K   + IS
Sbjct: 316 RVEELTEKCSMKNHDFLKAKEKVNEIFEKLNTIRDDVIKKKSQNEYYRGRTKKLQANIIS 375

Query: 500 EAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKD 542
             E++   LR Q+         L Q    E S+ +DI ++ KD
Sbjct: 376 TKEDL---LRNQEI--------LGQTYLPENSVFEDIDITRKD 407

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 65/138 (47%), Gaps = 12/138 (8%)

Query: 1253 KEQLGILK---KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1309
            K Q+ +L+   + + D  + G   IS    +++  +   G  +LE  ++   +   +   
Sbjct: 923  KSQIAVLRDNTEPKIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNFSNWQVKILVK 979

Query: 1310 VMPPKKSWRNITNLS--GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1367
                 +S R +T+ S  GGEK +S+   + +L  +   P  V+DEI+  +D RN  I+  
Sbjct: 980  -FRDNESVRELTSQSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHR 1038

Query: 1368 YIKERT---KNAQFIVIS 1382
             + E       +Q+I+++
Sbjct: 1039 IMVENACEDNTSQYILVT 1056

 Score = 39.3 bits (90), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 18/74 (24%)

Query: 125 LQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSFSAVV 184
           ++LSP++         YD +Q+ S       I ++ ++NF +Y    V      SF+ ++
Sbjct: 36  IKLSPIQ---------YDDYQAGS-------IIKIKMKNFMTYG--LVEYQLCPSFNMII 77

Query: 185 GPNGSGKSNVIDSM 198
           GPNGSGKS V+ ++
Sbjct: 78  GPNGSGKSTVVCAL 91

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 90/203 (44%), Gaps = 30/203 (14%)

Query: 1197 RELDVELIESKINELSYYVEETNVD---IGVLEEYARRLAEFKR------RKLDLNNAVQ 1247
            R  ++  I+  I++L   +   N D   I +L++    L E ++      + L++  A  
Sbjct: 859  RNFNLPFIQDVIDKLESEIAMVNHDESAITILDQVVTELRELEQIVPQQTKDLEITKA-- 916

Query: 1248 KRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEG-- 1305
               ++KE   IL+ K  DE ++    IS     ++  +   G   LE       ++E   
Sbjct: 917  ---KLKEDHAILEPK-LDEIVSK---ISTRFARLFNNVGSAGAVHLE---KPKDYAEWKI 966

Query: 1306 ---VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
               V F    P K   + T  SGGE+ +S++  + AL ++   P  V+DEI+  +D RN 
Sbjct: 967  EVMVKFRDNAPLKKLDSHTQ-SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNE 1025

Query: 1363 SIVANYIKERT---KNAQFIVIS 1382
             IV   + E       +Q+ +I+
Sbjct: 1026 RIVHKAMVENACAENTSQYFLIT 1048

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 74/165 (44%), Gaps = 22/165 (13%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFPSLQSC---SVAVH---FQYVIDESSGTSRIDEEKPGLIITRKAFKNNS 267
           + D I   +    ++     S  +H   F    DE+   +R        IITR   +   
Sbjct: 99  VEDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTR--------IITRSKRR--- 147

Query: 268 SKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
           S Y IN+++ S   V  L+    I LD+    + Q  VE  A++K
Sbjct: 148 SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 155 FINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I ++ L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   R + 
Sbjct: 84  YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 214 LSDLI 218
           L DLI
Sbjct: 142 LKDLI 146

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 155 FINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 214 LSDLI 218
           L DLI
Sbjct: 140 LKDLI 144

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1370 KERTK---NAQFIVIS 1382
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 155 FINELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I +L L NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 213 RLSDLI 218
            L DLI
Sbjct: 136 SLKDLI 141

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 155 FINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQ 237
           L DLI +        S  + +H +
Sbjct: 145 LKDLIRE-----GCYSAKITLHLE 163

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 155 FINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 214 LSDLI 218
           L DLI
Sbjct: 139 LKDLI 143

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1291 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNITNLSGGEKTLSSLALVFA 1338
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1339 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1382
              K   + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 88/202 (43%), Gaps = 43/202 (21%)

Query: 1204 IESKINELSYYVEETNVDIGV-----LEEYARRLAEF---KRRKLDLNNAVQKRDEVKEQ 1255
            I  ++ ++S  ++    DIGV     LE Y + +++F   K + ++++NA          
Sbjct: 884  IRKELEDISRKIKRNESDIGVSYEKALELYEQTMSKFLSAKEKYIEMDNA---------- 933

Query: 1256 LGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLD--PFSEGVTFS---- 1309
            L IL            +I S T+   YQ  +   +A+ +  +SL    F   + F     
Sbjct: 934  LSIL----------NHSIKSRTVNFGYQKTSTFADADFDFRNSLRIRKFKGKLDFGKTKE 983

Query: 1310 ----VMPPK--KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1363
                   P+  K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  
Sbjct: 984  TLNVYTGPQTDKEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRK 1043

Query: 1364 IVANYIKERTKN---AQFIVIS 1382
                 I ++ K+    Q I+I+
Sbjct: 1044 TSTQLIVQKLKDDSRTQTIIIT 1065

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1381 IS 1382
            I+
Sbjct: 1047 IT 1048

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 72/162 (44%), Gaps = 16/162 (9%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFPSLQSC---SVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKY 270
           + D I   +    ++     S  VH    I+    T +I       IITR   +   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 271 YINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
            IN+ + S   V  L+    I LD+    + Q  VE  A++K
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1381 IS 1382
            I+
Sbjct: 1047 IT 1048

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 18/163 (11%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFP----SLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269
           + D I   +       +L++       +Y ID    T +I       IITR   +   S 
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEY-IDARDETIKITR-----IITRSKRR---SD 149

Query: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
           Y IN+ + S + V  L+    I LD+    + Q  VE  A++K
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1381 IS 1382
            I+
Sbjct: 1072 IT 1073

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 16/157 (10%)

Query: 161 LENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR-LSDLI 218
           L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R + D I
Sbjct: 71  LHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNVDDYI 127

Query: 219 HKSEAFPSLQSC---SVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEK 275
              E    ++     S A+H    + E S T  I       I+TR   K   S+Y IN+ 
Sbjct: 128 KNDEEHGEIEITLKNSEAIHDVEGVLEGSDTITITR-----ILTRSKKK---SEYKINDS 179

Query: 276 ESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
             +   V +L+    I LD+    + Q  VE  A++K
Sbjct: 180 LVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1378
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1379 IVIS 1382
             +I+
Sbjct: 1056 FLIT 1059

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 159 LVLENFKSYAGKQVVGPF--HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 215
           L +ENF +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  +L 
Sbjct: 49  LRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 216 DLIHKSE 222
           D I   E
Sbjct: 105 DFIKNGE 111

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (49%), Gaps = 21/131 (16%)

Query: 1263 RFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1322
            R DE +     IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  
Sbjct: 933  RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAE 982

Query: 1323 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-- 1372
            L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E   
Sbjct: 983  LKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENAC 1042

Query: 1373 TKN-AQFIVIS 1382
             KN +Q+ +I+
Sbjct: 1043 AKNTSQYFLIT 1053

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 173/400 (43%), Gaps = 49/400 (12%)

Query: 156 INELVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I +L L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 213 RLSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYI 272
           ++ D I        ++   + V     +   S     DE      +  KA K     YYI
Sbjct: 102 KVEDFIKNGTEESVIE---LTVKNSKAVSGYSMIGGSDEVINIKTVIMKAKKK--CIYYI 156

Query: 273 NEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N +     +V  L+    I LD+    + Q  VE  A++K      SD  L E +  I  
Sbjct: 157 NGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK------SDKLLEETIRSIDS 210

Query: 333 TANYKPLI-------EERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKE 385
           T   K  +       E  +G+   LN+  LEK     ++ R K SLES +  ALE  E++
Sbjct: 211 TLVEKLDMLKDKQQEEVTIGRDVELNKSKLEK-----LIIR-KESLES-QVRALEEYERK 263

Query: 386 KQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN----KDLEDEKMKFQESLKKV----DE 437
           K    +  KL  +  ++++    + L+K+   +    KD   +K  F+ + +K+    DE
Sbjct: 264 KNEIDIHKKLLPYVRVKNHKLQLNNLKKVYEQSKQELKDFLKDKKPFKVASEKLQLLSDE 323

Query: 438 IKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLV---SKMEKAEKTLKST 494
            +  +K  ++  +S  +  K L+     L   R+S+++  K +    S+ E   + ++  
Sbjct: 324 SEGLKKIKEEEYNSLKTNHKKLI---ETLSNQRISIQDLKKKISYYRSRRENMRRKVEMA 380

Query: 495 KHSISEAENMLEELR--GQQTEHETEIKDLTQLLEKERSI 532
           +  IS    +LE L    Q+   + E +   QL EKE  I
Sbjct: 381 EQDISSRNKLLETLMLPSQEVMDDYE-RRRVQLYEKESDI 419

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 155/355 (43%), Gaps = 41/355 (11%)

Query: 161 LENFKSYAGKQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 217
           L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + R  R+ D 
Sbjct: 51  LTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDF 106

Query: 218 IHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFK-NNSSKYYINEKE 276
           I    A       ++ +  +   +  SG   I  E   + +     K      YYIN + 
Sbjct: 107 IKNGTA-----ESTIEIQLRNSRN-VSGLPMISAEDEAINVRTVLMKARRKCAYYINGEP 160

Query: 277 SSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANY 336
            S  ++  L+    I LD+    + Q  VE  A++K        D LLE     +  +  
Sbjct: 161 VSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKA-------DKLLEQTVRSVDASLL 213

Query: 337 KPLIEERMGQIENLN---EVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRS 393
             L + +  Q E L+   EV L  + + E +   K SLE+ +  ALE  E++K+   +  
Sbjct: 214 GLLEQLKTSQQEELSLNREVEL-GQKKLEKLMTHKESLEN-QVRALEEYERKKEEIDIHK 271

Query: 394 KLFQFKLLQSNSK----LASTLEKISSSNKDLEDEKMKFQES----LKKVDEIKAQRKEI 445
           +L  +  ++++ +    L S  E++    K+   +K  F+ +    L +V+  + Q++  
Sbjct: 272 RLLPYVRVKNHKRQLKDLKSEYERVKQELKEFLKDKKPFKIASNALLSEVENSQRQKQGK 331

Query: 446 KDRISSCSSKEKTLVLE----RRELEGTR---VSLEERTKNLVSKMEKAEKTLKS 493
           +       S +++L+ E    R E+E  +        R +N+  K+EKAE+ + S
Sbjct: 332 ESEYIQVKSTQRSLIEELGKQRTEVEDLKKKVTYYRTRRENIRRKVEKAEQDIAS 386

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 68/154 (44%), Gaps = 27/154 (17%)

Query: 1254 EQLGILKK----------KRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFS 1303
            E+LG+L++           R DE +     IS   ++++    +G   E+ L+   D +S
Sbjct: 914  ERLGLLRRGMLDMRNNLEPRLDELVEN---ISQRFRKLFS--NVGSAGEICLLKP-DLYS 967

Query: 1304 EG-----VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
            E      V F  +   K   + T  SGGE+ +S++  + AL  +   P  V+DEI+  +D
Sbjct: 968  EWKIEIRVKFRDVAELKKLDSHTQ-SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMD 1026

Query: 1359 FR-----NVSIVANYIKERTKNAQFIVISLRNNM 1387
             R     + ++V N   E T     I   L  N+
Sbjct: 1027 TRYERIVHKAMVENACAENTSQYFLITPKLLTNL 1060

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1381 IS 1382
            I+
Sbjct: 1044 IT 1045

 Score = 37.0 bits (84), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 95/404 (23%), Positives = 174/404 (43%), Gaps = 40/404 (9%)

Query: 156 INELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           I ++ L NF +Y+  +       S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 44  IIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKL 101

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINE 274
            D I   E     QS  V V  + V +    T  I      LI T         +Y IN 
Sbjct: 102 EDYIKNGED----QSV-VEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAING 150

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
              + T +   +K   I LD+    + Q  VE  A++K        D LLE     I ++
Sbjct: 151 STVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK-------SDKLLEETIRSIDSS 203

Query: 335 NYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSK 394
               L  E++  ++   E+ L+K+   ++ +++   L + +E     ++  K+   L+ +
Sbjct: 204 MLTSL--EKLKTLQT-TEISLQKD--VDLKNKKLQELTAQREKLEGAVKALKEYEHLKKE 258

Query: 395 LFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLK-KVDEIKAQRKEIKDRISSCS 453
           +   +LL    K+     K+ S  +D  + K K +  L+ K   IKA+    K +    +
Sbjct: 259 IEIHQLLLPYVKIKDHKSKVQSYIRDFREAKQKLKSFLQDKKPFIKAKNSLEKKQAKYQA 318

Query: 454 SKEKT---LVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRG 510
            K+ T   L+ ER++L      L +  + ++ + ++ E     TK        + E +R 
Sbjct: 319 LKQDTNSSLINERKKLNSILNDLGKGKEEIIKRKKQIEYYENRTK-------KLQESIRS 371

Query: 511 QQTEHETEIKDLTQLLEKERSILDDI---KLSLKDKTKNISAEI 551
            + E E +I  L  L   ++  LD+I   + +L +K  NI+ +I
Sbjct: 372 TEKEKEDKIASLETLQLPDQQTLDEITNERNTLIEKESNITTKI 415

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.4 bits (93), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1372
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1373 TKNAQFIVIS 1382
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 39.7 bits (91), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1381 ISL 1383
            IS+
Sbjct: 655  ISI 657

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 39.7 bits (91), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 94/195 (48%), Gaps = 27/195 (13%)

Query: 1204 IESKINELSYYVEETNVD---IGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260
            +E  +N+L   ++ +N D   + +LE+   ++A+ + +   L   V+K + +++++   +
Sbjct: 878  VEQIVNKLESKIQLSNHDRSAVALLEQTKAKIADLEDK---LPTQVRKCNTIRKEMSDKQ 934

Query: 1261 K---KRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1317
            K    R +  ++G   I     E+++ +   G   L     L  FS+     +M   +  
Sbjct: 935  KVLEPRLESIVSG---IGRKFSELFKDVGTAGGVTLNRKSKL--FSDW-KLEIMVQFRDE 988

Query: 1318 RNITNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVAN 1367
              ++ L     SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N
Sbjct: 989  GKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQN 1048

Query: 1368 YIKERTKNAQFIVIS 1382
              +E T  +Q+ +I+
Sbjct: 1049 ACEEGT--SQYFLIT 1061

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 75/176 (42%), Gaps = 24/176 (13%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 214 LSDLIHKSEAFPSLQSC-----SVAVHFQYVIDESSGTSRIDEEKPGLI----------- 257
           + D I   +    ++       ++ + F   +  S    R +    GL+           
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEF---LGSSFHRIRNNGNYKGLLTITRNLEKRTK 151

Query: 258 ITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP 313
           I R   K  + +Y IN   ++ + V  L+    I LD+    + Q  VE  A+++P
Sbjct: 152 IGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 39.3 bits (90), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 90/176 (51%), Gaps = 20/176 (11%)

Query: 402  QSNSKLASTLEKISSSNKDLEDEKMKFQESL---KKVDEIKAQRKEIKDRISSCSSKEKT 458
            Q+N++LAS LE+ +  +K++ + + K +++L   K +DE++ +RK ++D ++        
Sbjct: 1154 QTNARLASELEE-TRKDKEISNSQAK-EDALQLSKTIDELREERKGLEDGLAETKLNNTN 1211

Query: 459  LVLERRELEGTRVSLEERTKN---LVSKMEKAEKTLKSTKHSISEAENMLE-ELRGQQTE 514
            LV    EL+  +V++ E+  N   L  K E A   L   K    E E  L+ +++  QT+
Sbjct: 1212 LV---SELDALKVTVGEKNGNIQELEKKKETASSALSKIKADFDETEKRLKAQIQSLQTK 1268

Query: 515  HETEIKDLTQLLEKERSIL----DDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQ 566
            HE +++D     +KER +     D +      K   +  +I   EK++E    QLQ
Sbjct: 1269 HERKVQD----FDKERQLFAEGSDMVTQEYSKKINTLEEQISVSEKQIEEVKSQLQ 1320

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 155 FINELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 207
           +I  + L+NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1302 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1360 RNVSI----VANYIKERTKNAQFIV 1380
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 155 FINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +    V    + +F  +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 214 LSDLIHKSEAFPSLQSCSVAVHF 236
           L +LI K        S  V +H 
Sbjct: 130 LKELIRK-----GCNSSKVTLHL 147

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1364
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1346 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1396
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1397 VYKRDNRTKST 1407
              K+ +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>Ecym_2368 Chr2 (715575..717851) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AAL109W
          Length = 758

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 85/171 (49%), Gaps = 30/171 (17%)

Query: 385 EKQLTLLRS--KLFQFKLLQSNS-----KLASTLEKISSSNKDLEDEKMKFQESLKKVDE 437
           +++L  LRS  K+ Q KL + N       L   LE ++ S + LE+EK + +  L+ ++E
Sbjct: 211 QEKLVTLRSECKILQDKLAEGNHPEKVETLIKDLELLTISKESLEEEKDELKNRLESLEE 270

Query: 438 ----IKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSK--------ME 485
               + A+  + KD +             RR+++   +S E+ + N+V K        + 
Sbjct: 271 GYANVAAELVQYKDEVDL-----------RRKIDLEELSKEDLSPNIVWKQNELMKDALM 319

Query: 486 KAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDI 536
           K +++L ++   + E +   +EL    TE   EIK+LT  LE+ RS ++D+
Sbjct: 320 KIQESLDASSQLVVELQQEKKELLQTNTEMSNEIKELTLQLEQARSTINDL 370

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1362 VSIVANYIKERT 1373
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 1302 FSEGVTFSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1351
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1352 EIDAALDFRNVSIVANYI 1369
            E D  +D  N  I    I
Sbjct: 1036 EFDVFMDQVNRQIGTKLI 1053

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 13/124 (10%)

Query: 156 INELVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           + +++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273
           L DLI +        S S  +   Y+ +   G+ + D     +II R   ++    + + 
Sbjct: 129 LKDLIREG-------SYSAKITL-YLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSLK 180

Query: 274 EKES 277
            KE 
Sbjct: 181 TKEG 184

>Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii AGR229W
          Length = 717

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 7/111 (6%)

Query: 403 SNSKLASTLEKISSSNKDLEDEKMKFQESLKKVD-EIKAQRKEIKDRISSCSSKEKTLVL 461
           S+S+L S +  ++  N  LE E   +Q+ LK  D E KA R +IKD      S E    +
Sbjct: 406 SSSELESKITDLTEENLILEKE---YQKLLKDYDSETKALRNQIKDIYEENKSLESKYEV 462

Query: 462 ERREL---EGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELR 509
           + +EL   +  R   E++ KNL+S++E+A   L S K  ++E  + + EL+
Sbjct: 463 DCKELVSLKTQRTEFEKQIKNLISELEEANNELVSKKAEVNELNSTITELK 513

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 23/95 (24%)

Query: 155 FINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRL 214
           ++  + L+NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+   +   
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNR--- 115

Query: 215 SDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRI 249
                              V  + +I E  GT+RI
Sbjct: 116 ------------------GVSLKSLIREGCGTARI 132

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519 bp,
            1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 400  LLQSNSKLASTLEKISSSNKDLEDEKMKF-QESLKKVDEIKAQRKEIKDRISSCSSKEKT 458
            LL+ + +L  + EK+SS    L+ E     Q+ L K +EIK  + + K+ ISS +S  K 
Sbjct: 1001 LLEKSQELTVSKEKLSSEYHALKMEHSSLSQDVLVKENEIKKIQNDYKESISSVNSASKA 1060

Query: 459  LVLERRELE 467
            LV+ +RELE
Sbjct: 1061 LVVSQRELE 1069

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 67/130 (51%), Gaps = 14/130 (10%)

Query: 396 FQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESL-----------KKVDEIKAQRKE 444
           ++ KL + N   + +L KI S  K +ED K +FQ++            KK++E K   + 
Sbjct: 443 YELKLQEKNHSTSDSL-KIESLKKSMEDLKQQFQDAQREWHKKEMTQKKKMEEDKLVIEG 501

Query: 445 IKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENM 504
           ++  +   S K++ L  E + L  ++V LEE+ K+L+  ++  EK  K    S+ E   +
Sbjct: 502 LQANLDYLSKKQEQLEQENKALVESKVDLEEQVKDLMFYLDSQEK-FKDADESVKEGTVL 560

Query: 505 LEE-LRGQQT 513
           +++ L+G Q 
Sbjct: 561 IQQPLKGAQA 570

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 21/174 (12%)

Query: 406  KLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKE-------IKDRISSCS-SKEK 457
            KL + L+++ S  K LE++  K    LK   E+ +  KE       + +R+ S S + +K
Sbjct: 872  KLKNDLQEMESKKKFLEEKNQKTINELKDTQELLSLEKENLKKNESLLNRVKSSSETLQK 931

Query: 458  TL---VLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTE 514
                 VLE+ E+   ++        ++  +EKAE+ ++  + SI E E  L  LR +  E
Sbjct: 932  QFDDTVLEKNEISKQKLQ-------IMQNLEKAEQIIQDLQESIKERETALGNLRSKNDE 984

Query: 515  HETEIKDLTQLLEKE---RSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQL 565
               +I +L   + KE   +S++ + KL L+ + K +   I   E E+  +D +L
Sbjct: 985  LIKQISNLNYDISKEQNSQSLIKESKLKLESEIKRLKGVINLKENEINSFDKKL 1038

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
           (REAL)
          Length = 829

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 19/161 (11%)

Query: 396 FQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSK 455
           FQ++ L  N +     + I SSN+ +E    + + ++ KV++ K + KE+   I   +S 
Sbjct: 347 FQYEKLNKNHQ-----QLIDSSNEKVEKLSTERENNISKVEKFKKRIKELNTEIKVLNSN 401

Query: 456 EKTLVLE-----------RRELEGTRVSLEERTKNLVSK---MEKAEKTLKSTKHSISEA 501
           +K L  +           R E E T  +L    KNL  K   +E  ++ L++    +SE 
Sbjct: 402 QKILQEKYDDSITDLNNLRSEHENTVNTLHINEKNLNEKNVELENVKEELRTNVDKLSEY 461

Query: 502 ENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKD 542
           + M+ EL    TE   +I+    +L+ + + LD++KLSLK+
Sbjct: 462 QAMVNELNSCITELNDKIESTNIVLKSKETELDNLKLSLKE 502

>TPHA0P00430 Chr16 complement(91648..92607) [960 bp, 319 aa] {ON}
           Anc_8.85 YPL004C
          Length = 319

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 66/126 (52%), Gaps = 12/126 (9%)

Query: 827 HVAKGLMKLGTNQSDKVDDYTPE------EVDKIERELSERENNFRVASDTVHEMEEELK 880
           H A  L + G    + V D T +      E+ +++ +  ++ + +R+   ++ ++E  ++
Sbjct: 81  HAATQLSEWGYGNDEDVSDVTDKLGVLLFELGELQDQFIDKYDQYRITIKSIRDIESSVQ 140

Query: 881 KLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLER 940
             RD +  L  QI+  + + D  +++L + EQ++  AE    +++  +AQL+ + +  E+
Sbjct: 141 PSRDRKEKLAGQIAALKYK-DPTSAKLPVLEQELVRAE---AESLVAEAQLSNITR--EK 194

Query: 941 LRGEYN 946
           L+  +N
Sbjct: 195 LKASFN 200

>Smik_7.121 Chr7 (211577..214975) [3399 bp, 1132 aa] {ON} YGL151W
            (REAL)
          Length = 1132

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 70/174 (40%), Gaps = 31/174 (17%)

Query: 729  DYLRKNKLGYARFILLD----------RLRQFNLQPISTPENVPRLFDLVKPKNPKFSNA 778
            DY RK +LGY +F++L+          ++  F     ST  N+  LF+L++   PK    
Sbjct: 877  DYSRK-QLGYGKFLILNENPVNKIMTNQINSFWSLHSSTYYNLDYLFELIELVTPK---- 931

Query: 779  FYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN 838
              S L D L     K       G K  R     G L         G  HV          
Sbjct: 932  --SFLFDVLKTLEYKLTTYGVPGSKNKR-----GSL---------GSEHVFDYFFYFLVL 975

Query: 839  QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQ 892
               K  D   + +D +E +L +   +  + S+ +HE +E ++  ++ +P  E+Q
Sbjct: 976  YDVKTADEATQLIDYMENDLKKATEDVDIKSEDLHEKKEAIEVKQESQPKNEAQ 1029

>TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON}
           Anc_2.16 YNL225C
          Length = 1016

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 83/169 (49%), Gaps = 23/169 (13%)

Query: 398 FKLLQSNSKLASTLEKISSSNKDLEDEKMK-FQESLKKVDEIKAQRKEIKDRISSCSSKE 456
           F  L +N K+   L +I  +N  L +EK+   +E +K++D+  ++R  ++  I+      
Sbjct: 389 FTSLPNNGKM---LPQIDLNNSALLNEKVHILEERIKQLDKFDSRRLMMRKEIT------ 439

Query: 457 KTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTK----HSISEAENMLEELRGQQ 512
            TL   +REL      LEE      SK EK++  LKS      H   + EN  E+L+   
Sbjct: 440 -TLKTSKRELNANLKKLEEEKNAYKSKYEKSQDILKSVNNELYHLKRQNENTEEKLKNIL 498

Query: 513 TEHETEIKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPW 561
            E++  + D  +LLEK+       KL+   + + IS+++  + KEL  +
Sbjct: 499 LENKI-LTDRLELLEKD-------KLTYSKELQMISSKLKINNKELSAY 539

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
            KEL1Protein required for proper cell fusion and cell
            morphology; functions in a complex with Kel2p to
            negatively regulate mitotic exit, interacts with Tem1p
            and Lte1p; localizes to regions of polarized growth;
            potential Cdc28p substrate
          Length = 1164

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 400  LLQSNSKLASTLEKISSSNKDLEDEKMKF-QESLKKVDEIKAQRKEIKDRISSCSSKEKT 458
            LL+ + +L  + EK+SS    L+ E     Q+ L K +EIK  + + K+ ISS  S  K 
Sbjct: 993  LLERSQELTISKEKLSSEYHALKMEHSSLSQDVLVKENEIKKIQNDYKESISSMDSASKA 1052

Query: 459  LVLERRELE 467
            L++ +RELE
Sbjct: 1053 LMVSQRELE 1061

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
            YHR158C (REAL)
          Length = 1169

 Score = 33.5 bits (75), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 400  LLQSNSKLASTLEKISSSNKDLEDEKMKF-QESLKKVDEIKAQRKEIKDRISSCSSKEKT 458
            LL+ + +L  + EK+SS    L+ E     Q+ L K +EIK  + + K+ ISS  S  K 
Sbjct: 999  LLEKSQELTISKEKLSSEYHALKMEHSSLSQDVLVKENEIKKIQSDYKESISSMDSASKA 1058

Query: 459  LVLERRELE 467
            L + +RELE
Sbjct: 1059 LTVSQRELE 1067

>SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa]
           {ON} similar to uniprot|P24384 Saccharomyces cerevisiae
           YER013W PRP22 RNA-dependent ATPase/ATP-dependent RNA
           helicase in the DEAH-box family associates with the
           lariat intermediate before the second catalytic step of
           splicing
          Length = 1139

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 180 FSAVVGPNGSGKSNVIDSMLFVFGFRANKM---RQDRLSDLIHKSEAFPSLQSCSVAVHF 236
           F  +VG  GSGK+  I   L+  GF  N +    Q R    I  ++       C+V    
Sbjct: 495 FLVIVGETGSGKTTQITQYLYEEGFGRNGIIGCTQPRRVAAISVAKRVAEEVGCTVGEEV 554

Query: 237 QYVI---DESSGTSRIDEEKPGLIITRKAFKNNSSKYYI 272
            Y I   DE+S  ++I     G++       +  SKY I
Sbjct: 555 GYTIRFEDETSPMTKIKYMTDGMLQREALLDSKMSKYSI 593

>NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {ON}
           Anc_1.162 YKL179C
          Length = 684

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 453 SSKEKTLVLERRELEGTRV-SLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQ 511
           SS E  L+++  E   +R+  LEER   L +K+ KA      T     EA    +EL+  
Sbjct: 234 SSTEFNLLVQELESAQSRIMQLEERNVTLNTKLTKA------TSEEEKEAHLHAKELKIN 287

Query: 512 QTEHETEIKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELE 559
           Q E E  +  L+   E+ERS L  IK  L+D+ K +  E I  + ELE
Sbjct: 288 QLESENVL--LSASFERERSELSKIKDELQDQIKEVKNESISVKSELE 333

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
            YHR158C (REAL)
          Length = 1168

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 400  LLQSNSKLASTLEKISSSNKDLEDEKMKF-QESLKKVDEIKAQRKEIKDRISSCSSKEKT 458
            LL+ + +L  + EK+SS  + L+ E     Q+ L K +EIK  + + K+ I+S  S  K 
Sbjct: 997  LLEKSQELTMSKEKLSSEYRALKMEHSSLSQDVLVKENEIKKIQNDYKESINSMDSASKA 1056

Query: 459  LVLERRELE 467
            L++ +RELE
Sbjct: 1057 LMVSQRELE 1065

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1362 VSIVANYIKERTKNAQFIVISL 1383
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 1323 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1382
            LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      IS
Sbjct: 590  LSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTTIS 644

Query: 1383 LRNNMFELAQQL-VGVYKRDN 1402
            + + +  +A    V V  RD 
Sbjct: 645  IAHRISTIAHSTRVVVLGRDG 665

>CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly
           similar to uniprot|P22204 Saccharomyces cerevisiae
           YGR092w DBF2 ser/thrprotein kinase or uniprot|P32328
           Saccharomyces cerevisiae YPR111w DBF20
          Length = 539

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 719 DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNA 778
           +T E  +H    LR+ +LG  R+ + DR   F    I+ P N  + F+ VK + P FS  
Sbjct: 389 ETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRLKSFEHVK-RMPYFSEI 447

Query: 779 FYSVLRD 785
            +S LR+
Sbjct: 448 DFSKLRE 454

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 64/124 (51%), Gaps = 13/124 (10%)

Query: 401 LQSNSKLASTLEKISSSNKDLEDEKMKFQESLK-----------KVDEIKAQRKEIKDRI 449
           LQ  ++  S L ++ S  K +ED K++F+ + K           K+DE K   + ++  +
Sbjct: 447 LQEQNQNVSELSQVESLQKSMEDLKLQFRATQKEWHEKETIQKTKLDEDKLVIEGLQANL 506

Query: 450 SSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEE-L 508
              S K++ L  +++ L  ++  LEE+ K+L+  ++  EK  K+   S+ E   ++++ L
Sbjct: 507 DHLSKKQEQLEQDKKVLAESKQDLEEQVKDLMFYLDSQEK-FKTADESVKEGTILIQQPL 565

Query: 509 RGQQ 512
            G Q
Sbjct: 566 EGAQ 569

>TDEL0C03980 Chr3 complement(697431..699503) [2073 bp, 690 aa]
          {ON} Anc_2.263 YIL108W
          Length = 690

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 45 EPDLPALEASYSKSYTPRKLVLSSGENRYAFSQPTN--STTTSLHVPNLQPPK 95
           P LP L    ++S     ++L+ GENR  F+  TN   T T  + P LQ P 
Sbjct: 42 HPQLPRLSYPLNESGFKATIILTPGENRLTFATDTNKSKTVTCYYTPLLQDPP 94

>TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {ON}
           Anc_4.46 YLR309C
          Length = 910

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 10/119 (8%)

Query: 850 EVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTL 909
           E+D++ +E      +F+   D   E+E  +KK +D   DL+  ISK       L  + T 
Sbjct: 424 ELDEVHKEKEVLLKDFKNKED---ELEASIKKYQDDITDLKKNISK-------LNEQRTA 473

Query: 910 AEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKGLQDEIMK 968
            EQ + ++ +   K  +D   LNV +K L  L+   N L++    K++ I  L+++I K
Sbjct: 474 HEQAISQSNVTITKLKNDNNVLNVQLKELAVLKKSENQLKTNLVQKEKTITYLENQIKK 532

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 876  EEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVM 935
            EEE+K L++ +  LE+QI +++ E + L  +L +  +   E E    +      +LNV  
Sbjct: 1544 EEEIKNLQNEKSTLETQIKESKKEIEELERKLKIEAKSTTELETIEQQLSKANEKLNVNR 1603

Query: 936  KNLERLRGEYNDLQSETKTKKEKIKG 961
            K    L+ +  DL+ E K K+ KIK 
Sbjct: 1604 KEDALLKSKLKDLERELKEKQVKIKN 1629

>Suva_4.347 Chr4 complement(614150..616405) [2256 bp, 751 aa] {ON}
           YBR102C (REAL)
          Length = 751

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 16/83 (19%)

Query: 901 DSLASELTLAEQQVKE-----AEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955
           D   S LT    QV+E        +Y + ++    LNV M  L+R+RG  NDL +ET   
Sbjct: 201 DKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNVAMLELKRVRGNINDL-NET--- 256

Query: 956 KEKIKGLQDEIMKIGGIKLQMQN 978
                   D+  KI   +LQ+QN
Sbjct: 257 -------LDQFTKIAAKRLQLQN 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 139,680,168
Number of extensions: 6351289
Number of successful extensions: 44862
Number of sequences better than 10.0: 1903
Number of HSP's gapped: 42715
Number of HSP's successfully gapped: 4154
Length of query: 1418
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1296
Effective length of database: 39,492,147
Effective search space: 51181822512
Effective search space used: 51181822512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)