Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR085C (ARP6)8.258ON43843822830.0
Skud_12.1538.258ON43843821410.0
Smik_12.1448.258ON43843821270.0
Suva_10.1698.258ON43843821090.0
NDAI0B019608.258ON43944116430.0
NCAS0B049908.258ON42043916260.0
ZYRO0C01738g8.258ON41443816190.0
Kpol_543.368.258ON42744116060.0
KAFR0B027008.258ON42043816000.0
TDEL0F038508.258ON41943915920.0
TBLA0H014608.258ON44244515810.0
KLTH0G13772g8.258ON42043815740.0
CAGL0L12166g8.258ON42143515380.0
SAKL0H17138g8.258ON41943915280.0
Kwal_56.238328.258ON41943815030.0
KNAG0G020108.258ON42443714940.0
Ecym_43128.258ON41143614540.0
AGR091W8.258ON41043414320.0
KLLA0F19063g8.258ON41544214010.0
TPHA0A018308.258ON42144013690.0
TBLA0C004408.23ON3754382571e-23
NCAS0C037008.23ON3754382561e-23
TDEL0C004708.23ON3754382542e-23
CAGL0K12694g8.23ON3754382542e-23
Suva_6.188.23ON3754382542e-23
Smik_6.398.23ON3754382542e-23
YFL039C (ACT1)8.23ON3754382542e-23
TPHA0D002508.23ON3754382543e-23
KNAG0L002508.23ON3754382543e-23
KAFR0D009408.23ON3754382543e-23
NDAI0G030408.23ON3754382534e-23
ZYRO0F02772g8.23ON3754382534e-23
SAKL0B00968g8.23ON3754382525e-23
ABR222W8.23ON3764382525e-23
Kpol_1058.158.23ON3754382518e-23
KLLA0D05357g8.23ON3754382482e-22
KLTH0G18832g8.23ON3754382463e-22
Ecym_15208.23ON3764382454e-22
Skud_6.318.23ON3603892392e-21
Kwal_14.11098.23ON3603892312e-20
Ecym_63852.117ON3774422163e-18
AFR051W2.117ON4054422111e-17
KLTH0F06490g3.161ON3913842084e-17
TBLA0F008703.161ON3913902057e-17
ZYRO0B04928g3.161ON3914622058e-17
SAKL0E11814g2.117ON3794502031e-16
CAGL0K01595g3.161ON3913862012e-16
TDEL0B048102.117ON3734331994e-16
SAKL0C07370g3.161ON3913881994e-16
NDAI0G029003.161ON3913901994e-16
ZYRO0G05676g2.117ON3814361995e-16
Ecym_52373.161ON3913881979e-16
KNAG0K01130na 1ON3933861961e-15
Kwal_23.48482.248ON7451661972e-15
Kwal_33.141773.161ON3373181923e-15
TDEL0D046103.161ON3913881924e-15
KLLA0C03850g3.161ON3913841906e-15
ADR316W3.161ON3913861872e-14
YDL029W (ARP2)3.161ON3913901872e-14
KLLA0E22925g2.117ON3804381862e-14
NCAS0C035503.161ON3923861862e-14
Smik_4.2063.161ON3913901852e-14
TDEL0C041402.248ON7491691883e-14
Kpol_479.253.161ON3913901843e-14
Suva_4.2203.161ON3913901844e-14
Skud_4.2223.161ON3913901844e-14
Ecym_32852.248ON7461721856e-14
KNAG0I018602.248ON7531851848e-14
SAKL0E08602g2.248ON7471661821e-13
TPHA0I013002.117ON3794301792e-13
KLLA0F03421g2.248ON7471801812e-13
NCAS0B071302.117ON3814471763e-13
YNL059C (ARP5)2.248ON7551651768e-13
Kpol_1003.162.248ON7491641759e-13
Kpol_1023.188.23ON3193511701e-12
TPHA0A009203.161ON3913901711e-12
NDAI0D010602.248ON7531651722e-12
TBLA0E038602.248ON7591651722e-12
KAFR0D037001.514ON4494481694e-12
Skud_14.2722.248ON7551661704e-12
Suva_14.2812.248ON7551671695e-12
KAFR0C01040na 1ON3373251648e-12
KLTH0G09482g2.248ON7451861671e-11
KLLA0B13904g1.514ON4562581651e-11
NDAI0B044602.117ON3813841641e-11
ADL253C2.248ON7511661661e-11
KNAG0B001701.514ON4532591632e-11
Smik_14.2672.248ON7551651642e-11
SAKL0D12804g1.514ON4564441623e-11
NDAI0A039701.514ON4624511588e-11
CAGL0F00517g1.514ON4542591589e-11
TPHA0O010401.514ON4582631571e-10
NCAS0A122701.514ON4542591561e-10
TPHA0C031602.248ON7551831562e-10
KNAG0H036502.117ON3874291542e-10
KLTH0B05940g2.117ON3834461533e-10
Smik_10.3551.514ON4492631543e-10
Ecym_31531.514ON4582641543e-10
AFR419C1.514ON4552591543e-10
Kwal_33.146422.117ON3834421533e-10
YJR065C (ARP3)1.514ON4494571533e-10
TBLA0D036801.514ON4584541533e-10
ZYRO0G01936g1.514ON4612561533e-10
KLTH0C02508g1.514ON4514461533e-10
CAGL0H09042g2.117ON3874311524e-10
Skud_10.2891.514ON4492631534e-10
Skud_8.1902.117ON3844011507e-10
Kpol_1056.161.514ON4602591507e-10
Suva_15.3262.117ON3843831507e-10
Suva_12.1541.514ON4492631508e-10
TDEL0F004701.514ON4612591509e-10
Smik_8.2102.117ON3843871481e-09
YHR129C (ARP1)2.117ON3843881481e-09
ZYRO0A01584g2.248ON7482051492e-09
KAFR0F005902.117ON3864411472e-09
Kwal_27.99581.514ON4451921402e-08
TBLA0B010702.117ON3834371392e-08
CAGL0J10054g2.248ON7541851374e-08
KAFR0J011602.248ON7511651276e-07
Kpol_282.41.287ON5011061142e-05
KLLA0D02288g1.287ON5201051142e-05
AFR105C1.287ON4791051133e-05
TBLA0D053601.287ON5961251062e-04
TDEL0D015501.287ON480931034e-04
Ecym_63301.287ON4801051035e-04
KAFR0A015601.287ON4855241018e-04
TPHA0I010301.287ON503326990.001
NDAI0G055801.287ON515242980.002
Kwal_14.23771.287ON481518970.002
ZYRO0G21428g1.287ON483524920.010
KLTH0H09702g1.287ON481146910.013
SAKL0D05874g1.287ON497105900.016
NCAS0B060601.287ON49797890.025
CAGL0M03201g1.287ON49351880.030
NCAS0G030502.248ON743151880.034
Suva_6.1541.287ON489113860.054
KLTH0C05324g7.448ON399210850.057
Smik_10.1611.287ON489237820.18
SAKL0F13772g7.448ON422293810.18
Kwal_27.105527.448ON351211800.24
YJL081C (ARP4)1.287ON489108780.50
Skud_10.1321.287ON48893780.51
KNAG0B019201.287ON505105770.58
TDEL0C031207.448ON438145760.93
TPHA0E006407.436ON1071163723.3
KLTH0H16016g2.367ON70785704.6
AGL357W5.18ON1166102696.7
NCAS0C018808.587ON79883688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR085C
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   884   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   829   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   823   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   816   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   637   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   630   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   628   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   623   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   620   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   617   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   613   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   610   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   597   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   593   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   583   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   580   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   564   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   556   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   544   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   531   0.0  
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   103   1e-23
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   103   1e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   102   2e-23
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   102   2e-23
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   102   2e-23
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   102   2e-23
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   102   2e-23
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   102   3e-23
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   102   3e-23
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   102   3e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   102   4e-23
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   102   4e-23
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   101   5e-23
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   101   5e-23
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   101   8e-23
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   100   2e-22
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    99   3e-22
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    99   4e-22
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    97   2e-21
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    94   2e-20
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    88   3e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    86   1e-17
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    85   4e-17
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    84   7e-17
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    84   8e-17
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    83   1e-16
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    82   2e-16
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    81   4e-16
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    81   4e-16
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    81   4e-16
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    81   5e-16
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    80   9e-16
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    80   1e-15
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    80   2e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    79   3e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    79   4e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    78   6e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    77   2e-14
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    77   2e-14
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    76   2e-14
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    76   2e-14
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    76   2e-14
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    77   3e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    75   3e-14
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    75   4e-14
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    75   4e-14
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    76   6e-14
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    75   8e-14
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    75   1e-13
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    74   2e-13
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    74   2e-13
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    72   3e-13
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    72   8e-13
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    72   9e-13
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    70   1e-12
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    70   1e-12
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    71   2e-12
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    71   2e-12
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    70   4e-12
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    70   4e-12
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    70   5e-12
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    68   8e-12
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    69   1e-11
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    68   1e-11
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    68   1e-11
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    69   1e-11
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    67   2e-11
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    68   2e-11
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    67   3e-11
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     65   8e-11
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    65   9e-11
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    65   1e-10
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    65   1e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    65   2e-10
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    64   2e-10
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    64   3e-10
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    64   3e-10
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    64   3e-10
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    64   3e-10
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    64   3e-10
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    64   3e-10
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    64   3e-10
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    64   3e-10
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    64   3e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    63   4e-10
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    64   4e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    62   7e-10
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    62   7e-10
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    62   7e-10
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    62   8e-10
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    62   9e-10
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    62   1e-09
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    62   1e-09
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    62   2e-09
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    61   2e-09
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    59   2e-08
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    58   2e-08
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    57   4e-08
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    54   6e-07
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    49   2e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    49   2e-05
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    48   3e-05
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    45   2e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    44   4e-04
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    44   5e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    44   8e-04
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    43   0.001
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    42   0.002
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    42   0.002
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    40   0.010
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    40   0.013
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    39   0.016
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    39   0.025
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    39   0.030
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    39   0.034
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    38   0.054
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    37   0.057
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    36   0.18 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    36   0.18 
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    35   0.24 
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    35   0.50 
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    35   0.51 
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    34   0.58 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    34   0.93 
TPHA0E00640 Chr5 complement(113447..116662) [3216 bp, 1071 aa] {...    32   3.3  
KLTH0H16016g Chr8 complement(1374529..1376652) [2124 bp, 707 aa]...    32   4.6  
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    31   6.7  
NCAS0C01880 Chr3 complement(346987..349383) [2397 bp, 798 aa] {O...    31   8.9  

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/438 (97%), Positives = 426/438 (97%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRG            KNAQDS
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHGPDWCTKHRFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/438 (89%), Positives = 409/438 (93%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  PIVIDNGSYEIKF PSTN+ PFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNPSEF GFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEFDSLFKSPVAVFVPFTKSYKG+++TISGKDE+ D+V               +AQ+S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNN+KE+CLFVSPVSYFDSFK KDKHALEYVLPDFQTSF+GYVRNPR+EN PLPED
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ I LTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVP GDCALFGWEVMSQFAKT+SYR+ARVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHGPDWCTK RFGYQNWI
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/438 (89%), Positives = 403/438 (92%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           MET PIVIDNGSYEIKFGPSTN+KPFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNP EFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEFDSLFKSPVA FVPFTKSYK +M+ ISGKDED DIV              ++ Q  
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLD+GGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKE+CLFVSPVSYFDSFK KDKHALEYVLPDFQTSFLGYVRN RKEN PL ED
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ ITLTDELFTIPETFFHPEI+QITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVPE DCALFGWEVMSQF+ T SYR ARVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNWI
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/438 (88%), Positives = 407/438 (92%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME PPIVIDNGSYEIKFGPSTNK PFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEFDSLFKSPVAVFVPFTKSYKG+MRTISGKDED D+                +  +S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            +DYHDFQLVIDSGF+CTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKE+CLFVSP SYFDSFK+K+KH LEYVLPDFQTSF+GYVR+P +E+ PLP D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ ITLTDELFTIPETFFHPEISQI KPGIVEAILESLSMLPEIVRPLM+GNIVCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           NLPNFAQRLA ELQRQLPTDWTC+VSVPEGDC LFGWEVMSQFAKT+SY++ARVTREEYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHGPDWCTKHRFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/441 (65%), Positives = 358/441 (81%), Gaps = 5/441 (1%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M++ P+V+DNGSYEIKFG S +++P+RALN  A DK+G++YLSN +K I+++S +T RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELESCIWDYCL+NP EFDGF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPF---TKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNA 177
           EEYEFDSLFK+P A ++PF       K  + TISGK  D D++               + 
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 178 QDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
           +   +DY D++LVIDSGFNCTWIIP++KG+PYYKA+KKLDIGGRFLTGLLKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 238 MMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297
           +MDET+LVNNIKE+CLFVSP SYFDSFK K++ ++EY+LPD  +S+LGY R  + +  PL
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSK--PL 298

Query: 298 PEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
           PE +Q++ L DELF++PETFFHPEIS+I KPGIVE ILESLSM+PEI+RPL+V NIVCTG
Sbjct: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358

Query: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTRE 417
           GNFNLP+FA RLAAELQRQLPTDWTC +SVP+ +C LF W+ M QFA TDSY+K R+++E
Sbjct: 359 GNFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418

Query: 418 EYYEHGPDWCTKHRFGYQNWI 438
           EYYEHGPDW TKH+FGYQNW+
Sbjct: 419 EYYEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/439 (68%), Positives = 353/439 (80%), Gaps = 20/439 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME+ PI IDNGSYEIKFG +    P+RA+NA A DK+ T+YLSN IKNIKDI+S+TFRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELES IWDY LFNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGK-DEDIDIVRGXXXXXXXXXXXXKNAQD 179
           EEYEFDS +KS +A F+ F        + ISGK +EDI +                  Q 
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADD--KNTKIISGKTEEDISL--------------DSVNQV 164

Query: 180 SGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMM 239
              +Y+D+QLVIDSGFNCTWIIPV+KG+PYYKAVKKLDIGGRFL GLLKETLSFRHY++M
Sbjct: 165 REKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVM 224

Query: 240 DETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPE 299
           DETILVNNIKE CLFVSP SYFDSFK K++ A+EYVLP+FQT+FLG+VR+  K   PLPE
Sbjct: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK---PLPE 281

Query: 300 DAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGN 359
           + Q I L DELF++PETFFHPEI++I KPG+VE ILESLSM+PE++RPL+VGN+VCTGGN
Sbjct: 282 NTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGN 341

Query: 360 FNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEY 419
           FNLP+FA RL +ELQRQLPTDW C  SVP  +C LFGW+ M+QFA T+SYRK RVTREEY
Sbjct: 342 FNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEY 401

Query: 420 YEHGPDWCTKHRFGYQNWI 438
           YEHG DW TK+RFGYQNWI
Sbjct: 402 YEHGTDWLTKNRFGYQNWI 420

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/438 (68%), Positives = 345/438 (78%), Gaps = 24/438 (5%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME+PPIV+DNGSYEIKFG    + P RA NALA+DKFG+ YLSN IK IKDISS+ FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WELES IWDYC FNP EF+GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEF S+FKSP+A F PF +        ISGK +D                   N +  
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPSIA----ISGKGDD-----------------QPNRKAE 159

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
              Y  FQLVID GFNCTW++PV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKE CLFVSPVSYF+SFK K++ A+EYVLPDFQTSFLGYV++P+K   PLP+D
Sbjct: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q + L DELF++PETFFHPEI Q+ KPGI+E ILESLS+LPE +RPLM+GNIVCTGGNF
Sbjct: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNF 336

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           NLPNFA RLA ELQRQLPTDWTC V +P G   L+GW  M+ F  +  Y  ARVTREEY+
Sbjct: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCT+HRFGYQNW+
Sbjct: 397 EHGVDWCTRHRFGYQNWM 414

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/441 (66%), Positives = 356/441 (80%), Gaps = 17/441 (3%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  PIVIDNGSYE+KFG S  K P RALNALAKDK+G  YLSN + NIKDISS+T RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE  +WDYC FNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDI--DIVRGXXXXXXXXXXXXKNAQ 178
           EEYEF+SLFKSPVA FVPF  + +  M+ I GK +D+  D++               ++Q
Sbjct: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISNM------------DSQ 167

Query: 179 DSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNM 238
           +  + Y DF LVIDSGFNCTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++
Sbjct: 168 NIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDV 227

Query: 239 MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLP 298
            DETILVNNIKE+CLF+SP SY DSFK KD+++++YVLPDFQTSF+GYV++ +K N  LP
Sbjct: 228 TDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLP 286

Query: 299 EDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
           E++Q+ITLTDELF++PET FHPE++++ KPGIVE ILESLS++PE +RPL+V NIVC GG
Sbjct: 287 ENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGG 346

Query: 359 NFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAK-TDSYRKARVTRE 417
           NFN+PNF  RLA ELQRQLPTDW C++ +PE DC L GW+ MSQFA+ TD Y+KAR++RE
Sbjct: 347 NFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISRE 406

Query: 418 EYYEHGPDWCTKHRFGYQNWI 438
           EYYEHG DW TK RFGYQNWI
Sbjct: 407 EYYEHGTDWTTKKRFGYQNWI 427

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 347/438 (79%), Gaps = 18/438 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  P+VIDNGSY +KFGP++ + P+ ALNA+A DK+  SYLSN IK+IKDISS++ +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H LGQLT WE+++ IWDYCL+NP EF+GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEF SL KSPVA ++PF ++ K ++  I G+ +    V                   S
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQI--IIGERDTEPFVE----------------TPS 162

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y DFQLV+DSGFNCTWIIPV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 163 TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKE+CLFVSP SYFDSFK KD  + EYVLPDFQTSFLGYVR   ++  PLPED
Sbjct: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q ITL DELF +PETFFHPEISQI KPG+VE ILESLSM+PE++RPLMV NI+C GGNF
Sbjct: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           NLP+FA R+A ELQRQLPTDW C +++ +G+  L GW+ MS FA TD Y+  RVTREEYY
Sbjct: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNW+
Sbjct: 403 EHGIDWCTKHRFGYQNWV 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 352/439 (80%), Gaps = 21/439 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME+ P+V+DNGSYE+KFG ST  +PFRALNALA+DKFG +YLSN I  IKDISS++F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WEL+SC+WDYC FNP+EFDGFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEFDSL K+P++ F+PF+K +    + ISGK +                     +   
Sbjct: 121 EEYEFDSLLKAPISGFMPFSK-HTENTKVISGKGDS----------------ESGTSTSE 163

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             DY  FQ+VIDSGFNCTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+MD
Sbjct: 164 TKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD 223

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKE+CLF+SPVSYFDSF  KD+ A+EYVLPDFQT+FLGYV + +    P  +D
Sbjct: 224 ETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKN---PPSKD 280

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ +TL DELF++PETFFHPEI+Q+ KPGI+E ILESLS++PE +RPLMV NI+CTGGNF
Sbjct: 281 AQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPE-GDCALFGWEVMSQFAKTDSYRKARVTREEY 419
           NLP+F +RLA ELQRQLPTDW+  + +P+   C L GW  MS FA TD Y+ ARV+R+EY
Sbjct: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400

Query: 420 YEHGPDWCTKHRFGYQNWI 438
           YEHG +W TK+RFGYQNWI
Sbjct: 401 YEHGVEWTTKNRFGYQNWI 419

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/445 (65%), Positives = 352/445 (79%), Gaps = 10/445 (2%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M+  PIVIDNGSYEIKFG S ++ PFRA+NA+AKDK+ T YLSN IK IKDISS+ FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           +ELGQLT WELES IWDYC +NP EFDGF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEY + S++KSPVA F+PF    K ++ +ISGK +D D                     S
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTK-DVISISGKADDDDDDNNAKFQEQLVTNDLNTYISS 179

Query: 181 -------GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                   ++Y DFQL+IDSGFNCTWIIPV+KGIPYYKA+KK+DIGGRFLTGLLKETLSF
Sbjct: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239

Query: 234 RHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKE 293
           RHYN+ DETILVNNIKE+CLFV+P SY +SFK K+K A+EYVLPDF T+F+GY+++  K 
Sbjct: 240 RHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK- 298

Query: 294 NVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNI 353
              LP++AQ+ITL DELF++ ET FHPEIS+I KPGI+E I+ESLSMLPE++RPLMV NI
Sbjct: 299 -TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNI 357

Query: 354 VCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKAR 413
           VC GGNFNLPNF++RL +ELQRQLPTDWT HV +P+ D  LFGW+ M+QF+ TDSYRKAR
Sbjct: 358 VCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKAR 417

Query: 414 VTREEYYEHGPDWCTKHRFGYQNWI 438
           +TREEY EHG +WCTKHRFGYQNWI
Sbjct: 418 ITREEYMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/438 (65%), Positives = 345/438 (78%), Gaps = 18/438 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  PIVIDNGSYEIKFG +++ +PF ALN++AKDK+G  +LSN +++IKDISS+TF RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELES IWDYCLFNP EFDG+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYE+DSLFK+PV VFVPF    +G+   I    ED D+V               +    
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVV-------------ASDHPSD 165

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             DY D++LVIDSGFNCTW++PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVN+IKE+CLF+SP SYFDSF+++ K A EYVLPDF TSF GY+R P +    LPED
Sbjct: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT---LPED 282

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q I L DELF +PETFFHPEI+ +  PGI+EAILES+SMLPE +RPL+VGN+V TGGNF
Sbjct: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           N+PNFA RLA ELQRQ PTDW+C VSVP GD  L+GW+ M +F++T +YR++RV+REEYY
Sbjct: 343 NIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYY 402

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCT  RFGYQ W+
Sbjct: 403 EHGVDWCTSKRFGYQAWL 420

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/435 (63%), Positives = 347/435 (79%), Gaps = 22/435 (5%)

Query: 6   IVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQ 65
           IVIDNGSY++KFG ++  +P  ALNALAKDK+G ++LSN ++NIKDISS+ FRRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125
           LT WELESCIWDYCL+NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSLFKSPVAVFVPFTKSYKGEMRTISGKDE--DIDIVRGXXXXXXXXXXXXKNAQDSGSD 183
           DSL+K+P A ++PF  + +  ++TISGK +  ++DI               +   ++G +
Sbjct: 126 DSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGELDI---------------EEKIEAGKE 169

Query: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI 243
           Y+DF LVIDSGFNCTW+IP++KG+PYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+I
Sbjct: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI 229

Query: 244 LVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQI 303
           LVNNIKEQCL+V PVSYF++FK K K+ +++VLPDFQTSF GYVR+P+     LP++AQI
Sbjct: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQI 286

Query: 304 ITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
           +TLTDE F++PE FFHPEISQ  KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP
Sbjct: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLP 346

Query: 364 NFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHG 423
            F  RL +ELQRQLPTDW C   +  GD +L GW  M++FA TD+Y+KARVT+E+Y+EHG
Sbjct: 347 GFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406

Query: 424 PDWCTKHRFGYQNWI 438
            DW TK RFGYQNW+
Sbjct: 407 LDWTTKERFGYQNWV 421

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 341/439 (77%), Gaps = 21/439 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M+  PI+IDNGSYE+KFGP+TN  PFRALNALA+DK+G  +LSN +  +KDIS++ FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WEL+SCIWDYCL+NP EF+ +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEF S FK PVA FVPF      E   I  K++ +                 K++   
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQ-ALEHNMIYAKEDSV---------------YRKDSTGE 163

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            ++Y+DFQLVIDSGFNCTW++P++KGIPYYKA+KKLDIGGRFL G LKETLSFRHYN+MD
Sbjct: 164 RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD 223

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVNNIKE+CLF+SPVSYF+SF+ K+    EYVLPDFQTSF GYV+  +++   +PED
Sbjct: 224 ETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPED 280

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q I L DELF+IPETFFHPEI+ + KPGIVE ILES+SMLPE +RPLMV N V TGGNF
Sbjct: 281 SQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNF 340

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEG-DCALFGWEVMSQFAKTDSYRKARVTREEY 419
           N+ NFA+RLA ELQRQ PTDW   VSVP   D ALFGW+ M QF++T +Y++ RVTREEY
Sbjct: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400

Query: 420 YEHGPDWCTKHRFGYQNWI 438
           YEHG DWCTK RFGYQ W+
Sbjct: 401 YEHGVDWCTKQRFGYQKWL 419

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/438 (61%), Positives = 335/438 (76%), Gaps = 19/438 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  P++IDNGSYEIKFG  + K+P RALN++AKDK+G  +LSN +++IKDISS+ F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE+ IWDYCLFNP +F+G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEYEF+++FK+PV VFVPF    K     ++                       ++    
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVA----------------KEDSEVEESEVAP 164

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y+DFQLVIDSGFNC+WI+PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 165 AKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           ETILVN+IKE CLF+SP +YF+SF+++ K A EYVLPDF TSF GY+R P +    LP +
Sbjct: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAE 281

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q I L DELF +PETFFHPEI+ +   GIVE ILES+SMLPE +RPLMVGNIV TGGNF
Sbjct: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420
           N+PNFA RLA ELQRQ PTDW+C VS+P+GD  L+GW+ M +F++T+ Y ++RVTR+EYY
Sbjct: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCT  RFGYQ W+
Sbjct: 402 EHGVDWCTAKRFGYQAWL 419

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/437 (62%), Positives = 328/437 (75%), Gaps = 18/437 (4%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64
           P VIDNGSYEIKFG +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEEY 123
           QL  WELE CIWDYCL+NP EFDGF L +  +   L+ +E+C TLPELSK++DQV+FEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFDSLFKSPVAVFVPFTKSYKGE-MRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDSGS 182
           EF ++FKSP + F+PF      + M  + GKD  ++                     +  
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVN---------------TDYTTATTK 167

Query: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242
           +Y DFQLVIDSGFNCTW++P++KG+P+YKA+KK+DIGGRFL GLLKETLSFRHYNMMDET
Sbjct: 168 EYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDET 227

Query: 243 ILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQ 302
           IL+NNIKE+CLFVSPVSYFDSFKTK + A+EYVLPDFQTSFLGY+ +            Q
Sbjct: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 303 IITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
            ITLTDE F +PETFFHPE++ I KPG+VE ILE++SM+PE +RP++V NIVC GGNF L
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSVP-EGDCALFGWEVMSQFAKTDSYRKARVTREEYYE 421
           P+ + RL +ELQRQLPTDWTC V+VP   DC L  W  M+QF+ TD Y+  RVTREEY E
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407

Query: 422 HGPDWCTKHRFGYQNWI 438
           HG DWC+KHRF YQNWI
Sbjct: 408 HGTDWCSKHRFTYQNWI 424

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/436 (61%), Positives = 330/436 (75%), Gaps = 30/436 (6%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64
           PI+IDNGSYEIKFGPS+ K P+RALN LA+DK+G  +LSN +K I+++S+   RRP ELG
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124
           QL  WELE  IWDYCLFN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FDSLFKSPVAVFVPF--TKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDSGS 182
           F SL K PVA ++PF     YK     + G D  + +VR                     
Sbjct: 123 FGSLMKCPVAQYIPFDNMADYK-----VYGSD-GLPVVR------------------KKD 158

Query: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242
           DY+DFQLV+DSGFNCTW+IPV+KG+PYYKAVKKLDIGGRFLTGLLKET+SFRHYN+MDET
Sbjct: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218

Query: 243 ILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQ 302
           IL NNIKEQC F+ PVSYFDSF+ K +  ++YVLPDFQTS +GYVR P++    +PED+Q
Sbjct: 219 ILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ---AIPEDSQ 275

Query: 303 IITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
            + L DELFTIPETFFHPEI+ I KPG++E +LES+SMLPE++RPLMV NI   GGNFN+
Sbjct: 276 TLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNI 335

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEH 422
            NFA RLA ELQRQ PTDW+  V +P+GD  L GW+ M +F+ TDSY++ RVTR EY EH
Sbjct: 336 SNFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEH 395

Query: 423 GPDWCTKHRFGYQNWI 438
           G DWCTK+RFGY+ WI
Sbjct: 396 GVDWCTKYRFGYEQWI 411

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/434 (60%), Positives = 327/434 (75%), Gaps = 27/434 (6%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64
           P++++NGSYEIKFGP+  + P+RA N L +D++G  +LSN +  I+DIS    RRP ELG
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124
           QL  WELE  IWDYCLFNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDSGSDY 184
           F S+ K PVA FVPF ++             D DIV G                ++ S Y
Sbjct: 123 FGSMMKCPVAQFVPFDRA------------RDYDIVGGA-----------GEVVEAKSGY 159

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244
           ++FQLV+DSGFNCTW++PV+KG+PYYKA KKLDIGGRFL GLLKET+SFRHYN+MDETIL
Sbjct: 160 NNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETIL 219

Query: 245 VNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQII 304
           +NNIKEQC F+ PVSYFDSF+ K++  +EY+LPDFQTS +GYVR P++    +P+ +QI+
Sbjct: 220 INNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQIL 276

Query: 305 TLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPN 364
            L DELFT+PETFFHPEIS I KPG+VE ILE +SM+PE++RPL+V NIV  GGNFN+ N
Sbjct: 277 RLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIAN 336

Query: 365 FAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGP 424
           FA RLA ELQRQ PTDW   V  P+ D AL GW+ M QF++TDSY+ +RVTR EY EHG 
Sbjct: 337 FATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGA 396

Query: 425 DWCTKHRFGYQNWI 438
           DWCTKHRFGY+ WI
Sbjct: 397 DWCTKHRFGYEQWI 410

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/442 (60%), Positives = 319/442 (72%), Gaps = 31/442 (7%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M  P +VIDNGSYEIKFG S   +P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117
           HELGQL  WELES +WDYC +N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNA 177
           VIFEEY+F S+FK PVA ++PF +    +    + +D+                      
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDK---------------------- 157

Query: 178 QDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
               S Y DFQLVIDSGFNCTW +P++KG+PYYKA+KKLDIGGRFLTGLL+ET+SFRHYN
Sbjct: 158 --KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215

Query: 238 MMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297
           +M+ETILVNNIKEQC FV P SYF SF  K    +EYVLPDFQTSFLGYV+ P KE   L
Sbjct: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK--L 273

Query: 298 PEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
            +DAQ + LTDE+F++PETFFHPEI+QI KPGIVE ILE ++M PE+VRPL+V NIVCTG
Sbjct: 274 TDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333

Query: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVP-EGDCALFGWEVMSQFAKTDSYRKARVTR 416
           GNFN+PNF +RL  ELQRQ P DW+C V  P E D +L GWE M  FA +D +R ARVTR
Sbjct: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393

Query: 417 EEYYEHGPDWCTKHRFGYQNWI 438
           EEY EHG DWCTK+RFGYQ W+
Sbjct: 394 EEYLEHGLDWCTKNRFGYQQWL 415

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/440 (56%), Positives = 323/440 (73%), Gaps = 21/440 (4%)

Query: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M   P++IDNGSYEIKFG S  + PF ALNALAKDK+ T YLSN I NIKDISS++ +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELE  IWDYC +N  +F GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDS 180
           EEY FDSL+K+P A F+PF K+       +SGK +    + G                  
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSK--TYLDGSKE--------------- 163

Query: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            ++Y DF LVIDSG+NC+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 164 -NNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222

Query: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300
           E++LVNNIKE C+F+SPVSY +SFK K    +EYVLPDFQTSF+GYVR+ +K +  LPE 
Sbjct: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST-LPEH 281

Query: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q I L DELF++PE FFHPE++ + KPGI+E ILESL +LPE +R LMV NIVCTGGNF
Sbjct: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDS--YRKARVTREE 418
           N+PNF  R+  ELQ+Q+ T+W C VS+P+ +  L  W+ M  F + +   Y+  RVT++E
Sbjct: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401

Query: 419 YYEHGPDWCTKHRFGYQNWI 438
           Y EHG +W TK RFGYQNW+
Sbjct: 402 YNEHGFEWTTKQRFGYQNWL 421

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMEVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 106/438 (24%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP I  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 175/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAS 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG+   P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 104/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   G+ +    S+      VR 
Sbjct: 232 QSSSVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 DLYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR +T  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 63

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 114

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 115 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 152

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR +T  L +
Sbjct: 153 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMK 192

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 193 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 232

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 233 QSSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRK 292

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 293 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 350

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 351 TTFQQMWISKQEYDESGP 368

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  101 bits (251), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 104/438 (23%), Positives = 173/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G      + ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/438 (23%), Positives = 174/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 NNREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR +T  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            L+ R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILAERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAS 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/438 (23%), Positives = 173/438 (39%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G      + ++D+ GR +T  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 232 QSSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRK 291

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 292 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 349

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 104/438 (23%), Positives = 180/438 (41%), Gaps = 89/438 (20%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +        Y+ +  ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDCYVGDEAQSKR 63

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 114

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 115 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 152

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G     A+ ++D+ GR +T  L +
Sbjct: 153 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMK 192

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+  +V+ + Y    +T             Q+S +   
Sbjct: 193 ILSERGYSFSTTAEREIVRDIKEKLCYVA-LDYDQEMQTAA-----------QSSAI--- 237

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
               +++  LP D Q+IT+ +E F  PE  FHP +  +   GI +    S+      VR 
Sbjct: 238 ----EKSYELP-DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRK 292

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKT 406
            + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  A  
Sbjct: 293 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASL 350

Query: 407 DSYRKARVTREEYYEHGP 424
            ++++  ++++EY E GP
Sbjct: 351 TTFQQMWISKQEYDESGP 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 158/389 (40%), Gaps = 77/389 (19%)

Query: 40  SYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH- 98
           SY+ +  ++ + I  +T R P E G +T W+    IW +  +N       +L+     H 
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 99  LVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDID 158
           ++ +E+ M      +   Q++FE +   + + S  AV   ++          SG+   I 
Sbjct: 88  VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI- 136

Query: 159 IVRGXXXXXXXXXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDI 218
                                          V+DSG   T ++P+  G     A+ ++D+
Sbjct: 137 -------------------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDL 165

Query: 219 GGRFLTGLLKETLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVL 276
            GR LT  L + LS R Y+     E  +V +IKE+                    L YV 
Sbjct: 166 AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVA 205

Query: 277 PDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
            DF+       ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    
Sbjct: 206 LDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYN 265

Query: 337 SLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALF 395
           S+      VR  + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++ 
Sbjct: 266 SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV- 324

Query: 396 GWEVMSQFAKTDSYRKARVTREEYYEHGP 424
            W   S  A   ++++  ++++EY E GP
Sbjct: 325 -WIGGSILASLTTFQQMWISKQEYDESGP 352

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 90/389 (23%), Positives = 157/389 (40%), Gaps = 77/389 (19%)

Query: 40  SYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH- 98
           SY+ +  ++ + I  +T R P E G +T W+    IW +  +N       +L+     H 
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 99  LVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDID 158
           ++ +E+ M      +   Q++FE +   + + S  AV   ++          SG+   I 
Sbjct: 88  VLLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTGI- 136

Query: 159 IVRGXXXXXXXXXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDI 218
                                          V+DSG   T ++P+  G      + ++D+
Sbjct: 137 -------------------------------VLDSGDGVTHVVPIYAGFSLPHGILRIDL 165

Query: 219 GGRFLTGLLKETLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVL 276
            GR +T  L + LS R Y+     E  +V +IKE+                    L YV 
Sbjct: 166 AGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVA 205

Query: 277 PDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
            DF+       ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    
Sbjct: 206 LDFEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYN 265

Query: 337 SLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALF 395
           S+      VR  + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++ 
Sbjct: 266 SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV- 324

Query: 396 GWEVMSQFAKTDSYRKARVTREEYYEHGP 424
            W   S  A   ++++  ++++EY E GP
Sbjct: 325 -WIGGSILASLTTFQQMWISKQEYDESGP 352

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 103/442 (23%), Positives = 171/442 (38%), Gaps = 88/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G S  +KP    +  +  +  +K       G +++ N  + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW Y +FN S      L+  + H ++ +E+ +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSY-VFNKS----LQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             +++FE +   +L+ S  AV      S     RT                         
Sbjct: 122 MCELLFESFNVPALYVSIQAVL-----SLYASGRTTG----------------------- 153

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DI GR    FL  LL++T
Sbjct: 154 --------------CVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKT 199

Query: 231 LSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNP 290
                 +  +  + V  IKE+  +V+          KD H  E            +  NP
Sbjct: 200 TGVSLLSSSEREV-VRIIKEKACYVA----------KDPHIEEQ----------NFSINP 238

Query: 291 RKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D + I L  E F  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 239 NYTKFKLP-DGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLF 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYR 410
            N++ +GG   LP F  RL +EL+    +     +  P  +     W   S  +   +++
Sbjct: 298 SNVLLSGGTSILPGFGDRLLSELKSLSDSQTKIKIFAPP-ERKYSTWIGGSILSGLSTFK 356

Query: 411 KARVTREEYYEHGPDWCTKHRF 432
           K  VTR E+ E     C   RF
Sbjct: 357 KLWVTRAEWEEAAD--CIHSRF 376

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 105/442 (23%), Positives = 170/442 (38%), Gaps = 88/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----------FRALNALAKDKFGTSYLSNHIKNIKDISS 54
           P+V+DNGS  IK G S  +KP           +    +A    G +++ N  + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +T W     +W Y +FN S      L+  + H  + +E+ +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGY-VFNKS----LQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             +++FE +   +L+ S  AV      S     RT                         
Sbjct: 150 MCELLFESFNVPALYVSVQAVL-----SLYASGRTTG----------------------- 181

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DI GR    FL  LL++T
Sbjct: 182 --------------CVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKT 227

Query: 231 LSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNP 290
                 +  +  I V  IKE+  FV          TKD    E   P           NP
Sbjct: 228 TGVSLLSSSEREI-VRTIKEKACFV----------TKDPKLEEQNFP----------MNP 266

Query: 291 RKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D + I L  E +  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 267 SFSKFKLP-DGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLY 325

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYR 410
            NI+ +GG   LP F  RL  EL+    +     +  P  +     W   S  +   +++
Sbjct: 326 SNILLSGGTSMLPGFGDRLLKELKSLSGSRTKIKIFAPP-ERKYSTWIGGSILSGLSTFK 384

Query: 411 KARVTREEYYEHGPDWCTKHRF 432
           K  VT+ E+ E  PD C   RF
Sbjct: 385 KLWVTKSEWEEF-PD-CIHSRF 404

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 87/384 (22%), Positives = 146/384 (38%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N +  +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     D   L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              +V+FE+Y+F  ++ +  AV   + +                                
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS----------------------------- 151

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                 SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 152 ------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPR 291
           R Y  N   +   V  IKE+  +VS     D+   ++   L                   
Sbjct: 199 RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTL------------------- 239

Query: 292 KENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
            EN  LP D ++I +  E F  PE  F P +  + +PG+ E +  ++      VR  +  
Sbjct: 240 VENYELP-DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYR 298

Query: 352 NIVCTGGNFNLPNFAQRLAAELQR 375
            IV +GG+   P    RL  EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 90/390 (23%), Positives = 146/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +    +
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERGTISTPLKDIMIGDEASEV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  FN        L    G  ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPV 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE Y+F  ++ +  AV   + +                            
Sbjct: 117 KNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L  EY LPD       
Sbjct: 195 LLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD------- 247

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                           +II +  E F  PE  F P++  +  PG+ E +  ++      V
Sbjct: 248 ---------------GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDV 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLERELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 105/462 (22%), Positives = 175/462 (37%), Gaps = 117/462 (25%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      +     ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERGSISTPLKDIMIGEEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W+    +WDY  +N  +F         G  ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L               
Sbjct: 195 LLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVL--------------- 239

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                EN  LP D ++I +  E F  PE  F P++  + +PGI E +  ++      +R 
Sbjct: 240 ----VENYELP-DGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRS 294

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCA-------------- 393
            +   IV +GG+   P    RL  EL +QL   W  +  +  GD A              
Sbjct: 295 SLYRAIVLSGGSSMYPGLPSRLEKEL-KQL---W--YTRILRGDAARLDKFKVKIEDPPR 348

Query: 394 ------LFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTK 429
                 + G  + S  A+ D      +T+EE++E GP    K
Sbjct: 349 RKHMVFIGGAVLASIMAEKD---HMWLTKEEWHESGPAAMAK 387

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 105/450 (23%), Positives = 179/450 (39%), Gaps = 104/450 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPF----------RALNALAKDKFGTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G S  ++P           +    +A    G  ++ N  + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW++ +F+ S      L   + H ++A+E+ +   +  + 
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNH-VFHKS----LQLNNIEEHPVLATEAPLNPLKNREA 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             +++FE +   +++ S  AV      S     RT                         
Sbjct: 124 MCEMLFETFNVPAVYVSIQAVL-----SLYASGRTTG----------------------- 155

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++D+ GR    FL  LL++T
Sbjct: 156 --------------CVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKT 201

Query: 231 LSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNP 290
                 +  +  I V  IKE+  +V+          +D       L + QT    Y   P
Sbjct: 202 TGVSLLSSSEREI-VRIIKEKACYVA----------RDP------LTEEQT----YHLTP 240

Query: 291 RKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D +++ L +E F  PE  F P++       I E   +S+S +   +RP ++
Sbjct: 241 TSTIFKLP-DGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALL 299

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFG--------WEVMSQ 402
            NIV +GG    P F  RL  EL+         ++S P+    +F         W   S 
Sbjct: 300 SNIVLSGGTTMFPGFGDRLLTELR---------NLSEPQTKIKIFAPPERKYSTWIGGSI 350

Query: 403 FAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
            +   +++K  VT+ E+ E+ PD C   RF
Sbjct: 351 LSGLSTFKKIWVTKSEWQEN-PD-CVHSRF 378

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/386 (23%), Positives = 148/386 (38%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKP-FRALNALAKDK-FGTSYLSNHIKNIKD 51
           PIV+D G+  +K G           PS   +P  RA      +K      + +   +++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPEL 111
              I++  P E G +  W     +WDY  FN  +     L    G  ++ +E  M   + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAFFNQMQ-----LPTTSGGKILLTEPPMNPVKN 118

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXX 171
            +   +V+FE+Y+F  ++ +  AV   + +                              
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS--------------------------- 151

Query: 172 XXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                   SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 152 --------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196

Query: 232 SFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRN 289
           S R Y  N   +   V  IKE+  +VS     D+   ++   L                 
Sbjct: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTL----------------- 239

Query: 290 PRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              EN  LP D +II +  E F  PE  F P +  + + GI E +  ++      VR  +
Sbjct: 240 --VENYELP-DGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 97/433 (22%), Positives = 162/433 (37%), Gaps = 86/433 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKF----------GTSYLSNHIKNIKDISS 54
           P+VIDNGS  +K G    +KP     +L  D              S++ N  + ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  + P E G ++ W+    +W + LF     D   L  G  H L+ +E+ +  PE +K 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILF-----DSLQLTSGMEHPLLITEAPLN-PESNKE 122

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
               +F    F++     + V +P   S     RT                         
Sbjct: 123 KMLEVF----FETFNIPAICVSIPGVLSLYASGRTTG----------------------- 155

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+D G      +PV +G     ++K++++GG  +T  L+  L   
Sbjct: 156 --------------CVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKE 201

Query: 235 HYNMM---DETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPR 291
               +    E  LV  +KE+  +VS     +  K ++K   E                P 
Sbjct: 202 SGVWLFSSGERELVRTMKEKSCYVS----LNQLKDEEKFTFE----------------PG 241

Query: 292 KENV--PLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
           K N    LP D  ++TL+   F  PE  F P+I    +P + E  L+S+  +   +RP +
Sbjct: 242 KMNTNFKLP-DGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRL 300

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSY 409
           +  I  +GG      F  R   ELQ          +  P  +     W   S  A   ++
Sbjct: 301 MSRITLSGGTTMFRGFGDRFLQELQISTCKKSNIRILAPP-ERKYTAWIGGSMLAGLTTF 359

Query: 410 RKARVTREEYYEH 422
           RK   T+ ++ EH
Sbjct: 360 RKMLTTKSDWREH 372

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/388 (22%), Positives = 147/388 (37%), Gaps = 88/388 (22%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASITTPLKDIMIGDEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  +     +   L    G  ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      K+LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L               
Sbjct: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTL--------------- 239

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                EN  LP D ++I +  E F  PE  F P +  + +PG+ E +  ++      VR 
Sbjct: 240 ----VENYELP-DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRT 294

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQR 375
            +   +V +GG+   P    RL  EL++
Sbjct: 295 ALYRAVVLSGGSSMYPGLPSRLEKELKQ 322

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 89/390 (22%), Positives = 147/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERANITTPLRDIMIGDEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  FN        L    G  ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L   Y LPD +T    
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT---- 250

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                             I +  E F  PE  F P +  + +PG+ E +  ++      V
Sbjct: 251 ------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDV 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSALYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 100/436 (22%), Positives = 168/436 (38%), Gaps = 91/436 (20%)

Query: 3   TPPIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFG--------TSYLSNHIKNIKDIS 53
           + P+V+DNGS  +K G S   +P F   + +   + G         +++ N  +  + I 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI- 68

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W     IWDY +F     D   LK+   H ++ +E+ +       
Sbjct: 69  -LQLRHPVDHGVVKNWNDMELIWDY-MFK----DKLKLKDVDEHPVLITEAPLNPVSNRD 122

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
               ++FE +   +L+ +  AV   +          ISG                     
Sbjct: 123 EMCDLLFESFGVQALYVANPAVLSLYASG------KISG--------------------- 155

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G   +  +PV +G     A+K++D+GGR LT  L+  L  
Sbjct: 156 ---------------CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQL 198

Query: 234 RHYNMMDETI-----LVNNIKEQCLFVSPVSYFDSFKTK---DKHALEYVLPDFQTSFLG 285
           R    +  T      LV  IKE+  +V+     +  K     D+  L++ LPD       
Sbjct: 199 RKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPD------- 251

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                           + ITL+ + F +PE  F P +       I E I +S+S L   +
Sbjct: 252 ---------------GKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAK 405
           RP M  +I+ +GG   L  F  RL  EL +         +  P  +     W   S  A+
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAPP-ERKYTSWIGGSILAE 355

Query: 406 TDSYRKARVTREEYYE 421
             +++K  VT+ ++ E
Sbjct: 356 LSTFQKIIVTKSQWQE 371

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 90/388 (23%), Positives = 149/388 (38%), Gaps = 88/388 (22%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   N+
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAGERSNISTPLKDIMIGDEASNV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  +     D   +    GH ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWADMEQLWDYAFY-----DQMKIPSTAGHKVLLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y  N   +   V  IKE+  +VS   Y     TK  H         +T+ L   
Sbjct: 195 LLSRRGYAFNKTADFETVRQIKEKLCYVS---YDLDLDTKLAH---------ETTTL--- 239

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                E   LP D ++I +  E F  PE  F P +  + + GI E +  ++      +  
Sbjct: 240 ----VETYELP-DGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIIS 294

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQR 375
            +   IV +GG+   P    RL  EL++
Sbjct: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/386 (23%), Positives = 146/386 (37%), Gaps = 82/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP---FRALNALAKDKFGTSYLSNHIKNIKDI--------- 52
           PIV+D G+  +K G +    P   F ++      +       +    IKDI         
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDV 65

Query: 53  -SSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPEL 111
            S +    P E G +  W     +WD+  F     +   L    G  ++ +E  M   + 
Sbjct: 66  RSYLQISYPMENGIIKHWTDMELLWDHAFF-----EKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXX 171
            +   QV+FE+Y+F  ++ +  AV   + +                              
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLS--------------------------- 153

Query: 172 XXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                   SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 154 --------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 198

Query: 232 SFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRN 289
           S R Y  N   +   V  IKE+  +VS    FD+   ++   L                 
Sbjct: 199 SRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTTL----------------- 241

Query: 290 PRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              EN  LP D +II +  E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 242 --VENYELP-DGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSL 298

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 299 YKAIVLSGGSSMYPGLPSRLEKELKQ 324

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S L  ++R PR  +         + L  E   +PE  F P +  + + GI+E I E
Sbjct: 577 DWRNSTLHLFLRGPRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICE 635

Query: 337 S--------LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           +               +   +  N+  TGGN  LP   +R+  E +  LP     +V + 
Sbjct: 636 TNFLKKFGSSRSELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA 695

Query: 389 EGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFG 433
             DCAL  W  M++ ++TDS +R   VTR+EY+E+GPD+  +H  G
Sbjct: 696 -NDCALDAWRGMAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETLSFRHYNMMDETIL 244
           LVI SG   T IIPV+ G       K+++ GGR    +L+ LL   L + ++ +   T  
Sbjct: 183 LVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 245 VNNIKEQCLFVSP 257
              + ++  +VSP
Sbjct: 241 FKALYDEFCYVSP 253

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 122/318 (38%), Gaps = 69/318 (21%)

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY  +     D   L    G  ++ +E  M   +  +   +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQD 179
           FE+Y+F  ++ +  AV   + +                                      
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQGLS----------------------------------- 97

Query: 180 SGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--N 237
           SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS R Y  N
Sbjct: 98  SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297
              +   V  IKE+  +VS     D+   ++   L                    EN  L
Sbjct: 151 RSADFETVRQIKEKLSYVSYDLDLDTKLARETTTL-------------------VENYEL 191

Query: 298 PEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
           P D ++I +  E F  PE  F P +  + +PG+ E +  ++      VR  +   IV +G
Sbjct: 192 P-DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250

Query: 358 GNFNLPNFAQRLAAELQR 375
           G+   P    RL  EL++
Sbjct: 251 GSSMYPGLPSRLEKELKQ 268

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 86/388 (22%), Positives = 146/388 (37%), Gaps = 88/388 (22%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPI--LRAEERANVSTPLKDIMIGDEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  F     D   L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFF-----DQMKLPTTSNGKILLTEPPMNPV 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L               
Sbjct: 195 LLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTL--------------- 239

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                EN  LP D ++I +  E F  PE  F P +  + + G+ E +  ++      +R 
Sbjct: 240 ----VENYELP-DGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRS 294

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQR 375
            +   IV +GG+   P    RL  EL++
Sbjct: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 85/384 (22%), Positives = 143/384 (37%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKN-IKDI----------S 53
           PIV+D G+  +K G +    P     ++       +    H    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L    G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAFF-----EQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              +V+FE+Y+F   + +  AV   + +                                
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLS----------------------------- 151

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                 SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 152 ------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPR 291
           R Y  N   +   V  IKE+  +VS     D+   ++   L                   
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL------------------- 239

Query: 292 KENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
            E+  LP D ++I +  E F  PE  F P +  + +PG+ E +  ++      +R  +  
Sbjct: 240 VESYELP-DGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYK 298

Query: 352 NIVCTGGNFNLPNFAQRLAAELQR 375
            IV +GG+   P    RL  EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/386 (21%), Positives = 143/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     +   L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              +V+FE+Y+F  ++    AV   + +                                
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLS----------------------------- 151

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                 SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 152 ------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLGYVRN 289
           R Y  N   +   V  IKE+  +VS     D+   ++   L  +Y LPD           
Sbjct: 199 RGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD----------- 247

Query: 290 PRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
                       ++I +  E F  PE  F P +  + +PGI E +  ++      +   +
Sbjct: 248 -----------GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 146/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +    +
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVATPLKDIMIGDEASEV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  F     +   L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++  AL   Y LPD +T    
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRT---- 250

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                             I +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 251 ------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 93/438 (21%), Positives = 170/438 (38%), Gaps = 80/438 (18%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP---------FRALNALAKDKF-GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G     KP             + +   +F G +++ N  + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +T W     +W +         G  L   + H ++ +E+ +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             +++FE +   +++ S  AV      S     RT                         
Sbjct: 125 MCELLFETFSVPAVYVSIQAVL-----SLYASGRTTG----------------------- 156

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+DSG  C+  +PV  G     A++++DI GR ++ LL+  +   
Sbjct: 157 --------------CVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIR-- 200

Query: 235 HYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKEN 294
                  ++L ++ +E    +   + + +   K++    Y +   QT F    R P    
Sbjct: 201 --KSTGVSLLSSSEREIVRIIKEKACYIALDPKEEEK-NYTMHGKQTMF----RLP---- 249

Query: 295 VPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIV 354
                D + I L +E F  PE  F+P++       + E + ES+  +   +R  +  NIV
Sbjct: 250 -----DGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIV 304

Query: 355 CTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARV 414
            +GG   +P F  R+  EL+          +  P  +     W   S  +   +++K  V
Sbjct: 305 FSGGTTMIPGFGDRVLKELKLSCEPQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWV 363

Query: 415 TREEYYEHGPDWCTKHRF 432
           T++E+ E+    C   RF
Sbjct: 364 TKKEWEEN--PRCVHARF 379

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 86/386 (22%), Positives = 145/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              +V+FE+Y+F  ++ +  AV   + +                                
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS----------------------------- 151

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                 SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 152 ------SG-------VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLGYVRN 289
           R Y  N   +   V  IKE+  +VS     D+   ++   L   Y LPD +T        
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT-------- 250

Query: 290 PRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
                         I +  E F  PE  F P +  + +PG+ E + +++      VR  +
Sbjct: 251 --------------IKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSAL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 147/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVTTPLKDIMIGDEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  F     +   L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++  AL   Y LPD +T    
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRT---- 250

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                             I +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 251 ------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 10/169 (5%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S L  ++R PR  +     +   + L  E   +PE FF P +    + G+ E    
Sbjct: 580 DWRNSTLHLFLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCER 639

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L      P  +  +   M  N+  TGGN  +P   +R+  E    LP + + +V++  
Sbjct: 640 VLLSKFGASPRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNIS- 698

Query: 390 GDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFGYQNW 437
            D +L  W  M+++A+ ++ Y+K+ ++++EY E+GPD+  +H+ G  N+
Sbjct: 699 SDPSLDAWRGMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 145/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +    +
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASISTPLKDIMIGDEASEV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  +     +   L    G  ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L  +Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD------- 247

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                           +II +  E F  PE  F P +  +   G+ E +  ++      V
Sbjct: 248 ---------------GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDV 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 147/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVTTPLKDIMIGDEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  F     +   L+      ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFF-----EQMKLQSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L   Y LPD +T    
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT---- 250

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                             I +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 251 ------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 146/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVATPLKDIMIGDEASDV 63

Query: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109
           +    I++  P E G +  W     +WDY  F     +   L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
           +  +   +V+FE+Y+F  ++ +  AV   + +                            
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------------------------- 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                     SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L +
Sbjct: 152 ----------SG-------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKE+  +VS     D+   ++   L   Y LPD +T    
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPDGRT---- 250

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                             I +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 251 ------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (48%), Gaps = 14/172 (8%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S L  ++R PR  +     +   + L  E   +PE  F P I  + + GIVE + E
Sbjct: 577 DWRNSVLHLFLRGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCE 635

Query: 337 SLSM---------LPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
           +L +         L EI + +M  NI  TGGN  LP   +R+  E    LP     +V +
Sbjct: 636 TLLLKKFGSNRRELSEISK-MMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKL 694

Query: 388 PEGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFGYQNWI 438
            E D ++  W  M++FA   S Y  + +T++EY E GP++  +H  G   ++
Sbjct: 695 AE-DPSMSAWRGMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 84/185 (45%), Gaps = 13/185 (7%)

Query: 258 VSYFDSFKTKDKHALEYVLPDFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPET 316
           + Y  +F  +D    +Y   D++ S L  ++R PR  +         + L  E   +PE 
Sbjct: 564 LEYDPTFTEEDTLDAQY---DWRNSTLHLFLRGPRPHDSEDVHQQHQLHLNTERIRVPEI 620

Query: 317 FFHPEISQITKPGIVE----AILESLSMLP---EIVRPLMVGNIVCTGGNFNLPNFAQRL 369
            F P I+   + GI E     +L+     P         MV N+  TGGN  +P    R+
Sbjct: 621 LFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWITGGNARIPGIKNRI 680

Query: 370 AAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCT 428
             E    LP      V + E D +L  W+ M++ A  ++ Y+   VTR+EY E+GPD+  
Sbjct: 681 VKEFTEFLPAGTPLSVHMSE-DPSLDAWKGMAKLANNETDYKNTAVTRKEYEEYGPDYIK 739

Query: 429 KHRFG 433
           +H+ G
Sbjct: 740 EHKLG 744

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S L  ++R PR  +     +   + L  E   +PE  F P +  + + GI+E + E
Sbjct: 578 DWRNSTLHLFLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSE 636

Query: 337 SLSMLP--------EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           ++ M            V   M  N+  TGGN  +P    R+  E    LP     ++ V 
Sbjct: 637 TIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA 696

Query: 389 EGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFG 433
             D A+  W+ M++FA++ + Y+ + VT++EY E+GPD+  +H+ G
Sbjct: 697 -SDPAIDAWKGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 89/430 (20%), Positives = 173/430 (40%), Gaps = 82/430 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP--FRALNALAKDKFG---------TSYLSNHIKNIKDIS 53
           P+VIDNG+  +K G   + KP  F+  N +   KF            Y+ N  +  + + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQH-NIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL- 67

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P E G++  W+    +W + L +       +++  + H ++ +E+ +   +  +
Sbjct: 68  -LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNRE 121

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
           H  +++FE +   ++     AV   ++       RT                        
Sbjct: 122 HMCEILFESFNIPAIHVENPAVLALYSGG-----RTTG---------------------- 154

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           VID G      +P+ +G     +++++DIGGR +T    E L F
Sbjct: 155 ---------------CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQF 195

Query: 234 RHYNMMDETILVNNIKEQCLFVSP-VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRK 292
           +    +  ++  +N KE    +     Y     +K++H  +Y+L D ++       N  K
Sbjct: 196 QIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEH--KYIL-DSES-------NSSK 245

Query: 293 ENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGN 352
             +P   D + +++ +  F   E  F+P +       + E + ++LS +   +RP++  +
Sbjct: 246 FKLP---DGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKS 302

Query: 353 IVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPEGDCALFGWEVMSQFAKTDSYRK 411
           +V  GG   LP F  R+  ELQ     D     ++ PE       W   S  A   +++K
Sbjct: 303 LVLNGGTTVLPGFGNRILKELQILTKQDTKLRIIASPERKYTT--WIGGSILAGLSTFQK 360

Query: 412 ARVTREEYYE 421
             VT+  + E
Sbjct: 361 ILVTKSNWNE 370

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 85/180 (47%), Gaps = 14/180 (7%)

Query: 263 SFKTKDKHALEYVLPDFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPE 321
           SF  +D    +Y   D++ S L  ++R PR  N         + L  E    PE  F P 
Sbjct: 567 SFTEEDTLDAQY---DWRNSVLHLFLRGPRPHNGEDVHQQHQLHLNIERIRAPEVIFQPS 623

Query: 322 ISQITKPGIVE---AIL-----ESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373
           +  + + GI E    IL        S L +     M  NI  TGGN  +PN  +R+  E 
Sbjct: 624 MGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD-MASNIFITGGNTKIPNLRERIVNEF 682

Query: 374 QRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRFG 433
              LP +   +V+  + + +L  W+ M++FA++D+Y    VT+ EY E GP++  +H+ G
Sbjct: 683 TGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           L+I+SG   T IIPV+KG       K++D GG      LK  LS ++
Sbjct: 186 LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 95/447 (21%), Positives = 165/447 (36%), Gaps = 94/447 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFGTSYLSNHIKN----------IKDIS 53
           P+V+DNGS  IK G S   KP     N +   K+    L+N I N           K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    +W +   +  + + FD      H L+ +E+ +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNRD 124

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              +V FE+++F +++     +  P T S     RT                        
Sbjct: 125 KMCEVFFEKFDFAAVY-----IANPSTLSLYASGRTTG---------------------- 157

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G      +P+ +G     +++++D+GGR +T  L+     
Sbjct: 158 ---------------CVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQI 200

Query: 234 RHYNMMD-----ETILVNNIKEQCLFVSPVSYFD---SFKTKDKHALEYVLPDFQTSFLG 285
           R Y  +      E  +V N+KE+  +VS     D   S    +K   ++ LPD +   L 
Sbjct: 201 RKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPDGKDLILD 260

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
             R                      F  PE  F P+I  +    + +   ES+S +   +
Sbjct: 261 KAR----------------------FRAPEILFRPQIMGLEYDSVSDMCFESISKVDLEL 298

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAK 405
           RP +  +I+  GG+     F  RL  ELQ +        +  P  +     W   S    
Sbjct: 299 RPKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAPP-ERKYTSWIGGSILTG 357

Query: 406 TDSYRKARVTREEYYEHGPDWCTKHRF 432
             ++++  +T+ E+ E   D   ++RF
Sbjct: 358 LSTFKQLWMTKAEWQE---DNNLRYRF 381

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 80/165 (48%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S L  ++R PR  +     +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L+     P  +      MV N++ TGGN  +P   +R+  E    LPT     V++  
Sbjct: 645 ILLKKFGSQPGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMS- 703

Query: 390 GDCALFGWEVMSQFAKTD-SYRKARVTREEYYEHGPDWCTKHRFG 433
            D +L  W+ M+  A+ +  YRK  ++++EY E+GP++  +H+ G
Sbjct: 704 SDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 9/164 (5%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S L  ++R PR  +     +   + L  E   +PE  F P +    + G+ E    
Sbjct: 581 DWRNSILHLFLRGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCET 640

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L+     P  +      M  NI  +GGN  +P    R+  E    LP      V++  
Sbjct: 641 ILLKKFGSSPNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMS- 699

Query: 390 GDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRFG 433
            D  L  W+ M+++AK++ Y K+ +T++EY E+GP++  +H+ G
Sbjct: 700 SDPLLDSWKGMAKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 132/351 (37%), Gaps = 86/351 (24%)

Query: 2   ETPPIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E   +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLP 109
            I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M   
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXX 169
              +   Q++FE +   + + S  AV   ++          SG+   I            
Sbjct: 114 SNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTGI------------ 151

Query: 170 XXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKE 229
                               V+DSG   T ++P+  G      + ++D+ GR LT  L +
Sbjct: 152 --------------------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMK 191

Query: 230 TLSFRHYNM--MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
            LS R Y+     E  +V +IKE+                    L YV  DF+       
Sbjct: 192 ILSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAA 231

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESL 338
           ++   E      D Q+IT+ +E F  PE  FHP +  +   GI +    S+
Sbjct: 232 QSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 145/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNKKP-FRA-----LNALAKDKFGTSYLSNHIK 47
           PIV+D G+  +K G           PS   +P  RA     LN   KD      +     
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVM----IGEEAS 61

Query: 48  NIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMT 107
            ++    I++  P E G +  W     +WDY  +     +   L    G  ++ +E  + 
Sbjct: 62  AVRSYLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLN 114

Query: 108 LPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXX 167
             +  +   +V+FE+Y+F  ++ +  AV   + +                          
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS----------------------- 151

Query: 168 XXXXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLL 227
                       SG       +VIDSG   T I+PV + +      ++LD+ GR +T  L
Sbjct: 152 ------------SG-------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192

Query: 228 KETLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLG 285
            + LS R Y  N   +   V  IKE+  +VS     D+   ++   L             
Sbjct: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL------------- 239

Query: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                  EN  LP D ++I +  E F   E  F P +  +   G+ E +  ++      V
Sbjct: 240 ------VENYELP-DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDV 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    R+  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRIEKELKQ 322

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S L  ++R PR  +         I L  E   +PE  F P +  + + GI E    
Sbjct: 584 DWRNSTLHLFLRGPRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSET 643

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L      P+ +  L   M  NI  TGGN  +P   +R+  E +  LP +   +V++  
Sbjct: 644 ILLRKFGSEPKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT- 702

Query: 390 GDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFG 433
            D     W  M++ A+ ++ Y+K  ++++EY E+GP++  +H+ G
Sbjct: 703 SDPTFDAWNGMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 78/165 (47%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEA--- 333
           D++ S L  ++R PR  +   P     I +  E   +PE  F P I    + GI E    
Sbjct: 590 DWRNSVLHLFLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSET 649

Query: 334 -ILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
             L   +  P  +  +   M+ N+  TGG+  LP   +R+  E    LP      +++  
Sbjct: 650 LFLRKFNSSPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-S 708

Query: 390 GDCALFGWEVMSQFA-KTDSYRKARVTREEYYEHGPDWCTKHRFG 433
            D +L  W+ M++ A  TD  +K +VT+++Y E+GP++  +H  G
Sbjct: 709 NDPSLDTWKGMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 85/237 (35%), Gaps = 48/237 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRAL-NALAKDK----FGTSYLSNHIKNIKDISSITFRR 59
           PI ID GSY +K G +    P     N L + +      T     +  N+     I  +R
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPLRIQAKR 97

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGK-GHHLVASESCMTLPELSKHADQV 118
           P++   +  WE    I+DY L +     G     G   + ++ +E    L     +  Q+
Sbjct: 98  PYDGLFIANWEYAEEIFDYTLHHL----GVQTTNGSISNPIILTEKMACLQSQRANWYQL 153

Query: 119 IFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQ 178
           +FE       F  P A F                    +D +                  
Sbjct: 154 LFE------TFDVPSATF-------------------GLDSLYAFY-------------N 175

Query: 179 DSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           +  + +    LVI+ G   T I+P+++G       K+++ GGR  T  L   L+ ++
Sbjct: 176 NCANPFESDGLVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 103/448 (22%), Positives = 169/448 (37%), Gaps = 110/448 (24%)

Query: 17  FGPSTNKKPFRALNA---LAKD---KFGTS----YLSNHIKNIKDISSITFRRPHELGQL 66
           FG ST+   F +LNA   L+ +   K GT     Y+ N         S +   P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 122 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 175

Query: 127 SLFKSPVAVFVPFTK--SYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDSGSDY 184
            L+ +  AV        S K   R+++G                                
Sbjct: 176 GLYIAVQAVLALAASWTSSKVTDRSLTGT------------------------------- 204

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244
                VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D    
Sbjct: 205 -----VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDT--- 254

Query: 245 VNNIKEQCLFVSPVSYFDSFKTKDKHALE--YVLPDFQTSFLGYVRNPRKENVPLPEDAQ 302
                             S +T ++   E  YV PD    F  + RNP K    + E+ +
Sbjct: 255 ------------------SLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQE 296

Query: 303 -----IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNI 353
                I+ +  E F  PE FF+PEI+        P IV+  +++    P  VR  +  NI
Sbjct: 297 KTQKKIVDVGYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYNNI 353

Query: 354 VCTGGNFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGW 397
           V +GG+    +F +RL  +++                +    D        + +   FG 
Sbjct: 354 VLSGGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGG 413

Query: 398 EVMSQFAKTDSYRKARVTREEYYEHGPD 425
            +++Q A+  SY     T+++Y E+GP+
Sbjct: 414 SLLAQTAEFKSYCH---TKKDYEEYGPE 438

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 78/166 (46%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S L  ++R PR  +     +   + L  E   +PE  F P +    + GI E + E
Sbjct: 585 DWRNSLLHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSE 643

Query: 337 SLSMLP--------EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           ++ M                MV NI+ TGGN  +P   +R+  E    LP      V++ 
Sbjct: 644 TILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS 703

Query: 389 EGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFG 433
             + +L  W  M+  A+  + Y+K  +++EEY E+GPD+  +H+ G
Sbjct: 704 -SNPSLDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 82/167 (49%), Gaps = 14/167 (8%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S L  ++R PR  +     +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLP--TDWTCHVSV 387
            +L+     P  +      MV N+  TGGN  +P   +R+  E    LP  T+++ ++S 
Sbjct: 645 ILLKKFGSQPGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS- 703

Query: 388 PEGDCALFGWEVMSQFAKT-DSYRKARVTREEYYEHGPDWCTKHRFG 433
              D +L  W+ M+  A+  + Y+K  ++++EY E+GPD+  +H+ G
Sbjct: 704 --SDPSLDAWKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 123/325 (37%), Gaps = 69/325 (21%)

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY  +   +    D   GK   ++ +E  M   +  
Sbjct: 11  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLP--DTSNGK---ILLTEPPMNPIKNR 65

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXX 172
           +   +V+FE+Y F  ++ +  AV   + +                               
Sbjct: 66  EKMCEVMFEKYNFGGVYVAIQAVLALYAQGLS---------------------------- 97

Query: 173 XXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                  SG       +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 98  -------SG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLS 143

Query: 233 FRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNP 290
            R Y  N   +   V  IKE+  +VS     D+   ++   L                  
Sbjct: 144 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL------------------ 185

Query: 291 RKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
             E+  LP D ++I +  E F  PE  F P +  + + G+ E +  ++      +R  + 
Sbjct: 186 -VESYELP-DGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLF 243

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQR 375
             IV +GG+   P    RL  EL++
Sbjct: 244 KAIVLSGGSSMYPGLPSRLEKELKQ 268

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 84/186 (45%), Gaps = 15/186 (8%)

Query: 258 VSYFDSFKTKDKHALEYVLPDFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPET 316
           + Y  +F  +D    +Y   D++ S L  ++R PR  +     +   + L  E   +PE 
Sbjct: 560 LEYDPNFTEEDTLDAQY---DWRNSTLHLFLRGPRPHDSENINEQHQMHLNVERIRVPEV 616

Query: 317 FFHPEISQITKPGIVE--------AILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQR 368
            F P ++ + + G+ E            + S L E  + L   N+  TGGN  LP   +R
Sbjct: 617 IFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKL-AANVFLTGGNMRLPGVRER 675

Query: 369 LAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWC 427
           +  E    LP     +V +   D A+  W  M++ ++  S Y+ + +TR+EY E G D+ 
Sbjct: 676 IVREFTGMLPMGSNLNVRMA-SDSAVDAWRGMAKLSQAGSQYKGSYITRKEYQELGADYI 734

Query: 428 TKHRFG 433
            +H  G
Sbjct: 735 KEHNLG 740

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETLSFRHYNMMDETIL 244
           LVI+SG   T +IPV+ G       K+++ GGR    +L+ LL   L + ++ +   T  
Sbjct: 183 LVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 245 VNNIKEQCLFVSPVSYFDSFK 265
             ++ E   +VS V Y D  +
Sbjct: 241 FQSLYEDFCYVS-VDYQDEIR 260

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 114/258 (44%), Gaps = 46/258 (17%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F    +   ++++ + +       R  +K          ++ +
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE-------RTTKK----------VVDV 312

Query: 307 TDELFTIPETFFHPEISQ---ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
             E F  PE FF+PEI+    +T   +V  + E++   P  VR  +  NIV +GG+    
Sbjct: 313 GYERFLAPEIFFNPEIASSDFLTPLPVV--VDETIQACPIDVRKGLYNNIVLSGGSTMFK 370

Query: 364 NFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTD 407
           +F +RL  +L+                R    D +      + +   FG  +++Q  +  
Sbjct: 371 DFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSLLAQTGEFK 430

Query: 408 SYRKARVTREEYYEHGPD 425
           SY     T+++Y E+GPD
Sbjct: 431 SYCH---TKQDYEEYGPD 445

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/384 (22%), Positives = 152/384 (39%), Gaps = 81/384 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFR---ALNALAK-DKFGTS--------YLSNHIKNIKDI 52
           PIVIDNGS  IK G S   KP      L  + K DK   +        Y+ N  ++I+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELS 112
             +  + P   G +  W+    +W + +FN    D  +++  + H L+ +E+ +T+ +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXX 172
               + +FE +   SL+ +  +V   +                                 
Sbjct: 124 HIMCERLFETFNIPSLYVANPSVLSLYA-------------------------------- 151

Query: 173 XXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
              +   +G        V+D G       P+ +G     +++K+++GGR +T    E L 
Sbjct: 152 ---SGNTTGC-------VVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDIT----EHLQ 197

Query: 233 FRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV--RNP 290
           F+       ++  +N KE    +             K  + Y+  DF  S   Y   ++ 
Sbjct: 198 FQIRKSSGISLYSSNEKEIVRTI-------------KEKVCYISEDFNKSEESYYLRQDE 244

Query: 291 RKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D + +TL  E F  PE  F+P++  +    +     ES+S +   +RP + 
Sbjct: 245 MSCKFKLP-DGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLF 303

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQ 374
            NI+ TGG+     F  RL  +LQ
Sbjct: 304 SNILLTGGSTLFKGFGSRLLGDLQ 327

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S L  ++R PR  +     +   + +  E   +PE  F P I  + + G+VE + E
Sbjct: 582 DWRNSTLHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVE-LCE 640

Query: 337 S--LSMLPEIVRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           +  L       R L      M  N+  TGGN  LP   +R+  E    LP      V++ 
Sbjct: 641 TVLLKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLA 700

Query: 389 EGDCALFGWEVMSQFAKT-DSYRKARVTREEYYEHGPDWCTKHRFG 433
           + D +L  W+ M++FA    SY+ + +T+ EY E+GP++  +H  G
Sbjct: 701 K-DPSLSAWKGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 112/259 (43%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 209 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERI 266

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F    +   +YV           V N  K         +++ +
Sbjct: 267 KQEYCYVCPDIVKEFNKFDRDPEKFAQYV-----------VENQEK------TQKKVVDV 309

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+   +++   P  VR  +  NIV +GG+   
Sbjct: 310 GYERFLAPEIFFNPEIASSDFLTPLPTIVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 366

Query: 363 PNFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMSQFAKT 406
            +F +RL  +L+                +    D +      + +   FG  +++Q A+ 
Sbjct: 367 KDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 426

Query: 407 DSYRKARVTREEYYEHGPD 425
            SY     T+++Y E+GP+
Sbjct: 427 KSYCH---TKKDYEEYGPE 442

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 78/165 (47%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S L  ++R PR  +     +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L+     P  +      M  N+  TGGN  +P   +R+  E    LP     ++++  
Sbjct: 645 ILLKKFGSQPGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMS- 703

Query: 390 GDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFG 433
            D +L  W+ M+  A+ +  Y++  ++R+EY E+GPD+  +H+ G
Sbjct: 704 SDPSLDAWKGMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 96/444 (21%), Positives = 169/444 (38%), Gaps = 102/444 (22%)

Query: 17  FGPSTNKKPFRALNALA------KDKFGTS----YLSNHIKNIKDISSITFRRPHELGQL 66
           FG ST+   F +L A A        K GT     Y+ N         S +   P   GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  TLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 129 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 182

Query: 127 SLFKSPVAVFVPFTK--SYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDSGSDY 184
            L+ +  AV        S K   R+++G                                
Sbjct: 183 GLYIAVQAVLALAASWTSSKVTDRSLTGT------------------------------- 211

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI- 243
                VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++ 
Sbjct: 212 -----VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLR 264

Query: 244 LVNNIKEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDA 301
               IK++  +V P  V  F+ F        ++++ + +++                   
Sbjct: 265 TAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST-----------------KK 307

Query: 302 QIITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
           +I+ +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +G
Sbjct: 308 KIVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSG 364

Query: 358 GNFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMS 401
           G+    +F +RL  +L+                +    D        + +   FG  +++
Sbjct: 365 GSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLA 424

Query: 402 QFAKTDSYRKARVTREEYYEHGPD 425
           Q A+  SY     T+++Y E+GP+
Sbjct: 425 QTAEFKSYCH---TKQDYEEYGPE 445

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 102/451 (22%), Positives = 179/451 (39%), Gaps = 102/451 (22%)

Query: 10  NGSYEIKFGPSTNKKPFRALNA---LAKD---KFGTSYLSNHIKNIKDISS----ITFRR 59
           N S    FG ST+   F  LN    L+ +   K GT  L  +I N   ++S     +   
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P   GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +   ++ 
Sbjct: 128 PIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIF 181

Query: 120 FEEYEFDSLFKSPVAVFVPFTK--SYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNA 177
           FE +    L+ +  AV        S K   R+++G                         
Sbjct: 182 FESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT------------------------ 217

Query: 178 QDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
                       VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R   
Sbjct: 218 ------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERG 263

Query: 238 MMDETI-LVNNIKEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKEN 294
            +D ++     IK++  +V P  V  F+ F        ++++ + + +        RK  
Sbjct: 264 EVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQEQT--------RK-- 313

Query: 295 VPLPEDAQIITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMV 350
                  +++ +  E F  PE FF+PEI+        P +V+  +++    P  VR  + 
Sbjct: 314 -------KVVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQA---CPIDVRKGLY 363

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQ----------RQLPTDWTCHVSV------PEGDCAL 394
            NIV +GG+    +F +RL  +L+           +L    +  V V       + +   
Sbjct: 364 NNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVW 423

Query: 395 FGWEVMSQFAKTDSYRKARVTREEYYEHGPD 425
           FG  +++Q A+  SY     T+++Y E+GP+
Sbjct: 424 FGGSLLAQTAEFKSYCH---TKKDYEEYGPE 451

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 115/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  +++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F        ++V+   + +        RK         +I+ +
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT--------RK---------KIVDV 310

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   E++   P  VR  +  NIV +GG+   
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---ETIQACPIDVRKGLYNNIVLSGGSTMF 367

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSV------PEGDCALFGWEVMSQFAKT 406
            +F +RL  +++            L    +  V V       + +   FG  +++Q A+ 
Sbjct: 368 KDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 427

Query: 407 DSYRKARVTREEYYEHGPD 425
            SY     T+++Y E+GP+
Sbjct: 428 KSYCH---TKKDYDEYGPE 443

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 111/263 (42%), Gaps = 56/263 (21%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D         
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADS-------- 263

Query: 250 EQCLFVSPVSYFDSFKTKDKHALE--YVLPDFQTSFLGYVRNPRKENVPLPED-----AQ 302
                        S KT ++   E  YV PD    F  + R P K    + E+      +
Sbjct: 264 -------------SLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKTTKK 310

Query: 303 IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
           +I +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG
Sbjct: 311 VIDIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGG 367

Query: 359 NFNLPNFAQRLAAELQ----------RQLPTDWTCHVSV------PEGDCALFGWEVMSQ 402
           +    +F++RL  +++            L    +  V V       + +   FG  +++Q
Sbjct: 368 STMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQ 427

Query: 403 FAKTDSYRKARVTREEYYEHGPD 425
            A+   Y     T+++Y EHGP+
Sbjct: 428 TAEFKGYCH---TKKDYEEHGPE 447

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 117/259 (45%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F    +   ++V+ + +++        RK         +I+ +
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST--------RK---------KIVDV 310

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 367

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSV------PEGDCALFGWEVMSQFAKT 406
            +F +RL  +L+            L    +  V+V       + +   FG  +++Q A+ 
Sbjct: 368 KDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEF 427

Query: 407 DSYRKARVTREEYYEHGPD 425
             Y     T+++Y E+GP+
Sbjct: 428 KGYCH---TKKDYDEYGPE 443

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 88/183 (48%), Gaps = 14/183 (7%)

Query: 261 FDS-FKTKDKHALEYVLPDFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFF 318
           FDS F  +D    +Y   D++ S L  ++R PR  +     +   + +  E   +PE  F
Sbjct: 571 FDSNFTMEDTVDAQY---DWRNSTLHLFLRGPRPFDSENSHEQHQMHMNIERPRVPEILF 627

Query: 319 HPEISQITKPGIVE----AILESLSMLPEIVR---PLMVGNIVCTGGNFNLPNFAQRLAA 371
            P +    + GI+E     +L+     P  +      M  N+  TGG+  LP    R+  
Sbjct: 628 QPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVK 687

Query: 372 ELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKH 430
           E    LP D    V++ +   +L  W+ M++F+  D+ ++ + ++++EY E+GP++  +H
Sbjct: 688 EFTSFLPNDAKFSVNISKH-PSLDAWKGMAKFSSDDADFKSSLISKKEYEEYGPEYIKEH 746

Query: 431 RFG 433
           R G
Sbjct: 747 RLG 749

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/429 (20%), Positives = 171/429 (39%), Gaps = 76/429 (17%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISS--------IT 56
           P+V+DNGS  +K G S ++ P      +A        ++  +++   + +        + 
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGLLA 72

Query: 57  FRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            RRP   G++T W+    +W +  ++  +    + + G  H L+ +E+ +   +  +   
Sbjct: 73  LRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGD-HPLLITEAPLNSTKNRETMC 131

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKN 176
           ++++E + FD+L+ +  AV   +                                     
Sbjct: 132 EILYETFNFDALYVAHPAVLSLYA-----------------------------------T 156

Query: 177 AQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLL----KETLS 232
            Q +G        V++ G   +   PV +G     +++++DIGGR +T  L    +++  
Sbjct: 157 GQTTGC-------VLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTG 209

Query: 233 FRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRK 292
              ++  ++ I V  IKE+  +V               AL+Y     +  F  + R    
Sbjct: 210 LSLFSNSEQEI-VRTIKEKANYV---------------ALDYKFE--EEKFFIHERE-NT 250

Query: 293 ENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGN 352
             V LP D Q +T     +   E  F P++       + E +LES++ +   +R  ++ N
Sbjct: 251 STVKLP-DGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLEN 309

Query: 353 IVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKA 412
           IV +GG   L  F QR  +E ++ LP      +     + +   W   S  +    +R  
Sbjct: 310 IVLSGGTTMLKGFDQRTMSETKKMLPKHTKVKIR-SLAERSYIAWIGGSILSGLYGFRNL 368

Query: 413 RVTREEYYE 421
            +TRE Y E
Sbjct: 369 WLTREMYEE 377

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 96/446 (21%), Positives = 169/446 (37%), Gaps = 92/446 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP------------FRALNA--LAKDKFGTSYLSNHIKNIK 50
           P+V+DNGS  IK G S  ++P            +  + A  LA D   +  + N  + ++
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKMR 67

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPE 110
            +  + +  P E G +  W     +W +  +N        L   + H ++ +E+ +   +
Sbjct: 68  GLLKLHY--PLEHGVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLNPMK 120

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXX 170
                 +++FE +   +++ S  AV   +        RT                     
Sbjct: 121 NRNKMCEMLFETFGSPAVYVSIQAVLALYAGG-----RTTG------------------- 156

Query: 171 XXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGL 226
                              VID G  C   +PV  G     A++++D+ GR    FL  L
Sbjct: 157 ------------------CVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLL 198

Query: 227 LKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGY 286
           L+++      +  +  I V  IKE+  FV+     +    +  ++ E      +T F   
Sbjct: 199 LRKSSGVTLSSSSEREI-VRMIKEKACFVATDVGNEEQNYEGANSAE-----LETRF--- 249

Query: 287 VRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                     LP D +I+TL  E F  PE  F P +       I E   +S+S +   +R
Sbjct: 250 ---------KLP-DGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLR 299

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKT 406
             +  +IV +GG+     F  RL +E+++    +    +  P  +     W   S  A  
Sbjct: 300 SSLYSSIVLSGGSTMFSGFGDRLLSEIRKTSEPNTKIKIFAPP-ERKYSTWIGGSILAGL 358

Query: 407 DSYRKARVTREEYYEHGPDWCTKHRF 432
            ++ K  VTR E+ E+    C   RF
Sbjct: 359 STFEKLWVTRAEWQEN--PQCIHSRF 382

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 110/263 (41%), Gaps = 56/263 (21%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADT-------- 254

Query: 250 EQCLFVSPVSYFDSFKTKDKHALE--YVLPDFQTSFLGYVRNPRKENVPLPEDAQ----- 302
                        S +T +K   E  YV PD    F  + R+P K    + E+ +     
Sbjct: 255 -------------SLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRK 301

Query: 303 IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
           ++ +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGG 358

Query: 359 NFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMSQ 402
           +    +F +RL  +L+                +    D +      + +   FG  +++Q
Sbjct: 359 STMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 403 FAKTDSYRKARVTREEYYEHGPD 425
            A+   Y     T+++Y E+GP+
Sbjct: 419 TAEFKGYCH---TKKDYEEYGPE 438

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 111/264 (42%), Gaps = 58/264 (21%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D         
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDT-------- 263

Query: 250 EQCLFVSPVSYFDSFKTKDKHALE--YVLPDFQTSFLGYVRNPRKENVPLPED-----AQ 302
                        S KT ++   E  YV PD    F  + R+  K +  + E+      +
Sbjct: 264 -------------SLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIENQGKTQKK 310

Query: 303 IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
           I+ +  E F  PE FF+PEI+        P IV+  +++    P  VR  +  NIV +GG
Sbjct: 311 IVDVGYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYSNIVLSGG 367

Query: 359 NFNLPNFAQRLAAELQRQLPTDWTCHVSVPEG-----------------DCALFGWEVMS 401
           +    +F +RL  +L R +  D      +  G                 +   FG  +++
Sbjct: 368 STMFKDFGRRLQRDL-RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLA 426

Query: 402 QFAKTDSYRKARVTREEYYEHGPD 425
           Q A+  SY     T+ +Y E+GP+
Sbjct: 427 QTAEFKSYCH---TKRDYEEYGPE 447

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 115/259 (44%), Gaps = 50/259 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F   D+ A ++        F+  V N  K         +++ +
Sbjct: 269 KQEYCYVCPDIVKEFNKF---DRDATKFA------QFI--VENKEKTQ------KKVVDV 311

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 312 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 368

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSVPEG-----------------DCALFGWEVMSQFAK 405
            +F +RL  +L R +  +      +  G                 +   FG  +++Q A+
Sbjct: 369 KDFGRRLQRDL-RSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAE 427

Query: 406 TDSYRKARVTREEYYEHGP 424
             SY     T+++Y E+GP
Sbjct: 428 FKSYCH---TKKDYEEYGP 443

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 95/442 (21%), Positives = 169/442 (38%), Gaps = 84/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----FRALNALAKDKFGTSYLSNHIKNI-----KDISSI 55
           P+V+DNGS  IK G S  +KP    +  +     DK     LS+  + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHA 115
             + P E G +  W     +W +  ++  + +         H ++ +E+ +   E     
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIG-----DHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXK 175
            ++++E +   +++ S  AV   +        RT                          
Sbjct: 126 CEMLYETFNVPAVYVSIQAVLALYAGG-----RTTG------------------------ 156

Query: 176 NAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETL 231
                         VID G  C   +PV  G     A++++D+ GR    FL  LL++++
Sbjct: 157 -------------CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSI 203

Query: 232 SFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPR 291
                +  +  I V  IKE+  +V+P    +  K       E +     T F        
Sbjct: 204 GVTLLSSSEREI-VRMIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKF-------- 249

Query: 292 KENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
                LP D +I++L  E F  PE  F P++       I +   +S+S +   +R  +  
Sbjct: 250 ----KLP-DGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYS 304

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHV-SVPEGDCALFGWEVMSQFAKTDSYR 410
           ++V +GG+     F  RL  EL+ +   +    + + PE   ++  W   S  A   ++ 
Sbjct: 305 SLVLSGGSTLFAGFGDRLLNELRSRCEPNVKIKIFAPPERKYSV--WIGGSILAGLSTFE 362

Query: 411 KARVTREEYYEHGPDWCTKHRF 432
           K  VTR E+ E+    C   RF
Sbjct: 363 KIWVTRSEWQEN--PQCVHSRF 382

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 101/457 (22%), Positives = 172/457 (37%), Gaps = 104/457 (22%)

Query: 3   TPPIVIDNGSYEIKFGPSTNKKPFRA-----LNALAKDKFGTSYLSNHIKNIKDISS--- 54
            P  V +  SY   FG ST+   F       L+     K GT  L  +I N   ++S   
Sbjct: 52  APSAVSNEASY---FGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGP 108

Query: 55  -ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
             +   P   GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +
Sbjct: 109 SYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENRE 162

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTK--SYKGEMRTISGKDEDIDIVRGXXXXXXXXX 171
              ++ FE +    L+ +  AV        S K   R+++G                   
Sbjct: 163 QVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT------------------ 204

Query: 172 XXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                             VIDSG   T +IPV +G     A+K + I GR +T  ++  L
Sbjct: 205 ------------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 232 SFRHYNMMDETI-LVNNIKEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVR 288
             R     D ++     IK++  +V P  V  F+ F        ++V           V 
Sbjct: 247 --RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFV-----------VE 293

Query: 289 NPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEI 344
           N  K         +++ +  E F  PE FF+PEI+        P +V+   +++   P  
Sbjct: 294 NQEKTR------RKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPID 344

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVP 388
           VR  +  NIV +GG+    +F +RL  +L+                +    D +      
Sbjct: 345 VRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRK 404

Query: 389 EGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPD 425
           + +   FG  +++Q A+   Y     T+++Y E+GP+
Sbjct: 405 QRNAVWFGGSLLAQTAEFKGYCH---TKKDYEEYGPE 438

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 101/454 (22%), Positives = 172/454 (37%), Gaps = 107/454 (23%)

Query: 10  NGSYEIKFGPSTNKKPFRAL--------NALAKDKFGTSYLSNHIKNIKDIS----SITF 57
           NGS    FG ST+   F  L        N LA  K GT  L  +I N   ++    S + 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLA-GKRGTEDLDFYIGNEALVAAQSPSYSL 121

Query: 58  RRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
             P   GQ+  W+     W+  +F       +   E + H+ + +E  +  PE  +   +
Sbjct: 122 SYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENREQVAE 175

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTK--SYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXK 175
           + FE +    L+ +  AV        S K   R+++G                       
Sbjct: 176 IFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT---------------------- 213

Query: 176 NAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
                         VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R 
Sbjct: 214 --------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RE 257

Query: 236 YNMMDETI-LVNNIKEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRK 292
               D ++     IK++  +V P  V  F+ F  + +   ++++   + +          
Sbjct: 258 RGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKT---------- 307

Query: 293 ENVPLPEDAQIITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPL 348
                    +++ +  E F  PE FF+PEI+        P +V+   +++   P  VR  
Sbjct: 308 -------KQKVVDVGYERFLAPEIFFNPEIASSDYLTPLPTVVD---QTIQACPIDVRKG 357

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFG------------ 396
           +  NIV +GG+    +F++R    LQR + +     +S  E    +              
Sbjct: 358 LYNNIVLSGGSTMFKDFSRR----LQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRK 413

Query: 397 -----WEVMSQFAKTDSYRKARVTREEYYEHGPD 425
                W   S  A+T  +R    T+ +Y E GP+
Sbjct: 414 QRNAVWFGGSLLAQTAEFRGYCHTKRDYEEIGPE 447

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 110/256 (42%), Gaps = 42/256 (16%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERGEVDTSLRTAERI 274

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F    +   +YV           V N  K         +++ +
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDAEKFAQYV-----------VENQDKTR------QKVVDI 317

Query: 307 TDELFTIPETFFHPEISQITKPGIVEAIL-ESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365
             E F  PE FF+PEI+       +  +L +++   P  VR  +  NIV +GG+    +F
Sbjct: 318 GYERFLAPEIFFNPEIASSDFLTPLPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 377

Query: 366 AQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSY 409
            +RL  +L+                R    D        + +   FG  +++Q   T  +
Sbjct: 378 GRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVWFGGSLLAQ---TPEF 434

Query: 410 RKARVTREEYYEHGPD 425
           +    T+++Y E+GP+
Sbjct: 435 KGYCHTKKDYEEYGPE 450

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 100/446 (22%), Positives = 166/446 (37%), Gaps = 106/446 (23%)

Query: 17  FGPSTNKKPFRALNALA------KDKFGTS----YLSNHIKNIKDISSITFRRPHELGQL 66
           FG ST+   F +L + A        K GT     Y+ N         S +   P   GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  TLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 124 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 177

Query: 127 SLFKSPVAVFVPFTK--SYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKNAQDSGSDY 184
            L+ +  AV        S K   R+++G                                
Sbjct: 178 GLYIAVQAVLALAASWTSSKVVDRSLTGT------------------------------- 206

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244
                VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D T+ 
Sbjct: 207 -----VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLR 259

Query: 245 VNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQ-- 302
                                 + K    YV  D    F  + R+P+K    + E+++  
Sbjct: 260 T-------------------AERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKT 300

Query: 303 ---IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVC 355
              +I +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV 
Sbjct: 301 KRKVIDVGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVL 357

Query: 356 TGGNFNLPNFAQRLAAELQ----------RQLPTDWTCHVSVP------EGDCALFGWEV 399
           +GG+    +F +RL  +L+            L    +  V V       + +   FG  +
Sbjct: 358 SGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSL 417

Query: 400 MSQFAKTDSYRKARVTREEYYEHGPD 425
           ++Q A+  SY     T+++Y E GP+
Sbjct: 418 LAQTAEFKSYCH---TKQDYEEIGPE 440

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 90/431 (20%), Positives = 169/431 (39%), Gaps = 89/431 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP-----FRALNALAKDKFGT-----SYLSNHIKNIKDISS 54
           P+++DNGS  IK G + +++P         N LA+    T     +Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +    P+    +  W+    +WDY L N  E +   L+E   H +V + S  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIE--QLQE---HPVVLTNSMSTSKKEEEK 124

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             +V+FE++   +++ S   +      S  G  RT                         
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIM-----SLYGLGRTTG----------------------- 156

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                           +  G     I  V+ G+    + +  + GG  +T  + + L   
Sbjct: 157 --------------CSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHN 202

Query: 235 H---YNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPR 291
           H    N  +   L+ +IKE+C  +S   +++  +        Y L   +TS   Y     
Sbjct: 203 HPKLENGQNGIELIRSIKERCCVLSK-DFYNEIRA-------YELITSKTSNNKY----- 249

Query: 292 KENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
                LP D  II +  E F  PE  F+P+    ++  + + I+ S+S    + R  ++ 
Sbjct: 250 ----RLP-DGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLE 304

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE--------GDCALFGWEVMSQF 403
           +IV +GG+  +  F +RL  E+++++  +    ++ P         G   L G   M   
Sbjct: 305 SIVLSGGSSLIKGFGERLTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLL 364

Query: 404 AKTDS-YRKAR 413
            K+ S YR+ +
Sbjct: 365 WKSKSAYREDK 375

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 110/263 (41%), Gaps = 56/263 (21%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADT-------- 254

Query: 250 EQCLFVSPVSYFDSFKTKDKHALE--YVLPDFQTSFLGYVRNPRKENVPLPEDAQ----- 302
                        S +T +K   E  YV PD    F  + R+P K    + E+ +     
Sbjct: 255 -------------SLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRK 301

Query: 303 IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
           ++ +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTPLPMVVD---QTIQACPIDVRKGLYNNIVLSGG 358

Query: 359 NFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMSQ 402
           +    +F +RL  +L+                +    D +      + +   FG  +++Q
Sbjct: 359 STMFKDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 403 FAKTDSYRKARVTREEYYEHGPD 425
            A+   Y     T+++Y E+GP+
Sbjct: 419 TAEFKGYCH---TKKDYEEYGPE 438

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 84/401 (20%), Positives = 157/401 (39%), Gaps = 93/401 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRAL-----------NALAKDKFGTSYLSNHIKNIKDIS 53
           PIVIDNGS  IK G S  ++P +AL             + +   G +++ N  + ++ + 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y L      +   L+  + H L+ +E+ M   +  +
Sbjct: 72  -LRLRYPMTHGVVEDWDSMELIWSYML-----NEVLQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              QV+FE +   +L+ S  AV   +        RT                        
Sbjct: 126 VMAQVLFETFNLPALYISNPAVLSLYASG-----RTTG---------------------- 158

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G      +P+  G     ++ ++DIGGR +T    E L F
Sbjct: 159 ---------------CVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQF 199

Query: 234 RHYNMM-------DETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGY 286
           +             E  +V  IKE+  +++     +  K +D++   +   D  + F   
Sbjct: 200 QLRKSAGISLFSSSELEVVRMIKEKVCYLAK----NIKKEEDRYLQGH--HDLGSVF--- 250

Query: 287 VRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                     LP D + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R
Sbjct: 251 ---------KLP-DGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
             ++ +I+ +GG   L  F +R+  +L+    +  TC + +
Sbjct: 301 KTLLSSIILSGGTTTLRGFGERMLHDLEAL--SKGTCKIKI 339

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 118/259 (45%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F  + +   ++++ +         ++  K+        +++ +
Sbjct: 274 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QDKTKQ--------KVVDI 316

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+  +++    P  VR  +  NIV +GG+   
Sbjct: 317 GYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQA---CPIDVRKGLYNNIVLSGGSTMF 373

Query: 363 PNFAQRLAAELQ-----RQLPTDWTCHVSVPEGDCAL-----------FGWEVMSQFAKT 406
            +F++RL  +++     R +  +    V     D  +           FG  +++Q A+ 
Sbjct: 374 KDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 433

Query: 407 DSYRKARVTREEYYEHGPD 425
            SY     T+++Y E+GP+
Sbjct: 434 KSYCH---TKKDYEEYGPE 449

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 83/383 (21%), Positives = 148/383 (38%), Gaps = 81/383 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK G S  +KP    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           + +  P E G +  W+    IW + L      +   L+  + H L+ +E+ M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILN-----EVLQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             QV+FE +   +L+ S  AV   +        RT                         
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYASG-----RTTG----------------------- 158

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          VID G      +P+  G     ++ ++DIGGR +T  L+  L   
Sbjct: 159 --------------CVIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKS 204

Query: 235 HYNMM---DETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPR 291
               +    E  +V  IKE+      V Y  +   K+++       D  + F        
Sbjct: 205 AGVSLFSSSEREIVRTIKEK------VCYLATDIKKEENTYMQESQDLTSVF-------- 250

Query: 292 KENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
                LP D + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R  ++ 
Sbjct: 251 ----KLP-DGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLS 305

Query: 352 NIVCTGGNFNLPNFAQRLAAELQ 374
           +I+ +GG   L  F  R+  +L+
Sbjct: 306 SIILSGGTTTLRGFGDRMLHDLE 328

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 109/263 (41%), Gaps = 56/263 (21%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADT-------- 254

Query: 250 EQCLFVSPVSYFDSFKTKDKHALE--YVLPDFQTSFLGYVRNPRKENVPLPEDAQ----- 302
                        S +T +K   E  YV PD    F  + R+P K    + E+ +     
Sbjct: 255 -------------SLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRK 301

Query: 303 IITLTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
            + +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG
Sbjct: 302 AVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGG 358

Query: 359 NFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPEGDCALFGWEVMSQ 402
           +    +F +RL  +L+                +    D +      + +   FG  +++Q
Sbjct: 359 STMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 403 FAKTDSYRKARVTREEYYEHGPD 425
            A+   Y     T+++Y E+GP+
Sbjct: 419 TAEFKGYCH---TKKDYEEYGPE 438

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 115/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  +++ L  R     D ++     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERI 274

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V P  V  F+ F    +   ++V+   +       +  RK          ++ +
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDSEKFAQFVVESQE-------KTRRK----------VVDV 317

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+  +++    P  VR  +  NIV +GG+   
Sbjct: 318 GCERFMAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYNNIVLSGGSTMF 374

Query: 363 PNFAQRLAAELQ-----RQLPTDWTCHVSVPEGDCAL-----------FGWEVMSQFAKT 406
            +F +RL  +L+     R + +++         D  +           FG  +++Q A+ 
Sbjct: 375 KDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 434

Query: 407 DSYRKARVTREEYYEHGPD 425
            SY     T+++Y E GP+
Sbjct: 435 KSYCH---TKKDYEEIGPE 450

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/387 (20%), Positives = 150/387 (38%), Gaps = 89/387 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK G S  ++P    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  W+    IW Y L      +   L+  + H L+ +E+ M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVL-----NEVLQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             QV+FE +   +++ S  AV   +        RT                         
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYASG-----RTTG----------------------- 158

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+D G      +P+  G     ++ ++DIGG    G + E L F+
Sbjct: 159 --------------CVVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQ 200

Query: 235 HYNMM-------DETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
                        E  +V  IKE+  +++     D+ K +DK+       D  ++F    
Sbjct: 201 IRKSAGVSLFSSSEREIVRTIKEKVCYLAK----DAKKEEDKYL--QGTQDLISAF---- 250

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                    LP D + I + ++ +  PE  F P+I      G+    ++S+  +   +R 
Sbjct: 251 --------KLP-DGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRK 301

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQ 374
            ++ +++ +GG   L  F  R+  +L+
Sbjct: 302 NLLSSVILSGGTTTLKGFGDRMLHDLE 328

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 79/388 (20%), Positives = 155/388 (39%), Gaps = 91/388 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNKKPFRALN--ALAKDKF---------GTSYLSNHIKNIKDIS 53
           P+VIDNGS  IK G S  ++P +AL    +   K+         G +++ N+ + ++ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL- 71

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W+    IW Y L          L+    H L+ +E+ M   +  +
Sbjct: 72  -LKLRYPIKHGVVEDWDSMELIWSYVLNEV-----LQLQNIGEHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
              QV+FE ++  +L+ S  AV   +        RT                        
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYASG-----RTTG---------------------- 158

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G      +P+  G     ++ ++DIGG  +T    E L F
Sbjct: 159 ---------------CVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT----EQLQF 199

Query: 234 RHYNMMDETI-------LVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGY 286
           +       ++       +V  +KE+  +++      + K +++  L+    D  ++F   
Sbjct: 200 QLRKSAGVSLFSSSEREIVRTMKEKVCYLAK-----NIKKEEEKYLQGT-QDLISTF--- 250

Query: 287 VRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                     LP D + I + ++ +  PE  F P+I  +   G+ +  ++S+  +   +R
Sbjct: 251 ---------KLP-DGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQ 374
             ++ +I+ +GG   L  F  R+  +L+
Sbjct: 301 KPLLSSIILSGGTTTLKGFGDRMLWDLE 328

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 90/205 (43%), Gaps = 18/205 (8%)

Query: 241 ETILVNNIKEQCLFVSPVSYFD-SFKTKDKHALEYVLPDFQTSFLG-YVRNPRKENVPLP 298
           E ++ +  KE       +  FD +F  +D    +Y   D++ S L  ++R PR  +    
Sbjct: 544 EELIEDQYKEIVALERVLLEFDPNFTEEDTLDAQY---DWRNSVLHLFLRGPRPHDGESI 600

Query: 299 EDAQIITLTDELFTIPETFFHPEIS---QITKPGIVEAILESLSMLPEIVRPL------M 349
                + +  E   +PE  F P +    Q   P + E +L  L       R L      M
Sbjct: 601 HHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSM 658

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAK-TDS 408
             N+  TGGN  LP   +R+  E    LP+     +   + D +L  W  M++ A+ T+ 
Sbjct: 659 AQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRKSQ-DPSLDAWRGMAKLAQNTED 717

Query: 409 YRKARVTREEYYEHGPDWCTKHRFG 433
           ++   +T++EY E+GP++  +H  G
Sbjct: 718 FKHGYITKQEYLEYGPEYIKEHNLG 742

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 100/441 (22%), Positives = 161/441 (36%), Gaps = 103/441 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----FRALNALAKDKF-------GTSYLSNHIKNIKDIS 53
           PIVIDNG+  IK G +   KP    +  +     DK          S++ N  +  + I 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y       FD     E    H +     +T P L+ 
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQYV------FDDTLYLENLNEHPIL----ITEPPLNN 121

Query: 114 HAD-----QVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXX 168
            A+     + +FE + F +++ S   V   +           SG+               
Sbjct: 122 MANRQKMCEALFEIFGFPAVYISVSPVLSLYA----------SGQTTGC----------- 160

Query: 169 XXXXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLT---- 224
                   A D G  Y            CT  IPV  G     +VKK+DIGG  +T    
Sbjct: 161 --------AVDCGDGY------------CT-SIPVYNGFSLASSVKKIDIGGCDITEQLQ 199

Query: 225 -GLLKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFK---TKDKHALEYVLPDFQ 280
             +LK T  F + +   E  +V  IKE+  +++     ++ K    ++K A ++ LPD  
Sbjct: 200 FSILKNTGLFMYSS--SEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD-- 255

Query: 281 TSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSM 340
                                +++ ++   +T  E  F PE+       + E   +S+  
Sbjct: 256 --------------------GKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKK 295

Query: 341 LPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVM 400
           +   +R  +  NIV +GG    P F  RL  ELQ     D    +  P  +     W   
Sbjct: 296 VDSDLRLPLYSNIVLSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAPP-ERKYTSWIGG 354

Query: 401 SQFAKTDSYRKARVTREEYYE 421
           S  +   ++ K  VT+  + E
Sbjct: 355 SILSGLSTFSKIWVTKSMWEE 375

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 86/192 (44%), Gaps = 29/192 (15%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D T+     I
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 258

Query: 249 KEQCLFVSP--VSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K++  +V    V  F+ F    +   +++           V N  K         ++I +
Sbjct: 259 KQEYCYVCSDIVKEFNKFDRDSEKFAQFI-----------VENSEKTR------RKVIDV 301

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+   +++   P  VR  +  NIV +GG+   
Sbjct: 302 GYERFLAPEIFFNPEIASSDFLTPLPTIVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 358

Query: 363 PNFAQRLAAELQ 374
            +F +RL  +L+
Sbjct: 359 KDFGRRLQRDLK 370

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 88/437 (20%), Positives = 164/437 (37%), Gaps = 100/437 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKKP----FRALNALAKDKFGTS------YLSNHIKNIKDISS 54
           PIV+DNGS  +K G   + KP    +  +     DK          ++ N  +  + +  
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL-- 70

Query: 55  ITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  WE    +WD+ +F     D   +     H LV +E+ +      + 
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDH-IFK----DCLKVSNLGEHPLVVTEAPLNPKPNREK 125

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
             + +FE +   +L+ +  AV   +        RT                         
Sbjct: 126 MCETLFESFNIPALYIANPAVLSLYASG-----RTTG----------------------- 157

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+++G      +P+ +G     +++++DIGGR +T  L+  L  R
Sbjct: 158 --------------CVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLR 201

Query: 235 HYNMM-----DETILVNNIKEQCLFVSPVSYFDSFK---TKDKHALEYVLPDFQTSFLGY 286
               M      E  +V  IKE   ++      +  K    ++K ++ + LPD +   +G 
Sbjct: 202 KSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGP 261

Query: 287 VRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
            R                      F  PE  F+P +       + + I++S+S +   +R
Sbjct: 262 GR----------------------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLR 299

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV---PEGD-CALFGWEVMSQ 402
             ++ NI  +GG+     F  RL  EL      D T  V +   PE    A  G  +++ 
Sbjct: 300 SKLLNNITLSGGSTMFQGFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILAN 357

Query: 403 FAKTDSYRKARVTREEY 419
            +   ++R   VT++++
Sbjct: 358 LS---TFRNMWVTKDQW 371

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 79/185 (42%), Gaps = 13/185 (7%)

Query: 258 VSYFDSFKTKDKHALEYVLPDFQTS-FLGYVRNPRKENVPLPEDAQIITLTDELFTIPET 316
           + Y  +F  +D    +Y   D++ S F  ++R PR  +     +   + +  E   +PE 
Sbjct: 568 LEYDPNFTEEDTLDAQY---DWRNSVFHLFLRGPRPHDSENIHEQHQMHINVERIRVPEV 624

Query: 317 FFHPEISQITKPGIVEA----ILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRL 369
            F P +    + GI E     I +     P  +      M  N+   GGN  +P    R+
Sbjct: 625 MFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRV 684

Query: 370 AAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCT 428
             E    LP+D   +V++ E    L  W  M + A T+  Y++  VT EEY E G D+  
Sbjct: 685 VKEFTEFLPSDTKINVNISEA-PTLDVWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLK 743

Query: 429 KHRFG 433
           +H+  
Sbjct: 744 EHKLS 748

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S L  ++R PR  +     +   + L  E   +PE  F P I    + GI E    
Sbjct: 582 DWRNSVLHLFLRGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCET 641

Query: 337 SLS-MLPEIVRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            LS       R L      M  NI  TGG+  LP   +R+  E    LP      V + +
Sbjct: 642 ILSNKFGSKPRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK 701

Query: 390 GDCALFGWEVMSQFAKTDS-YRKARVTREEYYEHGPDWCTKHRFG 433
            + +L  W  M + A+ ++ Y+ + +++++Y E+G ++  +H+ G
Sbjct: 702 -NPSLDAWYGMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 1/106 (0%)

Query: 328 PGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVS 386
           PGIV+ I  S+      +R  +  NIV TGG   +P F+ RL  EL ++LP   +    +
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 387 VPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
               +     W   S  +   ++ +  V ++EY E G D   K RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           GIV+ I +S+      +R  +  N+V TGG   +P  + R+  EL + LP   +    S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 388 PEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
              +    GW   S  A   ++ +  V REEY E GP+   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 62/143 (43%), Gaps = 15/143 (10%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH----YNMMDET-- 242
           LV+D G + + + PV+ G+   K+  +  + G++L  L+ + L  R     + ++ +   
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPD 215

Query: 243 ----ILVNNIKEQCL-FVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297
                L  ++ E  + F +   +F  F    K  L ++ P   +SF   +    K ++  
Sbjct: 216 FVKRTLSFDVNESVINFANERQFFQEF----KETLLHIAPKSLSSFKDELATQTKRSLEA 271

Query: 298 PEDAQIITLTDELFTIPETFFHP 320
           P   ++I   D  ++  E  F P
Sbjct: 272 PWGEELIFDADTRYSFAEQLFRP 294

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG  +LP    R++AEL R LP   +    S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 388 PEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
              +    GW   S  A   ++ +  V ++EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 69/356 (19%), Positives = 118/356 (33%), Gaps = 80/356 (22%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E   +VID GS+    G S    P     A+    +G  Y       +    SI   R+ 
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCP----QAILPSCYG-KYTEGEKDELFSEQSIGLPRKD 67

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +E+      G++  WE     WD+ + +   F+        G   + +E      E  K 
Sbjct: 68  YEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFE-----TNSGMPALLTEPIWNSEENRKK 122

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
           + +V+ E  +F + +  P A  V F                                   
Sbjct: 123 SLEVLLESMDFSACYLVPTATAVSFAMG-------------------------------- 150

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                         LV+D G + T + PV+ G+   K+  +  I G  L  L++  L+ R
Sbjct: 151 ----------RPTCLVVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

Query: 235 HY-----------NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSF 283
                          M+             FV+   +F  F    K  +  V P   + F
Sbjct: 201 KVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF----KETMLQVAPTSISKF 256

Query: 284 LGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQ------ITKPGIVEA 333
              +    K ++  P   +++  + +     E  F P++SQ      I+K G+VE 
Sbjct: 257 KSEIETTSKRSIEAPWGEELVYDSLQRLEFAEQLFTPDLSQFPEDWPISKDGVVET 312

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 2/125 (1%)

Query: 309 ELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQR 368
           E   +P+     +I  I  PGI + +  +++     +R  +  N++ TGG   +P  A R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 369 LAAELQRQLPT-DWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWC 427
           L  EL ++LP   +    S    +     W   S      ++ +  V + EY E GPD  
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 428 TKHRF 432
            K RF
Sbjct: 591 LKDRF 595

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           LV+D G +   + PV+ G+   K+V++    GR+L  LL+  +  R 
Sbjct: 246 LVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVPEGDCALFGWEV 399
           +R  +  NIV TGG  ++P F+ RL +EL ++LP        T H+   +    L G   
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGG--- 447

Query: 400 MSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
            S      S+ +  V ++EY E GPD     RF
Sbjct: 448 -SILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG+ ++P    R+ AEL + LP   +    S 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 388 PEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
              +     W   S  A   ++ +  V ++EY E G D   K RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 65/161 (40%), Gaps = 21/161 (13%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVN-- 246
           LV+D G + T + PV+ G+   K+  +  I G  L  L++ +L  R    + +       
Sbjct: 156 LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPE 215

Query: 247 --------NIKEQCL-FVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297
                    I    L FV+   +F  F    K  +  V P   T F   +    K ++  
Sbjct: 216 FVKRSFDYEIHPSLLNFVNERQFFQEF----KETMLQVAPTSLTKFKSELEQLSKRSIEA 271

Query: 298 PEDAQIITLTDELFTIPETFFHPEISQ------ITKPGIVE 332
           P    ++  ++  F I E  F PE ++      I+K G+VE
Sbjct: 272 PWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVE 312

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 105/524 (20%), Positives = 173/524 (33%), Gaps = 145/524 (27%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E   +VID GSY    G S    P   L +   D   T       K +    SI   R+ 
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKD 72

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +E+      G +  W+     W + L N        L+   G   + +E      E  K 
Sbjct: 73  YEIKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVENRKK 127

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
           + +++ E  +F++ + +     V F     G  R+                         
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSF-----GTGRSSC----------------------- 159

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                         LV+D G +   + PV+ G+   K+ K+    G +L  L+K  +S  
Sbjct: 160 --------------LVVDLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYISPE 205

Query: 235 H---------------------------YNMMDETILVNNIKEQCLFVSPVSYFDSFK-- 265
                                       Y   ++  +    KE    V+  S  D  K  
Sbjct: 206 KIIPLFAIDKRRPELKKKVFEFPVHESLYKYANDRGIFQECKETLCQVAAPSTLDKMKSE 265

Query: 266 --TKDKHALEY-----VLPDFQTSFLGYVRN---PRKENVP----LPEDAQIITLTDELF 311
             T  K ++E      ++ D +T + G+      PRKE+VP    + E+  + T  ++  
Sbjct: 266 LATVAKRSIETPWTEEIIFDNETRY-GFAEQLFLPRKEDVPDNWNISENGTVETWHNDYV 324

Query: 312 TI----------------PETFFHPEI-------------------SQITKP---GIVEA 333
            +                P+    P I                   S+ITK    G+ + 
Sbjct: 325 PVKRTKPSGSVKSNKDSTPQNSVEPSITAEPLDETNENGKRIIESSSEITKGSLLGVADL 384

Query: 334 ILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVP 388
           +  S+      +R  +  N+V TGG   +P  + RL AEL  +LP        T H    
Sbjct: 385 VHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTGHTRER 444

Query: 389 EGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
           +    L G    S      ++ +  V +EEY + G D     RF
Sbjct: 445 QYQSWLGG----SVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/326 (20%), Positives = 117/326 (35%), Gaps = 84/326 (25%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLT-----------------------G 225
           LV+D G +   + PV+ G+ + K+ ++  I G++L                         
Sbjct: 179 LVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPT 238

Query: 226 LLKETLSFRHYNMM----DETILVNNIKEQCLFVSPVSYFDSFK------TKDKHAL--- 272
           L+K+T  F  ++ +    ++  +   IKE    VSP S  + +K      +K K+     
Sbjct: 239 LVKKTFDFPIHDSLKTYANDRGIYQEIKEALCRVSPNSSLEKYKPELEKMSKRKYETLWN 298

Query: 273 ---------------------EYVLP-DFQTSFLGYVRNPRKENVPLPEDAQIITLTDEL 310
                                E  +P D+ TS  G V     + +PL  +    T+  + 
Sbjct: 299 EDIVFDNETIYGFGEQLFIPKENDIPVDWNTSKDGIVETWHNDYIPLKRNKPAGTVKTDK 358

Query: 311 FTIPETFFHPEISQITK-----------------------PGIVEAILESLSMLPEIVRP 347
               E    P +   T                        PGIV+ I  S++     +R 
Sbjct: 359 EATEE--LTPAVDNATPSEDTNDNGKRPIGNEGEEKEKIIPGIVDLIESSINAADVDLRT 416

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPEGDCALFGWEVMSQFAKT 406
            +  N+V TGG   +P  + R+  EL ++LP   +    +    +     W   S  +  
Sbjct: 417 SLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLANGQTRERQYQSWLGGSILSSL 476

Query: 407 DSYRKARVTREEYYEHGPDWCTKHRF 432
            ++ +  V ++EY E G D     RF
Sbjct: 477 GTFHQLWVGKQEYEEIGADRLLTDRF 502

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 85/242 (35%), Gaps = 55/242 (22%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKN-IKDISSITFRRP 60
           E   IVID GSY    G S +  P   + +       T+   N  K  +    SI   RP
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------ELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
                   E G++  W+     WD+ L N        LK   G  ++ +E      E  K
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXX 173
            + +V+ E  +F++ + SPV+  V F                                  
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPN---------------------------- 157

Query: 174 XKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          LV+D G + T + PV+ G+   K+  +  I GR++  L++  L  
Sbjct: 158 --------------CLVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKP 203

Query: 234 RH 235
           R 
Sbjct: 204 RE 205

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 9/109 (8%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTC 383
           GI + +  S+      +R  +  N+V TGG   +P    RL  EL ++LP        T 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 384 HVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
           H+   +    L G    S      ++ +  V +EEY E G D     RF
Sbjct: 470 HLREKQYQAWLGG----SILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 100/518 (19%), Positives = 169/518 (32%), Gaps = 137/518 (26%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNA-----LAKDKFGTSYLSNHIKNIKDISSIT 56
           E   +VID GSY    G S    P   + +        +K G    ++    +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W + + +  +F  F     KG     +E+     E  K + 
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKN 176
           +V+ E  EF++ + +P A  V F                                     
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFAMG---------------------------------- 152

Query: 177 AQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY 236
                       LV+D G +   + PV+ G+   K+  +  + G+ L  L+++ L  R  
Sbjct: 153 --------RPTCLVVDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPREI 204

Query: 237 ---------------------------NMMDETILVNNIKEQCLFVSP------VSYFDS 263
                                      +  ++   +   KE  L V+        S  DS
Sbjct: 205 IPMFKVAQKRPEFIPKKFDFDIHKSIDDFANDRGFLQECKETMLHVASEELPKFQSELDS 264

Query: 264 FKTKDKHA--LEYVLPDFQTSF------LGYVRNPRKENVPLPEDAQIITLTDELFTIPE 315
              +   A   E ++ D +T +         +R    EN PLP D  + T  ++   +P 
Sbjct: 265 MSKRSIEAPWGENIVFDSRTRYSFAEQLFVPIREQLPENWPLPVDGVVETWHNDY--VPL 322

Query: 316 TFFHPEISQITKPGIVEAI--LE---------------------------SLSMLPEIV- 345
               P +    K G  E+   LE                           S++ L  +V 
Sbjct: 323 KRAKPGLGNKEKEGTTESTPALEETSGDNPSNSVNESGKRPLEEAREASASIAGLANLVN 382

Query: 346 ----------RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPEGDCAL 394
                     R  +  N+V TGG+ ++   A RL  EL ++LP   +    S    +   
Sbjct: 383 TAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALKFRILTSGHLRERQS 442

Query: 395 FGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
             W   S  +   ++ +  V R+EY E G +   K RF
Sbjct: 443 RAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 103/524 (19%), Positives = 173/524 (33%), Gaps = 147/524 (28%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRAL-NALAKDKFGTSYLSNHIKNIKDI---SSITF 57
           E   +VID GS+    G S    P   L +     K   +   +  K+   +    S+TF
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  RRPH-------ELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPE 110
            RP        E G +  W+     WD+ L N        L+  KG   + +ES     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXX 170
               + +V+ E  +F++ + S     V F                               
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSFATGRPN------------------------- 162

Query: 171 XXXXKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             LV+D G +     PV+ G+   ++ ++  I G+F+  L+ + 
Sbjct: 163 -----------------CLVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKY 205

Query: 231 LSFRH---------------------------YNMMDETILVNNIKEQCLFVSPVSYFDS 263
           L  R                            YN  +E       KE    ++P +  D 
Sbjct: 206 LQPREIIPLFEIAQRRPEFKKKNFEFNIDPSLYNFANERGFFQECKETLCQIAPTT-LDK 264

Query: 264 FK----TKDKHALEYVLPDF----QTSFLGYVRN---PRKENVP----LPEDAQIITLTD 308
           FK    +  K ++E    +       S  G+      P+ E++P    + +D  + T  +
Sbjct: 265 FKPELESTAKRSIEAPWTEEIVFDNPSRYGFAEQLFYPQSEDIPEGWPVSKDGIVETWHN 324

Query: 309 ELFTIPETFFHPEISQITKP-----------------------------------GIVEA 333
           +   +P     P  S+  KP                                   GI + 
Sbjct: 325 DY--VPLKRNKPSGSKPEKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELAGISDL 382

Query: 334 ILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVP 388
           +  S++     +R  +  NIV TGG+ ++P F+ RL  EL ++LP        T H+   
Sbjct: 383 VHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRER 442

Query: 389 EGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
           +    L G    S      S+ +  V + EY E G +     RF
Sbjct: 443 QYQSWLGG----SILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 10/146 (6%)

Query: 293 ENVPLPEDAQIITLTDELFTIPETFFHPEISQITK-----PGIVEAILESLSMLPEIVRP 347
           E+ P PE+A   T +    T  E    P I + +K      G+ + +  +++     +R 
Sbjct: 339 ESTPAPEEANGETPS---ATTNENGKRP-IEESSKTSDAIAGLADLVNTAITATDVDLRA 394

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPEGDCALFGWEVMSQFAKT 406
            +  N+V TGG+ ++P    RL  EL ++LP   +    S    +     W   S  +  
Sbjct: 395 TLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSGHLRERQSRAWLGGSILSSL 454

Query: 407 DSYRKARVTREEYYEHGPDWCTKHRF 432
            ++ +  V R+EY E G +   K RF
Sbjct: 455 GTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 69/356 (19%), Positives = 117/356 (32%), Gaps = 80/356 (22%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNA-----LAKDKFGTSYLSNHIKNIKDISSIT 56
           E   +VID GSY    G S    P   + +      A  K G    ++    I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFM-IMPRPDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W + + +  +F+ F     KG     +E+     E  K + 
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXXKN 176
           +V+ E  EF++ + +P A    F                                     
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSFAMG---------------------------------- 152

Query: 177 AQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH- 235
                       LV+D G +   + PV+ G+   K+  +  + G+ L  L++  L  R  
Sbjct: 153 --------RPTCLVLDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPREL 204

Query: 236 ---YNMMD----------ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTS 282
              Y +            E  +  ++ E   F +   +    K    H     LP FQ+ 
Sbjct: 205 VPLYKVERKRPEFVPKKFEFTVSKSVDE---FANSRGFLQECKETMLHVAAVELPKFQSE 261

Query: 283 FLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQ------ITKPGIVE 332
               +    K ++  P    II  ++  ++  E  F P          +TK G+VE
Sbjct: 262 ----LETTSKRSIEAPWGENIIFDSNARYSFAEQLFKPTKEMLPSDWPVTKDGVVE 313

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG  ++P    R+ AEL + LP   +    S 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 388 PEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
              +     W   S  +   ++ +  V ++EY E G     K RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 10/97 (10%)

Query: 292 KENVPLPEDAQIITLTDELF-----TIPETFFHP--EISQITK---PGIVEAILESLSML 341
           KE+ P P+       T E       T+ E    P  +IS+ TK    G+ + +  ++   
Sbjct: 345 KESTPQPKAEDTSATTTETLDNISDTVNENGKRPVDDISEPTKNDIAGLADLVYSAIIKS 404

Query: 342 PEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
              +R  +  N+V TGG+ ++P  + RL  EL R+LP
Sbjct: 405 DVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLP 441

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 328 PGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
           PGIV+ I  S+S     +R  +  N+V TGG+  +P  + R+  EL  + P
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFP 437

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 63/151 (41%), Gaps = 14/151 (9%)

Query: 278 DFQTSFLG-YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVE---A 333
           D++ S L  ++R PR  +         + L  E   +PE  F P +    + GI+E    
Sbjct: 582 DWRNSTLHLFLRGPRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCET 641

Query: 334 IL------ESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
           IL      E   + P  +   M  N+  TGGN  LP   +R+  E    LP     +V  
Sbjct: 642 ILTKKFGSEQRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVK- 698

Query: 388 PEGDCALFGWEVMSQFA-KTDSYRKARVTRE 417
              + +L  W  M++    ++ Y+   ++++
Sbjct: 699 QSYNPSLDAWNGMAKLTLNSEDYKNTIISKK 729

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 3/113 (2%)

Query: 321 EISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT- 379
           +I +IT  G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+ 
Sbjct: 378 DIKEIT--GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSL 435

Query: 380 DWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
            +    +    +     W   S      ++ +  V ++EY E G D     RF
Sbjct: 436 KFRILTTGHTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 83/237 (35%), Gaps = 58/237 (24%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G S      K I    SI   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N    D        G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNELYLDS-----NSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
           + +V+ E  +F++ + +P +  V F                                   
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPN----------------------------- 154

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  I G+F+  L+K+ +
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 80/210 (38%), Gaps = 20/210 (9%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNI 248
           LV+D G   + + P++ G     AV +    G FL   + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 249 KEQCLFV--SPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITL 306
           K+  L +  +  ++   FKT         L D  ++ L  +     +N  L +   I   
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTISLT 257

Query: 307 TDELFTIPETFFHPE-ISQ--ITKPGIVEAILESLS---------------MLPEIVRPL 348
             +   + E  F P  +SQ  +   G+ E + +S+                  PE     
Sbjct: 258 QKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQTHAA 317

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
           ++ NI+ TG +  +    QR+  +L  Q P
Sbjct: 318 LLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 86/237 (36%), Gaps = 58/237 (24%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G        KNI    SI   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N        L    G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  + G+F+  L+K+ L
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT 379
           G+   +  S+      +R  +  N+V TGG   +P  + RL  EL + LP+
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPS 434

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 59/293 (20%), Positives = 104/293 (35%), Gaps = 67/293 (22%)

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL------------- 231
            +  LV+D G +   + P++ G     AV +    G FL   + E L             
Sbjct: 137 RNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDS 196

Query: 232 ----SFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYV 287
               SF+++        +++ K   L VSP    +    +D  A  +   D +  FL   
Sbjct: 197 KVPESFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFLY-- 252

Query: 288 RNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQ---ITKPGIVEAILESL------ 338
              +K N  L  + +      E + + E  F P+++      K G+ E +++++      
Sbjct: 253 ---KKGNKTLTLEQR------ECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAA 303

Query: 339 --------------------------SMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAE 372
                                     +  PE +   ++ NIV TG    +P   QR+  E
Sbjct: 304 VTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNE 363

Query: 373 LQRQLPTDWTCHVSVPEG-DCALFGWEVMSQFAKTDSYRKAR-VTREEYYEHG 423
           L  Q P       + P   D  L  W+     +   S+     +TR+EY  +G
Sbjct: 364 LSYQFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 76/211 (36%), Gaps = 26/211 (12%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDE------- 241
           L++D G     + PV+ G     A+ +    G FL   + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 242 -------TILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNP---- 290
                     + + K   L V+P    D     D  AL+ +   +  +FL Y R      
Sbjct: 154 LELWRNSRTWIQDFKSYMLQVAPSKLQD----LDSAALDMMGLSYVKNFL-YRRQKTISL 208

Query: 291 -RKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESL--SMLPEIVRP 347
            +KE   L E     +   + F   E         + K G   A   S   +  PE +  
Sbjct: 209 MQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIHA 268

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
            ++ NIV TG +  +P   QR+  +L  Q P
Sbjct: 269 ALLTNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 7/108 (6%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT----DWTCH 384
           G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+      T  
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 385 VSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
            ++     +  G  +++      ++ +  V ++EY E G +     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLG---TFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 85/237 (35%), Gaps = 58/237 (24%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G        K I    SI   R+ 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N        L    G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  I G+F+  L+K+ L
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 9/93 (9%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVPEGDCALFGWEV 399
           +R  +  N+V TGG  ++P  + RL  EL + LP+       T H+   +    L G   
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRERQYQSWLGG--- 455

Query: 400 MSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
            S      ++ +  V ++EY E G +     RF
Sbjct: 456 -SILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 86/237 (36%), Gaps = 58/237 (24%)

Query: 2   ETPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G      + K +    SI   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N    D        G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALRNELYLDS-----NSGIPALLTEPVWNSMENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGXXXXXXXXXXXX 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 KNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  I G+F+  L+++ L
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + +  S+      +R  +  N+  TGG   +P  + RL  EL  +LP   +    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 388 PEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRF 432
            + +     W   S      ++ +  V R+EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 59/145 (40%), Gaps = 10/145 (6%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFL----TGLLKETL-SFRHYNMMDETI 243
           LVID G   T + P++ G      V K   GG FL      LL+E L S  H    +   
Sbjct: 148 LVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSAT 207

Query: 244 LVNNIKEQCLFV--SPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNP--RKENVPLPE 299
            +   K   L V    +S  + +        +        ++  Y+ NP  +K N  L +
Sbjct: 208 WIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKK 267

Query: 300 DAQIITLT-DELFTIPETFFHPEIS 323
           + + +TL   + + + E  F P+++
Sbjct: 268 NNKTVTLELRDCYRVCEYLFQPQLA 292

>TPHA0E00640 Chr5 complement(113447..116662) [3216 bp, 1071 aa] {ON}
            Anc_7.436 YPR030W
          Length = 1071

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 66/163 (40%), Gaps = 41/163 (25%)

Query: 17   FGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRR--------PHELGQLTL 68
            F   TN    RA+       F    LS+H+   KD+SS+   R        P  L   + 
Sbjct: 897  FASPTNSPRMRAM-------FSNDDLSDHLSLSKDVSSLNLNRTGEFVSTNPFHLNYSSN 949

Query: 69   WELESCI-----------WDYCLFNPSEFDGFD---LKEGKGHHLVASES--CMTLPELS 112
             ++ S +            D  L +P + DG D   +K G    LVA +   C+  P+  
Sbjct: 950  TDIASMVKSSQQFTTFDNLDDLLGSPKK-DGIDENLVKSGDSDSLVAIDVPYCLYSPDKK 1008

Query: 113  KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDE 155
            K   ++   E + + LFKS  + F P     KG   ++SG DE
Sbjct: 1009 K---KLTINESQPEGLFKSDYS-FKP-----KGSNHSLSGSDE 1042

>KLTH0H16016g Chr8 complement(1374529..1376652) [2124 bp, 707 aa]
           {ON} weakly similar to uniprot|Q03792 Saccharomyces
           cerevisiae YMR154C
          Length = 707

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 299 EDAQIITLTDELFTIPETFFHPEI---SQITKPGIVEAILESLSMLPEIVRPLMVGNIVC 355
           + A I T TD     P+ F +PEI   S+I+    V +++      PE V+   VG+   
Sbjct: 107 QHAPITTCTDRTQPPPKQFRNPEIEQNSRISDCSFVASLINIRCQCPEYVKVSRVGSSSV 166

Query: 356 TGGNFNLPNFAQRLAAELQRQLPTD 380
              N +    + RL       +P+D
Sbjct: 167 FNVNLHFNGASNRLVRVKLSNIPSD 191

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 45/102 (44%), Gaps = 7/102 (6%)

Query: 213 VKKLDIGGRFLTGLLKETLSFRHYNMMDE--TILVN--NIKEQCLFVSPVSYFDSFKTKD 268
           VKK DIG + LTGL    LS   Y+ + +  TIL    NI E+  FV      D  +T D
Sbjct: 729 VKKFDIGAQRLTGLGHILLS--QYSKLSQLGTILSKLLNISEEITFVEEYGP-DGVETVD 785

Query: 269 KHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDEL 310
            H             + +  NP +E++  P  + II   D L
Sbjct: 786 NHTELVRTELMDGDIITFAINPAEESLTYPFYSSIIEYYDYL 827

>NCAS0C01880 Chr3 complement(346987..349383) [2397 bp, 798 aa] {ON}
           Anc_8.587 YBR172C
          Length = 798

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 328 PGI-VEAILESLSMLP------EIVRPLMVGN-IVCTGGNFNLPNFAQRLAAELQRQLPT 379
           PG+ + ++LE L MLP      EI+   +  N  V  G  F      +R+  E Q   P 
Sbjct: 710 PGVSMNSVLEVLLMLPASASAKEIIADTIYANSTVMDGRRFATDFIKRRIECEKQLTDPL 769

Query: 380 DWTCHVSVPEGDCALFGWEVMSQ 402
            W   +S+PEG+   + ++V+S+
Sbjct: 770 SWKEALSLPEGNDDDWEFQVVSK 792

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,403,312
Number of extensions: 2184695
Number of successful extensions: 5214
Number of sequences better than 10.0: 153
Number of HSP's gapped: 5080
Number of HSP's successfully gapped: 223
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)