Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR084C (RAX2)8.256ON1220122058580.0
Smik_12.1438.256ON1220122048340.0
Skud_12.1528.256ON1220122148170.0
Suva_10.1688.256ON1220122046040.0
NDAI0B023808.256ON1219122726130.0
NCAS0B049808.256ON1204120525140.0
ZYRO0C01804g8.256ON1209121624490.0
TDEL0F038308.256ON1195120923770.0
Kpol_392.108.256ON1226123022840.0
SAKL0H17204g8.256ON1211123122770.0
KAFR0B026908.256ON1210122622640.0
TPHA0B032508.256ON1215121221220.0
TBLA0E043908.256ON1278126420240.0
KNAG0G020008.256ON1202123918910.0
Kwal_56.235898.256ON1213123218320.0
AGR095W8.256ON1201125117960.0
CAGL0L12144g8.256ON1156118617880.0
KLTH0G13838g8.256ON1214123217610.0
Ecym_43158.256ON1212124917400.0
KLLA0F18975g8.256ON1200123317260.0
Smik_10.1541.279ON33259753.0
YBR123C (TFC1)3.384ON649122763.5
TBLA0C061405.206ON2507124737.5
Skud_10.1261.279ON33859727.7
Suva_6.1601.279ON33782728.4
NCAS0B035408.313ON168330729.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR084C
         (1220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...  2261   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...  1866   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...  1860   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...  1778   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...  1011   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   972   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   947   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   920   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   884   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   881   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   876   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   822   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   784   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   733   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   710   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   696   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   693   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   682   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   674   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   669   0.0  
Smik_10.154 Chr10 (260576..261574) [999 bp, 332 aa] {ON} YJL088W...    33   3.0  
YBR123C Chr2 complement(484742..486691) [1950 bp, 649 aa] {ON}  ...    34   3.5  
TBLA0C06140 Chr3 (1485420..1492943) [7524 bp, 2507 aa] {ON} Anc_...    33   7.5  
Skud_10.126 Chr10 (236807..237823) [1017 bp, 338 aa] {ON} YJL088...    32   7.7  
Suva_6.160 Chr6 complement(281992..283005) [1014 bp, 337 aa] {ON...    32   8.4  
NCAS0B03540 Chr2 complement(622522..627573) [5052 bp, 1683 aa] {...    32   9.9  

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score = 2261 bits (5858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1146/1220 (93%), Positives = 1146/1220 (93%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS
Sbjct: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
            FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
            TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL
Sbjct: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXX 240
            IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSA            
Sbjct: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNST 240

Query: 241  XXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300
                      GQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE
Sbjct: 241  SSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300

Query: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360
            VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL
Sbjct: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360

Query: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420
            SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL
Sbjct: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420

Query: 421  ELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIP 480
            ELYQDTFSTYANDSLNEYGCSA              WYNGLTGESYIAAKYVPDQNEPIP
Sbjct: 421  ELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIP 480

Query: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540
            RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL
Sbjct: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540

Query: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600
            KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE
Sbjct: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600

Query: 601  TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR 660
            TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR
Sbjct: 601  TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR 660

Query: 661  ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF 720
            ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF
Sbjct: 661  ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF 720

Query: 721  NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS 780
            NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS
Sbjct: 721  NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS 780

Query: 781  GAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYFS 840
            GAVSHMQYGNLNGSVRF            GGIVPYLGAYLNESATAYAYEVDSLNKIYFS
Sbjct: 781  GAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFS 840

Query: 841  NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN 900
            NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN
Sbjct: 841  NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN 900

Query: 901  ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL 960
            ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL
Sbjct: 901  ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL 960

Query: 961  IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN 1020
            IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN
Sbjct: 961  IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN 1020

Query: 1021 QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS 1080
            QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS
Sbjct: 1021 QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS 1080

Query: 1081 LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXXX 1140
            LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVT          
Sbjct: 1081 LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPP 1140

Query: 1141 XXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200
                            IGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP
Sbjct: 1141 SSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1866 bits (4834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1220 (75%), Positives = 1037/1220 (85%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            MFVHRLWTLAF FL + SKASQL+NIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDA+S
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
            FY+YTGQQNFTK I P T+SHGLVYYSNNTYIQLEDASDDTRIDKITPFG DSFILSGSG
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
            TINNISVGNQILYNLSTLSM PIFNQSLG V+ VL +++S+YFGGNFSYNNGSM G+SAL
Sbjct: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXX 240
            +WD++S+T QLLPFGGFGENS+VNSI+KLN+DNI+FAG+FYTLDD S             
Sbjct: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNST 240

Query: 241  XXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300
                      GQRI LRYASWDSQGSTT AS+SLVCPN N +AWLYP TSGSLVCNLPYE
Sbjct: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300

Query: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360
            VSPTKIRLYNSQ + SEI++FQILT+PSSSIMNLTYLDPLSGELKNC EFCPLYSRATLL
Sbjct: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360

Query: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420
            +ASQN SSSMDMITFID N TDVKW+SDFQDFAF NELPV+SLK +ALNSYG S+GLSGL
Sbjct: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420

Query: 421  ELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIP 480
            ELYQ+TFSTYAN+SLNEYGCSA              WYNGLTGESYIA  Y+PDQNEPIP
Sbjct: 421  ELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIP 480

Query: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540
            RVKFYPNIIH GHYTIN YTPGC+QDNTCS+RGIVNVT+WN QNNT+MKTY IYQNNDNL
Sbjct: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540

Query: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600
            KYDQI+SGYLDFSPEIVLEY+SGIY++NTATVVVAD+VNVITVSLD FN LS+ +N K++
Sbjct: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600

Query: 601  TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR 660
            T LNGI QYQKSNFT T  N+TKVGNTTLNLFPV NYPKN+SL  +IY++KL++GGVSNR
Sbjct: 601  TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR 660

Query: 661  ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF 720
            IS +DLN++FE+ SS+N+TIQGDV+GITKT QGLLI+GD+ SS+NQS V LFN SF  V 
Sbjct: 661  ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP 720

Query: 721  NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS 780
            N S+ VNSA NIS+A+N+  V DN+Y++NASSNA I NS+SFSLSLWAAGNNG+GDVLFS
Sbjct: 721  NYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFS 780

Query: 781  GAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYFS 840
            G VSHM++ NLNGS  F             GIVPY GAYLNES +AYAYE D+LNKIYFS
Sbjct: 781  GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS 840

Query: 841  NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN 900
            N+V PSWNWS+ IT+MLYA+NQT+L VS+ SS+TA+L+IF+LRN+T IANETLGSNA+++
Sbjct: 841  NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS 900

Query: 901  ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL 960
            ALVNFEKN S+LVGGDFQ+T+PNC+GLCLYNYE+K+WSTF NNTIFGE+TQLS  NSSEL
Sbjct: 901  ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL 960

Query: 961  IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN 1020
            IISGLF T+E+QSIRLGSFNL N TM+PLLSGSEGKLNSF VT++S+VAWNDTSLFIY N
Sbjct: 961  IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN 1020

Query: 1021 QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS 1080
            Q+WNITSLP + S I SVS I T+ +S+TLNKR  NN ++GSILLLNGNF + QYG LQS
Sbjct: 1021 QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS 1080

Query: 1081 LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXXX 1140
            LLFDFQ WTPYFISE +N+SNYNP  FINRDVSTEFNSQ  L N+NITVT          
Sbjct: 1081 LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSP 1140

Query: 1141 XXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200
                            I RGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDYKPIKP
Sbjct: 1141 STSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1860 bits (4817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 918/1221 (75%), Positives = 1034/1221 (84%), Gaps = 2/1221 (0%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            MFVHRLWTL FPFL + SKASQL+NIKSLLDIEDNVLPNLNISQ+NSNAVQILGGVDALS
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
             YEYTGQQNFTKEI P T+S GLVYYSNNTYIQ+EDASDDTRIDKITPFG DSFILSGSG
Sbjct: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
            TINN+ +GNQILYNLSTLSM PIF+Q LG+V++VL + +S+YFGGNFSYNNGSMTG+SAL
Sbjct: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXX-XXXXXXX 239
            IWDSISN TQLLPFGGFGENS+VNSI+KLN+DNILFAG+FYTLDD SA            
Sbjct: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNS 240

Query: 240  XXXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPY 299
                       GQRIPLRYA+WD QGSTTF S+SLVCPN NEDAW+YP TSG+LVC LPY
Sbjct: 241  TSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300

Query: 300  EVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATL 359
            EVSPTK+RLYNSQ SD EISVFQILT+PS+SIMNLTYLDPLSG+LKNC EFCPLYSRATL
Sbjct: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360

Query: 360  LSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSG 419
            LSASQNVSS MDMI+F+DNN TDVKW+SDFQDFAF NELPV+ LKF A+NSYG SVGLSG
Sbjct: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420

Query: 420  LELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPI 479
            LELYQDTFSTYAN+SLNEYGCSA              WYNGL GESYIA +YVP+Q+EP 
Sbjct: 421  LELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPT 480

Query: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539
            PRV FYPNI+HPGHY IN YTPGC+QD+TCS+RGIVNVTMWN QN T+MKTY IYQNNDN
Sbjct: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540

Query: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKK 599
            LKYDQIYSGYLDFSPEI+LEYVSGI+T+NTATVVVADQVNVITV LDAF+TLS+S+N K+
Sbjct: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600

Query: 600  ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSN 659
               LNG+LQYQKSNFTST  NETK+GNTTLN+F V NYP NSSL+AD   ++L++GG +N
Sbjct: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660

Query: 660  RISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENV 719
             ISI+ LND+ EV  S+ Q IQGDVHG+T+T+QGLLIFGD+LSSNNQS+V LFNGSFENV
Sbjct: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENV 720

Query: 720  FNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLF 779
            FN SRTVNSA+NISLANND IV DNDY+VN SS+A I NS+SFSLSLW+AG+NG+ DVLF
Sbjct: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780

Query: 780  SGAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYF 839
            SGAVS MQ+G LNGS RF              +VPYL AYLNES TAYAYE + LNKIYF
Sbjct: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840

Query: 840  SNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARI 899
            SN V PSWNWS+ IT+MLYA+NQ+LL V + SSTTAELSIF+L+N TMIANET+GSNA+I
Sbjct: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900

Query: 900  NALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSE 959
            NALVNFEKN S+LVGG+FQM++PNC+GLCLYNYESK+WSTF NNT FGEITQLSF+ +S+
Sbjct: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960

Query: 960  LIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYR 1019
            L+ISGLF+T+EYQS+RL SFNLTNSTMIPLL+G+EGK+NSF VTE+SIVAWNDTSL IYR
Sbjct: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020

Query: 1020 NQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQ 1079
            +QEWNITS+PGN SSI SVS I T+    TLN+R  NN  NG+ILLL+GNF+I  YG LQ
Sbjct: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080

Query: 1080 SLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXX 1139
             LLFDF+ W+PYF+SE++NTSN NP IFINRDVSTEFNSQ PL+N+N+T T         
Sbjct: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTET-GPQSASSQ 1139

Query: 1140 XXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199
                             I RGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK
Sbjct: 1140 FPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PRIDENEMLDTVPPEKLMKFV
Sbjct: 1200 PRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1778 bits (4604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 878/1220 (71%), Positives = 1015/1220 (83%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            MFVHRLWTLA P L   SKASQL++IK+LLDIEDNVLP+LNISQ+N NA+QILGGVDALS
Sbjct: 1    MFVHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
            FYEYTGQQNFTKEIG ET+S GLVYYSNNTYI LE+A +DTRIDKITPFG DSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
            +IN + +GNQ+LYNLSTLSM  IF QSLG+V+AVL +++S+YFGGNFSYNNGSMTG+ AL
Sbjct: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXX 240
            +WDS SNTTQLLPFGGFGE+S+VNSIVKLN+DNILFAG+FYTLDD S             
Sbjct: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNAS 240

Query: 241  XXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300
                      GQRIPLRYASWDSQGSTTF S  LVCP+T++DAWLYP TSGSLVC LPYE
Sbjct: 241  STLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE 300

Query: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360
            V+PTKIRLYNS  SD++IS+FQILT+PS SIMNLTYLDP+SGEL++C EFCPLYSR TLL
Sbjct: 301  VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL 360

Query: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420
            SASQNVSSS+DMI+FIDNN TDVKW+SDFQDFAF NEL V+SLKF ALNSYG  VGLSGL
Sbjct: 361  SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL 420

Query: 421  ELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIP 480
            ELYQDTFSTYAN+SLNEYGCSA              WY+GLTG+SYIA  YVP+Q +P P
Sbjct: 421  ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP 480

Query: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540
             V FYP+IIHPGHYTIN YTPGC+QDNTCS+RGIVNVTMWN QNNT+M+TYLIYQNN+NL
Sbjct: 481  TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL 540

Query: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600
            KYD+IYSGYLDFSPEIV++YVSGIY +NTAT++VADQVN+IT SLD+F++LS++++ K+ 
Sbjct: 541  KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH 600

Query: 601  TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR 660
            T LNGILQYQ+SNFT+T  N TK+ NTTLNLF V NYPKNSS++AD+YD KL++GG  N 
Sbjct: 601  TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH 660

Query: 661  ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF 720
            IS++D ND+ EVTSS+N+TIQGDV+G+T+TNQGLLIFGD+ SS+N+S V +FNGSFE+V 
Sbjct: 661  ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS 720

Query: 721  NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS 780
            N S+ V +A+NI+LANND IV +NDY+ NASSN+ I NS+SFSLSLW+AGNN + DVLFS
Sbjct: 721  NYSKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFS 780

Query: 781  GAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYFS 840
            GAVS MQ+ +L+GS RF             GIVPYLGAYLNES  AYAY+ +SL+KIYFS
Sbjct: 781  GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFS 840

Query: 841  NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN 900
            N V PSWNWS+ IT+M+YA+NQTLL + + SSTTAELSI +LRN T IANETLGSNA+IN
Sbjct: 841  NNVSPSWNWSNNITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN 900

Query: 901  ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL 960
            A VNFEKN S+LVGGDFQM++PNCTGLC+YNYESK+WSTF NNTI GEITQL+F N SEL
Sbjct: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960

Query: 961  IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN 1020
            IISGLF T++ QSIRLGSFNLTNSTM+PLL+GS GKLNSFTVTE+SIVAWNDTSL IY++
Sbjct: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020

Query: 1021 QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS 1080
            Q+WN TSLPGN SS+SSV+ I T+ +S  L KR   +   GSILLLNGNF+I QYG LQ 
Sbjct: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080

Query: 1081 LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXXX 1140
            LLFD Q WTPYF SET   S+YNP IFINRDVS +FNSQ PL+N N+TVT          
Sbjct: 1081 LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLSP 1140

Query: 1141 XXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200
                            + RGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDY+PIKP
Sbjct: 1141 SSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1227 (43%), Positives = 800/1227 (65%), Gaps = 25/1227 (2%)

Query: 7    WTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTG 66
            W   F  L+ I +ASQL NIK++L++ +  +P LN++ +N +  Q+LG +D LSFY Y G
Sbjct: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64

Query: 67   QQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNIS 126
            QQNFT  I P ++S+GL+YYSNNT IQLE+ S+DT I KITPFG DSFILSG+G+++  S
Sbjct: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYS 124

Query: 127  VGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSIS 186
            + NQ+LYNL+TLS+ PIFN S+  V+ +L D+S +YFGGNF+  NG+   +S ++WDS S
Sbjct: 125  LTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184

Query: 187  NTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXX 246
            ++T+ L FGGFGENS +NSIVKLN+DNILFAG+FYTLD+P                    
Sbjct: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPD--FLIQNTTSSQNNIFNST 242

Query: 247  XXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKI 306
                GQ +PL  ++WD+ G +TF SD+ VCP+T E++W+   T+GSL C LP+EV+PTKI
Sbjct: 243  TVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKI 301

Query: 307  RLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNV 366
            R+YNS   D+++S+F+ILT+ +  IMNLTY+DP+S ELK+C  FCPLYS+A L  A  N 
Sbjct: 302  RIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANT 361

Query: 367  SSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDT 426
            +S  D I  + +N TD+KWT +FQ+FAF+N++ VSS++FVAL+SYG +V LS  +LYQ+ 
Sbjct: 362  TSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNA 421

Query: 427  FSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYP 486
            ++ +AND+LNE  C++              W  GLTG++YI+  Y P+Q +P+P V F P
Sbjct: 422  YAVFANDTLNEPNCNS-IESSSSSSLSANDWEMGLTGQTYISTTYTPNQ-DPVPYVSFSP 479

Query: 487  NIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIY 546
             I +PG Y+IN+YTPGC QD+TCS+R IVNVT+W+    +I+ T LIYQNN  LKYD++Y
Sbjct: 480  QIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELY 539

Query: 547  SGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGI 606
            SGYL  SP + +EYVSG+Y +NT   VVAD++NV+  SL+     S+ +N  +   LNG+
Sbjct: 540  SGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGL 599

Query: 607  LQYQKSNF--TSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIY-DNKLVIGGVSNRISI 663
            LQYQ SNF  +S+   + K+ NT+LN   ++ + KN+S+YAD+Y DN L++G  +  I +
Sbjct: 600  LQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKV 659

Query: 664  VDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENV--FN 721
            V LN++ ++ SS   ++ G+  G +  + G+L +G+   S+  + +  +NG+F  +  FN
Sbjct: 660  VKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFN 719

Query: 722  QSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSG 781
            ++ ++ + +N+++ + + +V+DN  + N SS++ I NSS+  LSLW++G+N + D +FSG
Sbjct: 720  KNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSG 779

Query: 782  AVSHMQYGNLNGSV----RFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKI 837
            A++ + Y +LNGS+     F              +  Y G +LN+S + YA + DS +++
Sbjct: 780  AIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSL--YTGLFLNDSLSIYASKTDSYSEL 837

Query: 838  YFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGS-STTAELSIFDLRNLTMIANETLGSN 896
             FSN     W++  GI  M+Y+ +QT+LAV++   +  +ELSI +L     IANETL  N
Sbjct: 838  LFSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVN 897

Query: 897  ARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTN 956
            ++IN L+NFE N +++VGG+F + + NC+GLCLYNY+S  W TF N++I G I Q+   N
Sbjct: 898  SKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELIN 957

Query: 957  SSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLF 1016
             ++L++SGLF  +   S+ L   +L+   +  +  G    L SF    D I+ WN   L 
Sbjct: 958  GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLE 1017

Query: 1017 IYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYG 1076
             Y N  W  +++  N +S +++ +I       TL KR      +G   ++NGN   ++YG
Sbjct: 1018 SYENGAW--STIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADG--FIINGNIYDTEYG 1073

Query: 1077 YLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVN---ITVTXXX 1133
             +Q+++++F++W PY+I  +TN S     IF+NRD S  +NSQS L N N   +T     
Sbjct: 1074 TIQAMIYNFKEWRPYYIISSTN-SQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSST 1132

Query: 1134 XXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEG 1193
                                   I RGFVVLIGLALALGTVS+LGI G++LAY+FKD +G
Sbjct: 1133 SSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDG 1192

Query: 1194 DYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             +  + PR +E+EML+TVPPEKLMKF+
Sbjct: 1193 SHDALNPRTNEDEMLETVPPEKLMKFL 1219

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1205 (44%), Positives = 793/1205 (65%), Gaps = 22/1205 (1%)

Query: 20   ASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETS 79
            ASQL +++  L+I    +PNLN++ ++ N+ ++LGG+D+LSFY YTGQQNFT  I P ++
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTDD-NSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76

Query: 80   SHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLS 139
            S+GL YYSNNT+IQL + S D+RI++I PFG DSFILSG G++   S+ NQ+L+NLS+ S
Sbjct: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 140  MTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGE 199
            +  IFNQ+L +V ++L D + + FGGNF+ +  S+ G+S  +W+  +N+T LLPF GFGE
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 200  NSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXXXXXXGQRIPLRYA 259
            NS +NSI KLN+DNILFAG+FYTLD+ +                       GQ IPL  A
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNST------LLNVVNDTMRNISDINLGQLIPLSAA 250

Query: 260  SWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEIS 319
            +W S GS  F  ++ VCP+   +AW    TSG+L CNLP++V+PTKIR+YNS   D+EIS
Sbjct: 251  TWSSTGS-FFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309

Query: 320  VFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNN 379
            +F+I +DPS SIMNLTY+DP+ G+LK+C  FCPLY++  L SAS+NV+ S +MI  +++N
Sbjct: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369

Query: 380  KTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYG 439
             +D++W+ DFQ+FAFVN+L  SSL+F+ALNSYG +VGLS  ++YQD ++ +AN+SLNE  
Sbjct: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPS 429

Query: 440  CSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMY 499
            C++              W  G+  ++Y+   Y+P Q   +P V F+P++ + G Y+I +Y
Sbjct: 430  CNS-LESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKYSGQYSIELY 487

Query: 500  TPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLE 559
            TPGC QDNTCS+RGIVNVT+WN  NN+I+ T LIYQNND LKYD++YSGYL++SP+I + 
Sbjct: 488  TPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVT 547

Query: 560  YVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTSTRL 619
            Y SGIY+  TA  VV D++N++  SLD  N + +S+N+ +   LNG+ QYQ SNF+++  
Sbjct: 548  YHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE---LNGLFQYQLSNFSTSSK 604

Query: 620  NET--KVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKN 677
            + +  +V NT++N   +  +  N SL A +Y++ L++G   + +SI +LN D  + SS  
Sbjct: 605  DSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQ 664

Query: 678  QTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVNSALNISLANN 737
            Q I+G + G+   + G+L++GD  SS   S V  FNGSF+++ N +  + +  NI++ ++
Sbjct: 665  QGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDS 724

Query: 738  DFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRF 797
            + +V DN+ + N SS++ I N+SSFSLSLW++G+N +GD LFSGA+S +Q+ NL+GSV  
Sbjct: 725  ELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSI 784

Query: 798  XXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVD-SLNKIYFSNEVYPSWNWSSGITQM 856
                        G   PY   +LN+S T Y  + D S +++ FS+     W W+  +  M
Sbjct: 785  ANNLSATSLRSIGS--PYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSM 842

Query: 857  LYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGD 916
            LY  NQ++LAV + SS   ELSI +L +  ++ANETL  N+ +  +V+FE+N S+LVGG+
Sbjct: 843  LYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGN 902

Query: 917  FQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRL 976
            F ++   C GLCLYNY    W TFLN TI G IT+L   N S+LII+G+F+TK   S+ L
Sbjct: 903  FSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNL 962

Query: 977  GSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSIS 1036
               NLT++ ++ +  G +  +  F   +D+I AWN+TSLF Y +  W    +  + SS +
Sbjct: 963  ALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSSTT 1022

Query: 1037 SVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYF-ISE 1095
              S  +T    N L KR  N+  + ++L++ G    + YG++Q+++++F++W PY  I+ 
Sbjct: 1023 IDSIGWTTTTDNNLKKRD-NSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINS 1081

Query: 1096 TTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXXXXXXXXXXXXXXXXXX 1155
              +++N    +FI+RDVS  F+SQ  L   N T +                         
Sbjct: 1082 LVSSANQPAELFIDRDVSKLFDSQLALQVSNTTAS--ITASSSTPTPTSSPKKKLHQSKK 1139

Query: 1156 XIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEK 1215
             I RGFVVLIGLALALGT++VLGI GVILAY F+D +GDY  I PR++E+EML TVPPEK
Sbjct: 1140 KIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEK 1199

Query: 1216 LMKFV 1220
            LM+F+
Sbjct: 1200 LMEFI 1204

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1216 (42%), Positives = 749/1216 (61%), Gaps = 17/1216 (1%)

Query: 9    LAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQ 68
            L+F FL+ I+  SQL +++ LL+  +  +P L+++ + + A+++LG    L+FY+YTGQ+
Sbjct: 7    LSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQE 66

Query: 69   NFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVG 128
            NFT  +   T SHGL+YYSN+T++QL + S+DT I +I P G DSFILSGSG I+  ++ 
Sbjct: 67   NFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQ 126

Query: 129  NQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNT 188
             Q+ YNL+ LS  PIF + L  V ++L D   +YFGGNF+++NGS TG+S ++W+S  N+
Sbjct: 127  RQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNS 186

Query: 189  TQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXXXX 248
            T LLPF GFG+NS+VNSI++L+ DNILFAG FY LDD                       
Sbjct: 187  TSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDV 246

Query: 249  XXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRL 308
              G  IPL+ A+W S  S+ F +D  +CP+   ++WL   TSGSL C+LP E +P KIR+
Sbjct: 247  ELGLAIPLQNANWTSS-SSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRI 305

Query: 309  YNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSS 368
            YNS   D+E+S+F+IL +P+  I+NL+Y+DP  GEL+ C  FCPLY+R  L  AS N SS
Sbjct: 306  YNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSS 365

Query: 369  SMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFS 428
              +M TF DNN TD+KW  DFQ+FAFVN +P+SS++FVAL+SYG +VGLS  + +Q   S
Sbjct: 366  VENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRAS 425

Query: 429  TYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNI 488
             YAN+SLN+  C                W  GL G++Y++  YV DQ   IPRV F+P I
Sbjct: 426  IYANNSLNQPAC-GKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQI 483

Query: 489  IHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSG 548
             +PG+Y+I +YTPGCL D TC+ R IVNVT+W+  +N  + + +IY+NN+ LKYD+++ G
Sbjct: 484  QYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDG 543

Query: 549  YLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQ 608
            +L  SP++ LEY S IY  N  +VVVAD +++   S D F         KK+  LNGI Q
Sbjct: 544  HLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHF------EKHKKDITLNGIFQ 597

Query: 609  YQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNK-LVIGGVSNRISIVDLN 667
            YQ SNFT     E+ +GNT+L++FP+  +  NSSL+A +Y+N  L++    ++ + + L+
Sbjct: 598  YQISNFTKNITKES-IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLD 656

Query: 668  DDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVN 727
             ++ V SSK+  +   V GI   + GL++FGD  SS  Q     FNGSF +    +R+V 
Sbjct: 657  KNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVE 716

Query: 728  SALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQ 787
               NI L   + +V DN++  N SS + + N++ FSLS+W+AG N +GD++FSGAVS   
Sbjct: 717  RFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDND 776

Query: 788  YGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSW 847
            Y NL G V                I PY+GAYLN++ TAYAY+  S ++I FSN     W
Sbjct: 777  YENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPW 836

Query: 848  NWSSGITQMLYADNQTLLAV-SAGSSTTAELSIFDLRNLTMIANETLGSNARINALVNFE 906
             W++ I  M+Y +   LLA+ ++ S +  +LS+ +L    ++ANETL   A +N+++ F 
Sbjct: 837  RWTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILFG 896

Query: 907  KNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLF 966
            KN ++L+GG+F  ++ +C GLCLYNY++K WSTF N++I G++TQ+   NSSEL+I+G  
Sbjct: 897  KNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSL 956

Query: 967  ETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNIT 1026
                   + L S N+T   M  LL G EG L SF V+ED +V WNDTSL  Y N  W   
Sbjct: 957  RVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHI 1016

Query: 1027 SLPGNASSISSVSAIYTDIESNTLNKRGINNVN-NGSILLLNGNFNISQYGYLQSLLFDF 1085
            S   N++S + +  I+     ++L KR  ++ N N   LL+ GN + +Q    Q+ ++D+
Sbjct: 1017 S-TSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGN-DKTQGDSYQASIYDY 1074

Query: 1086 QKWTPYFISET-TNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXXXXXXX 1144
              WTP FI+ + +  SN  P IF+N+DVS  F S+  L N     T              
Sbjct: 1075 YSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNP-TNHTSSRSSSSSSSAVTS 1133

Query: 1145 XXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDE 1204
                        + RG+VVLIGLALA+GTV V+G+ G+++AY+F +  G Y+ + P  + 
Sbjct: 1134 NSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEG 1193

Query: 1205 NEMLDTVPPEKLMKFV 1220
             +  +T PP K  KF+
Sbjct: 1194 TKAAETAPPAKSSKFL 1209

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1209 (42%), Positives = 747/1209 (61%), Gaps = 28/1209 (2%)

Query: 15   VEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEI 74
            V +S ASQLEN+K+   I +   P L+       A+Q+ GG +AL+F +Y GQ+NFT  I
Sbjct: 12   VCLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLFGGFNALTFPQYEGQENFTGTI 68

Query: 75   GPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYN 134
               T S G+VYYSN+T+I+L + S D+ ++KI PFG +SFIL GSG++    +G Q+LYN
Sbjct: 69   NNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYN 128

Query: 135  LSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPF 194
            LS LS+ PIF  SL  V+ +L D    YFGGNFS++NGS  G+S   W+S SNTT LLPF
Sbjct: 129  LSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPF 188

Query: 195  GGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXXXXXXGQRI 254
            GGFGE S VNSI+KL++DNILF G+FYTLDD +                        + +
Sbjct: 189  GGFGEESIVNSIIKLDSDNILFTGEFYTLDDQT----LLITNENTSKTNHSQSIEINELL 244

Query: 255  PLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRS 314
            PLR A+W++   ++F S + +CPN+ ++AW  P TSGSL  +LPYE  P K+R+YNS   
Sbjct: 245  PLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEE 304

Query: 315  DSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMIT 374
             + +S+F+I+T PS+ IMNLTY+DPLSGEL NC  FCPL  + +L +A  N ++S   + 
Sbjct: 305  HNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS--QVV 362

Query: 375  FIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDS 434
             +DNN TD++W+ D+QDFAFVN++ V+ L+F+AL+SYG +VGLS  +LYQDT +TYAN+S
Sbjct: 363  RLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNS 422

Query: 435  LNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHY 494
            LNE GC +              W  GL G+SY+ A +   Q E +P+V FYP I + G Y
Sbjct: 423  LNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVTFYPAINYAGQY 480

Query: 495  TINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSP 554
            T+N+YTPGC  D TC++R IVNVTMW++   +I+ + L++QNN+ +KYDQ+YSG+L+ +P
Sbjct: 481  TMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAP 540

Query: 555  EIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETL-LNGILQYQKSN 613
             + LEY S I   N + VVVAD++ VI  S+D     +D      ET+ LNG+ QYQ SN
Sbjct: 541  VLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTD------ETIPLNGMFQYQLSN 594

Query: 614  FTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVT 673
            FT++  ++  + NTTLN + V+N+PKN+SL++ +Y+N L +GG  + ++ V+L++D  V+
Sbjct: 595  FTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVS 654

Query: 674  SSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVNSALNIS 733
            S+      G V GI+  + G+++FG    S+   +   FNG F +  N   T+ +  N+S
Sbjct: 655  STAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVS 714

Query: 734  LANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNG 793
               ++ +V +N+YV N SSN+ I NSS+F LSLW+AG N   D LFSGAV+  Q+  L G
Sbjct: 715  FQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYG 774

Query: 794  SVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGI 853
            S                G  PY   +LN+S TAYAY   S++++YF N     W W   I
Sbjct: 775  SASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTI 834

Query: 854  TQMLYADNQTLLAVSA-GSSTTAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSML 912
              M Y+ N T+LA+   GS+    LS+F+L +  ++AN T+  N  I+++V F++N S+L
Sbjct: 835  NSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLL 894

Query: 913  VGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQ 972
            VGGD+ +++ +C+GLCLYNY+ K W+ F NN+I G IT++  + S +L+ISG        
Sbjct: 895  VGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKT 954

Query: 973  SIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNA 1032
            S+ L SFN++N  + PL+  S G + SF   ++ I+ WN+TSL  Y + +W       N+
Sbjct: 955  SVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEF-DNS 1013

Query: 1033 SSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYF 1092
            S IS V  I    E   L+KR   +    +IL+   N+      Y Q+ +++FQ+W PY+
Sbjct: 1014 SLISIVDVIAVKTEP-ALDKRQTFSSTFDAILVAGQNYA----EYPQASIYNFQRWLPYY 1068

Query: 1093 ISETTNTSN-YNPIIFINRDVSTEFNSQSPLANVNITVTXXXXXXXXXXXXXXXXXXXXX 1151
            ++   +  +      F N+D S  ++SQ+ L +     T                     
Sbjct: 1069 VANKADDEDPSRTTFFTNQDDSQLYDSQN-LLSDPTRTTTSSSSSTTSSSQTSPSKGSLV 1127

Query: 1152 XXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTV 1211
                 I RGFVVLIGLALALGTV ++GI GV+LA VF    G Y+ + PR DE+EM+DTV
Sbjct: 1128 RKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTV 1186

Query: 1212 PPEKLMKFV 1220
            PPEKL+KF+
Sbjct: 1187 PPEKLLKFL 1195

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1230 (40%), Positives = 751/1230 (61%), Gaps = 20/1230 (1%)

Query: 3    VHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFY 62
            + RL +L    ++ +S+ASQL N+K  L I    +P +N   N +N +QIL  ++ L+FY
Sbjct: 5    IVRLISLG---IIGVSQASQLTNVKDSLGINTVNIPQINFG-NTNNEIQILSNIEGLTFY 60

Query: 63   EYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTI 122
            +Y GQQNFT  I   +++HGL+YYSN+T I+L + SD+T+ID+I P   D+FILSGSGT+
Sbjct: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120

Query: 123  NNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIW 182
                + NQ+LYNLS LS+ P+FN  L  ++++L D   +YFGGNFSY + + T  S + W
Sbjct: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180

Query: 183  DSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPS---AXXXXXXXXXXX 239
            + ++    +LPF GFG+NS+VNSI+KL+ DN+LF G F TLDD S   +           
Sbjct: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNST 240

Query: 240  XXXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPY 299
                        Q+I L+YASW S G    +S   +CPN   +AW    T+G + CNL +
Sbjct: 241  SSSSTETNLELEQQISLKYASWASLGDLK-SSTQFICPNGQNEAWSSAGTTGEITCNLAF 299

Query: 300  EVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATL 359
            E S +KIR++NS     +I+ F+I+T PS+ IMNLTYLDPL+ E+K C  FCPLYS   L
Sbjct: 300  EASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNAL 359

Query: 360  LSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSG 419
             ++S+N ++S     FI+ NKT++ W++D+Q+FAFVN++PV++L+ +AL SYG +VGLSG
Sbjct: 360  QASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSG 419

Query: 420  LELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPI 479
             +LYQ+++S +AN+SLNE  C +              WY GL  +SYIA KY P  ++P 
Sbjct: 420  FQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG-DDPS 478

Query: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539
            P V FYP+I   G+YT+N+YTPGC  D TCS RGIVNVT+W+   N ++ T LIYQNN+ 
Sbjct: 479  PLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNE 538

Query: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSD--SSNA 597
            +KYDQ++ G+LD++P++ LEY SGI   N+  VVVAD V+++ ++++   T+ +  SS  
Sbjct: 539  MKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTE 598

Query: 598  KKETLLNGILQYQ-KSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGG 656
            + +  LNG+ QYQ  +  +S   +  KV NT+LNLFPV  +  + SLY   Y+  L++GG
Sbjct: 599  ELKVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGG 658

Query: 657  VSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSF 716
                +  + L++   + S++     G+V G      G+++FG+   SN   +   +NG+F
Sbjct: 659  SIAGVYALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTF 718

Query: 717  ENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGD 776
            ++  N +  + +  N++   ++ +  +N+Y  N S+++ I N+S+ SLS+W+AG+N  GD
Sbjct: 719  DSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGD 778

Query: 777  VLFSGAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNK 836
             LFSG ++  ++ NLN S                GI PYLG YLN+S TAY Y+  S + 
Sbjct: 779  TLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSN 838

Query: 837  IYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSS--TTAELSIFDLRNLTMIANETLG 894
            I FSN +  +WN    ++   Y+DN+T+   S+ S+  + AEL + +   + ++ NET  
Sbjct: 839  ILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFD 898

Query: 895  SNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSF 954
             N+ IN++V+F +N S+LVGGDF     NC+ LCL N  +  WS+F +N   G IT L F
Sbjct: 899  VNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSF-SNKFDGTITGLEF 957

Query: 955  TNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTS 1014
             N S L+ISG +  +    I LG  +L N     LLS S+ K+NSF     +IVAW+ ++
Sbjct: 958  ANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSST 1016

Query: 1015 LFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQ 1074
            ++ YR   W+   +P   SS S  +       +N+L+    +N  N  ++L+ G      
Sbjct: 1017 IYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSED 1076

Query: 1075 YGYLQSLLFDFQKWTPYFISETTNTSNYNP-IIFINRDVSTEFNSQSPLANVNITVTXXX 1133
            YG++Q++ +DFQ W PY+I++  ++ N +   +F+N+D+S  + SQ  L N N T++   
Sbjct: 1077 YGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISS 1136

Query: 1134 XXXXXXXXXXXXXXXXXXX---XXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKD 1190
                                      I RG+VVLIGLALA+GTV++LGI GV +AY+F D
Sbjct: 1137 TSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSD 1196

Query: 1191 PEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             +G+Y  IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1197 DKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1231 (41%), Positives = 736/1231 (59%), Gaps = 57/1231 (4%)

Query: 14   LVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKE 73
            L ++   SQL ++K  L+I+D  +P +++S + ++ + +LG  + L+FY YTGQ+NFT  
Sbjct: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73

Query: 74   IGPETSSHGLVYYSNNTYIQLEDASDD---TRIDKITPFGVDSFILSGSGTI-NNISVGN 129
            I  ET    L+YYSN T+I+L+  SD+     I+ I PFG DSFILSG+GT+    ++  
Sbjct: 74   I-TETEKD-LIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQ 131

Query: 130  QILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTT 189
            Q+LYNLS+L  T IFNQS+  V  +LAD+  +YFGG F Y  G+ TG+S ++W+S +N  
Sbjct: 132  QLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEI 191

Query: 190  QLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXXXXX 249
            QLLPF GFG +S VNSI++L+NDNI+FAG+F TLDD +                      
Sbjct: 192  QLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATDIEFD-- 249

Query: 250  XGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTS-GSLVCNLPYEVSPTKIRL 308
              Q IPL++A W SQGS      SL+CP+ + D W    T+ G    +L  ++ P+K+R+
Sbjct: 250  --QLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRI 305

Query: 309  YNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSS 368
            YN+  SD ++S+F+I+T P++ IMNLTYLDP +GEL  C  +CPL S   L  A  NV+ 
Sbjct: 306  YNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTI 365

Query: 369  SMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFS 428
            S D + +I NN T++KWTS +Q+FAFVNE+ V SL F+AL+SYG SVGL G E+YQ+ + 
Sbjct: 366  SSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYP 425

Query: 429  TYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNI 488
            T+AND+LN+  C                W  G    SYI + Y  D    +P V FYPNI
Sbjct: 426  TFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY--DGTGDLPSVNFYPNI 483

Query: 489  IHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSG 548
             + G YT+NM TPGC  D +CS+RGIVNVT+W+Q N+T++ T LIYQNN++ KYD +YSG
Sbjct: 484  TYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSG 543

Query: 549  YLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLD----AFNTLSDSSNAKKETLLN 604
            YL+ +P+I L++   I T ++ +++VAD+V+VI  S+D       T++++        LN
Sbjct: 544  YLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET--------LN 595

Query: 605  GILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIV 664
            G+ QYQ SNFT+   +  K+GNTT+N + ++N P NS L+A  Y+N L++ G  N I+++
Sbjct: 596  GLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVL 655

Query: 665  DLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSR 724
             LNDD  + S +     G   GI   + GLL  GD   S+ Q +   +NG+F +  N   
Sbjct: 656  QLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRT 715

Query: 725  TVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVS 784
             +    NI++ +++ +V +N Y+ N SSN  IRN+SSF+LSLW+AG+N   D +  GAVS
Sbjct: 716  NITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVS 775

Query: 785  HMQYGNLNGSVRFXXXXXXXXXX--XXGGIVPYLGAYLNESATAYAY--EVDSLNKIYFS 840
              QY  LNG+V                 G   Y   Y+N+S+TAYAY  + DS + +  +
Sbjct: 776  QRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIA 835

Query: 841  ----NEVYPSWNWSSGITQMLYADNQTLLAV--SAGSSTTAELSIFDLRNLTMIANETLG 894
                +E  P  +WS  +  M+Y  + +LLAV  +AG +    LS+F++ N  MI  E LG
Sbjct: 836  RGNRSEDLPV-SWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLG 894

Query: 895  SNARINALVNFEKNCSMLVGGDFQMTEPN--CTGLCLYNYESKTWSTFLNNTIFGEITQL 952
            + + +NA+V F KN S+LVGGDF + + +  C+GLCLYNY +  WS F NN+I G IT L
Sbjct: 895  AKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDL 954

Query: 953  SFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSE--GKLNSFTVTEDSIVAW 1010
             F N ++L+ISG   T+    I L   N+ ++ +  L  GS       +F  T D ++  
Sbjct: 955  QFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQ 1014

Query: 1011 NDTSLFIYRNQEW-NITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGN 1069
            +D  +  Y N EW N+TS   N S       I       T +KR ++N      LL+NG+
Sbjct: 1015 SDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPL---KQTSSKRDVSN----RALLVNGD 1067

Query: 1070 FNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITV 1129
               S YG + ++L+DF+ W PYFI +  N    +  IF+N+D+S+ + +Q+ L   N + 
Sbjct: 1068 LKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRASN-IFMNKDLSSLYTTQTILQGSNTST 1126

Query: 1130 TXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFK 1189
            +                          I RGFVVLIGLALA+GTV+VLG AG I+AY F 
Sbjct: 1127 S------TTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFA 1180

Query: 1190 DPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
              +G Y+P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1181 GNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1226 (42%), Positives = 755/1226 (61%), Gaps = 22/1226 (1%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            M  H     +      +S ASQL  +++ L I+    P L  S NN +++Q+LG  DALS
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
             Y YTGQQNF+ +I P+T+S+GLVYYSNNT IQL    DDTRI+ I P G DSFILSGSG
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
            ++N  S+ NQ+ YNLS+LS+ PIFN +L  V+++L D   +YFGGNF+++NG+  G+S  
Sbjct: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXX 240
            +W+  SN+T LLPF GFGENSS+N+I++LN+DNILFAG+FYTLDD S             
Sbjct: 181  VWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDAS-----LLTSNTSN 235

Query: 241  XXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300
                         +PL  A+W S  S  F + S +C N + DAW    T+G+L C+LPY+
Sbjct: 236  ATTNIYDLELSPLLPLNEATWSSDVS-DFDASSFICVNPDSDAWFVSGTTGTLACSLPYD 294

Query: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360
             + TKIR+YNS  S ++IS F++++DPS SIMN+TY+DP +G L++C  +CPL SR TL 
Sbjct: 295  SALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLS 354

Query: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420
            SAS   +S  +M   + +N T +KW++++Q+F FVN +  + L+F+ALNSYG +V L+G 
Sbjct: 355  SASD-AASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGY 413

Query: 421  ELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIP 480
             LYQD ++ +AN+SLN   C++              W  G +G++Y+   Y  + ++PIP
Sbjct: 414  SLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYT-EGDDPIP 472

Query: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540
            +V F  N+ + G Y IN+YTPGC  D TCS RG+VNVT++++ +++I+ T  IYQNN+ L
Sbjct: 473  QVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEAL 532

Query: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600
            KYD+++SGYL  S  IVLEYVSGI + +T T VVAD+ N+   SLD    +S S N    
Sbjct: 533  KYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGST- 591

Query: 601  TLLNGILQYQ-KSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSN 659
              LNG+ QYQ  +  ++   +  KVG T LN +P+  +  NSSL+A  YDN L++GG   
Sbjct: 592  VALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQ 651

Query: 660  RISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENV 719
             +  ++ ++D   ++S N  ++G    +   ++G+ ++G+   S        +NGSF N 
Sbjct: 652  SVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSF-NP 710

Query: 720  FNQ--SRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDV 777
            F Q  + ++++  N++  N++ +V +N Y+ N SS+ L+ NSSS SLSLW+AG N +GD+
Sbjct: 711  FTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDL 770

Query: 778  LFSGAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKI 837
            LF+GA S M Y   N S+                I PYLG Y+N S  AY Y+ D   ++
Sbjct: 771  LFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRV 830

Query: 838  YFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAE--LSIFDLRNLTMIANE-TLG 894
            YF+N   PSW W + +   +Y+DNQ+LL     SS  +   L++ +     +IANE    
Sbjct: 831  YFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSS 890

Query: 895  SNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSF 954
              ++I+ +VNF  N + ++GG+F M   NC GLCL+NY + TWS+F + +I G +  +  
Sbjct: 891  QQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQL 950

Query: 955  TNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTS 1014
             N SELI+SGLF TK   SI + S NL N+ +  L SG      SFTV +  IVAWN+T+
Sbjct: 951  FNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTA 1010

Query: 1015 LFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQ 1074
            L IY +  W +  +  N +S S V  +     ++ L+KR   + ++   +L++G    + 
Sbjct: 1011 LSIYEDNVWTVERI-SNINSSSVVDNLNYVTLASALSKR---DTSSSDAILVSGQLYDNS 1066

Query: 1075 YGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTXXXX 1134
            YG++Q++++DF  W PY +  + + S+ N   FI+RD+S+  N+Q  L   + TV+    
Sbjct: 1067 YGHIQAMVYDFSSWVPYLLINSESDSSINA--FIDRDMSSFTNTQVALLTNSGTVSNSSS 1124

Query: 1135 XXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGD 1194
                                  I RGFVVL+GLALALGTV+VLGIAGVI+AYVF+D  G 
Sbjct: 1125 STTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGA 1184

Query: 1195 YKPIKPRIDENEMLDTVPPEKLMKFV 1220
            Y+PI PRIDENEM++TVPPEKLMK++
Sbjct: 1185 YEPINPRIDENEMIETVPPEKLMKYI 1210

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1212 (39%), Positives = 707/1212 (58%), Gaps = 25/1212 (2%)

Query: 18   SKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPE 77
            + AS L NI  LL+I++  LPNLN + N SN++Q+LG V+ L FY Y GQQNFT +    
Sbjct: 20   ATASSLSNILKLLNIQEFELPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSG 78

Query: 78   TSS-HGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLS 136
             SS + L+YYS++  IQLE  S+DT I KI P G DSF+LSGSG +N  ++G Q+LYNL+
Sbjct: 79   ISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLT 138

Query: 137  TLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGG 196
            TLS+ PIF+Q LG + ++L D   +YFGG F+Y   S    S + W+  S+    LPF G
Sbjct: 139  TLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQG 198

Query: 197  FGENSSVNSIVKLNNDNILFAGQFYTLDDPS--AXXXXXXXXXXXXXXXXXXXXXXGQRI 254
            FG +S VNSI+KLN+DNILF G F TL + S                          Q+I
Sbjct: 199  FGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQI 258

Query: 255  PLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRS 314
             L+YA+WD+ G+  F  ++ VC   + +AW+    SG+L  N P  VSP+KIR+YN+  +
Sbjct: 259  SLKYATWDA-GTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTA 317

Query: 315  DSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMIT 374
            +  +S+F+I+T PS+ IMNLTY+DPL+G+LK C  FCPL + + L +AS N +S      
Sbjct: 318  EDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRV 377

Query: 375  FIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDS 434
            FI+NN T V W+  +Q+FAF+N + VS+L  +A +SYG    LSG+EL+QD+ + YAN++
Sbjct: 378  FINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNT 437

Query: 435  LNEYGC-SAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGH 493
            LN+ GC +               WY GL  +SYIAA Y  D   P+P V+FYPNI   G 
Sbjct: 438  LNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDS-SPLPTVQFYPNIQAVGD 496

Query: 494  YTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFS 553
            ++I MYTPGCL D TC +R IVNVT+ +  + T++ T LIYQNN+ +KYD+I++G L  S
Sbjct: 497  FSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVS 556

Query: 554  PEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKSN 613
            PEI L + S I     + ++VAD+V++    ++  + L DS+       LNG+ QYQ SN
Sbjct: 557  PEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSN 616

Query: 614  FTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVT 673
            FTS    +TKVGN +++   +  +P + SL  + ++N + + G ++ I  + LN D E+ 
Sbjct: 617  FTSDT--KTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELR 674

Query: 674  SSKNQTIQGDVHGITKTNQGLLIFGDI-LSSNNQSAVFLFNGSFENVFNQSRTVNSALNI 732
            ++      G+   I   +QGLL FG   +SS N      FNG+F +       V +  N 
Sbjct: 675  NTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANF 734

Query: 733  SLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLN 792
            +   ++ +  +NDY+ N SS + I N++ F+ S+ A G N + D L  G +   +Y N N
Sbjct: 735  TYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFN 794

Query: 793  GSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSG 852
              ++               IVPY   +LN++A  YAY+    +KI + N +  S ++S  
Sbjct: 795  EPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGT 854

Query: 853  ITQMLYADNQTLLAVSAGSST-TAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSM 911
            + ++ +++N +LL  +A ++  ++ L I ++ +   +A+E L +   I ++++F  N ++
Sbjct: 855  LNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTI 914

Query: 912  LVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEY 971
            LV G+F + + +C G+CLYNY +K WS F N+TI G I ++   NS +++ISGLF  + Y
Sbjct: 915  LVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNY 974

Query: 972  QSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGN 1031
             SI L S ++    +  L   S+ +++SF     SI  W++ ++  Y++++WN  S P  
Sbjct: 975  SSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNT 1034

Query: 1032 ASS-ISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTP 1090
             S  I SV A+  D++++T N           IL   G FN + YG L ++LF    W P
Sbjct: 1035 TSKYIESVEAVSIDLQNSTSNV--------SKILFAYGEFNSTLYGRLNAMLFRAGDWKP 1086

Query: 1091 YFISETTNTSNYNPII--FINRDVSTEFNSQSPLANVNITVTXXXXXXXXXXXXXXXXXX 1148
            YF S      N +P I  F NRD+S+ FNS++ L   NIT                    
Sbjct: 1087 YF-SINNFQVNEDPAITLFENRDLSSLFNSKNSLP-ANITSAETSSRSTVSSATATTVVN 1144

Query: 1149 XXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEML 1208
                    I RGFVVLI LALA+GTV++LG+ GV +AY+F+D E  Y+ IKPRID  EML
Sbjct: 1145 KIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRD-EQKYESIKPRIDGQEML 1203

Query: 1209 DTVPPEKLMKFV 1220
            DTVPPEKLMKF+
Sbjct: 1204 DTVPPEKLMKFI 1215

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1264 (38%), Positives = 709/1264 (56%), Gaps = 72/1264 (5%)

Query: 20   ASQLENIKSLLDIEDNVLPNLNISQNNSNAVQIL--GGVDALSFYEYTGQQNFTKEIGPE 77
            A+QL ++K +L+IE+   P  N+  + + ++Q+L   G D L+F  Y GQQNFT+ I   
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82

Query: 78   TSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLST 137
            + +H L+YYSN+TYI+L D    TRI  I P+G D+FILSG+G++N   + NQ++YNL+ 
Sbjct: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 138  LSMTPIF-NQSLGAVQAVLADNSS--IYFGGNFSYN-NGSMTGYSALIWDSISNTTQLLP 193
            LS+TPIF N+ +  V+ +  D  +  +YFGGNFSY    S      +IWDS SN T    
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 194  FGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXX-----XXXXXXXXXXXXXXXXXX 248
            FGGFG NS +N+I+KLN++++LF+GQFYTLDDPS                          
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 249  XXGQRIPLRYASWDSQGSTTFA-SDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIR 307
               QRIPL +  + +  +  +   + L+CP +  +AW     +GSL   LP+ + P+KIR
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 308  LYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVS 367
            ++NS   D E++ F+I     +SIM+L YLDPL G+LK C EFCPLY+R  L   + N +
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 368  SSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTF 427
                +IT +DNN TD+KW++ +Q+FAFVN+  +++L+F AL+SYG  VGLSGL L+Q   
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 428  STYANDSLNEYGCS---------------AXXXXXXXXXXXXXXWYNGLTGESYIAAKYV 472
            + +AN+S N+  C+                              WY  L    Y+A  Y+
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 473  PDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYL 532
               ++ IP V FYPN+++ G+YT++M TPGC  DN+C +RGIVNVTMWNQ +++I++T L
Sbjct: 502  -SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSL 560

Query: 533  IYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLS 592
            IYQ N+N K+DQI++GYLD   +I + + SG+Y+      +VAD++N+I  SLD   T S
Sbjct: 561  IYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTS 620

Query: 593  DSSNAKKETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYD-NK 651
             +        LNG+ QY + N +   LNE    N+T+N +   NYP N SL A  YD + 
Sbjct: 621  SNEIDIYNVTLNGLFQYPEYN-SVNNLNENYT-NSTINQYAYSNYPANVSLIAAAYDKDT 678

Query: 652  LVIGGVSNRISIVDLNDDFEVTSSKNQTIQ-GDVHGITKTNQGLLIFGDIL-SSNNQSAV 709
            L++GG  N++    +  + +  S +N       V GI   + GL+ +GDI+ SS +  A+
Sbjct: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738

Query: 710  FLFNGSFENVFNQSRTVNSALNISLANN-DFIVLDNDYVVNASSNALIRNSSSFSLSLWA 768
               N  F  + N +  + S  NISL  + + +  +N Y  N S+    +N+S+F LSLW+
Sbjct: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798

Query: 769  AGNNGDGDVLFSGAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYA 828
            AG N   D++FSG VS  +  NL G V                I PY   +LN+S+T YA
Sbjct: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858

Query: 829  YEVDS--LNKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA--ELSIFDLRN 884
            Y   +  LN++  SN    SW+W + I+ M +  N++LL+V   S        SI +L +
Sbjct: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918

Query: 885  LTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNT 944
              +IANETL  N++I++L+ F KN S+LVGG+F  ++  C+GLCL+NYE+K WSTF+NNT
Sbjct: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978

Query: 945  IFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTE 1004
            + G +++L   N+S ++ISG   T +  +I L   NL    +  LL  +   L SF  T 
Sbjct: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNT--NLTSFEFTG 1036

Query: 1005 DSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDI----ESNTLNKRGINNVNN 1060
            + I AWN ++LF Y N+ W+   LP    S+   S    DI     S+ L KR + + N 
Sbjct: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTN- 1095

Query: 1061 GSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNY-NPI-IFINRDVSTEFNS 1118
              I++  G F     G +Q+L +    W PYF    TN  +  N I IF N+D+S++  S
Sbjct: 1096 --IMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISSKIIS 1153

Query: 1119 QSPLANVNITVT----------------------XXXXXXXXXXXXXXXXXXXXXXXXXX 1156
               L N N  ++                                                
Sbjct: 1154 DFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKKHK 1213

Query: 1157 IGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKL 1216
            I RGFVVLIGLAL+L TV++LGI G++L+++F+D  GDY+ +KPR  E+EM D VPPEKL
Sbjct: 1214 IQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVPPEKL 1273

Query: 1217 MKFV 1220
            M FV
Sbjct: 1274 MPFV 1277

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1239 (36%), Positives = 697/1239 (56%), Gaps = 71/1239 (5%)

Query: 3    VHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFY 62
            V+ LW     F V I++AS LEN++ +L+  +  +P  ++  N +N  QIL  ++ +SFY
Sbjct: 6    VYCLW-----FAVAITRASNLENVRRILNATEVTVPTFDVG-NKNNQFQILDDINGISFY 59

Query: 63   EYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDA-SDDTRIDKITPFGVDSFILSGSGT 121
            EY GQQNFT +    T    L+YYSN T++ L D+ + + +I  I P G DSFILSG G 
Sbjct: 60   EYLGQQNFTTDAN-VTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118

Query: 122  INNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALI 181
            INN+S+ +Q+++N++ LS+T IF+  L +++ V  D   +YF GNF++NN +     A++
Sbjct: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIM 174

Query: 182  WDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXX 241
            WDS   +  LLPF GFG  +++NSI+KLN+DNILFAG F T+ + S              
Sbjct: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSS---LLLQSNVSEES 231

Query: 242  XXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEV 301
                        +PL+Y+ W + G     S  L+CP+ ++D+W    T+G   C LP+++
Sbjct: 232  VRNTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQI 289

Query: 302  SPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLS 361
            +P+KIR+YNS   DS++S+F+ LT P+ SIMNLTYLDPLSG + +C  FCPLYS+  L S
Sbjct: 290  TPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQS 349

Query: 362  ASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLE 421
               N + + + +  I+NN T+++WT ++Q+FA V+ +  +SL+F AL SYG ++GL+G +
Sbjct: 350  QWDNTAEA-NTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQ 408

Query: 422  LYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLT--GESYIAAKYVPDQNEPI 479
            +YQ +FS + N+S N   C+                 N  T  GE Y+   Y P++N P+
Sbjct: 409  IYQASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVGE-YLTVGYTPNEN-PV 466

Query: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539
            P+V +  +I H G Y+IN++TPGC  DNTCS RGIVN T+++   N ++ T LIYQNND 
Sbjct: 467  PKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDE 526

Query: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKK 599
            +KYD +YSG L+ S EI + Y SG+Y +NT T +VAD+V++  +S+D    LS  +   K
Sbjct: 527  IKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVSK 582

Query: 600  ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYA-DIYDNKLVIGGVS 658
              L NG+ QYQ SNFT+  +   K+ NT+LN F + N+  + SL A  + ++ +++ G  
Sbjct: 583  LAL-NGLFQYQISNFTNDSI-PMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTE 640

Query: 659  NRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFEN 718
              +  ++LN D  V +S       +       + GL++       + Q  V LF  +F+N
Sbjct: 641  GNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKDNFKN 694

Query: 719  VFNQSRTVNSAL-----NISLANNDFIVLDNDYVVNASSNALIR-NSSSFSLSLWAAGNN 772
            +   + T++ +L     NI+L  ++ +V +N Y+ N +S    R NSS F+L++ +AG N
Sbjct: 695  L---NTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGAN 751

Query: 773  GDGDVLFSGAVSHMQYG--NLNGSVRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAYE 830
               D +F G V   QY   N +  V                 VP  G +LN+ +T Y Y+
Sbjct: 752  SINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYK 811

Query: 831  VDSLNKIYFSNEVYPS-WNWSSGITQMLYADNQTLLAVSAGSSTT--AELSIFDLRNLTM 887
              + +K+Y +N    S   W      ++Y  N TLL V   +  T  + LS+ +L +  +
Sbjct: 812  ESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDV 871

Query: 888  IANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFG 947
            I  E L   + I++L+ F KN ++LV GDF+ +  NC+ LCLYNY+S  W +  NN++ G
Sbjct: 872  IKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSG 931

Query: 948  EITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLN--SFTVTED 1005
             +  L    +  +++ G     +   + +   NL+N+ +  L+   +  +N  S  V+  
Sbjct: 932  SVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNS 991

Query: 1006 SIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILL 1065
             IVAWNDT LF +    W   S+PG  SS +S+S++        ++  G ++      LL
Sbjct: 992  RIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSV------QFISMEGTDDA-----LL 1040

Query: 1066 LNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANV 1125
            L G F  S++G ++S++++F+ W PY +            +F+NRD+S    +Q PL N 
Sbjct: 1041 LLGEFRHSEFGDIKSIVYNFRDWIPYLL-YVDGPRQGTGHLFMNRDISLHNIAQIPLLNS 1099

Query: 1126 NITVTXXXXXXXXXXXXX-------XXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLG 1178
               +T                                 + RGFVVLIGLALAL TVSV+G
Sbjct: 1100 TRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMG 1159

Query: 1179 IAGVILAYVFKDPEGD-YKPIKPRIDENEMLDTVPPEKL 1216
            +AGV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1160 VAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1232 (35%), Positives = 688/1232 (55%), Gaps = 45/1232 (3%)

Query: 9    LAFPFLV--EISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTG 66
            LA  FLV  ++   + L  I+S L +++  +P+L++S +N+  +Q+LG    L++Y YTG
Sbjct: 7    LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTG 66

Query: 67   QQNFTKEIGPETSSHGLVYYSNNTYIQLED---ASDDTRIDKITPFGVDSFILSGSGTIN 123
            Q NFT  I  E +   L+Y+SN T ++L     +++   +D + P   DSFILSG+G I+
Sbjct: 67   QDNFTG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAIS 125

Query: 124  NISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWD 183
               + +Q+++NLS LS T IFNQSL  V A+  + +  YFGG+F +       +  ++WD
Sbjct: 126  GAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWD 185

Query: 184  SISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXX 243
             + N  + LPFGG G++S+VNSI+ L+++NILFAG F T+D+ SA               
Sbjct: 186  FVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAP 245

Query: 244  XXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCP-NTNEDAWLYPDTSGSLVCNLPYEVS 302
                     +IPL+ A W S GS     D LVCP N+   AWL   T+G    ++ + + 
Sbjct: 246  ELS-----HKIPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIR 298

Query: 303  PTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSA 362
            P+K+RL+N++  D E+S+F+++T PS+ IMNLTYLDP SGEL+ C  +CPL S    L+A
Sbjct: 299  PSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQN-LTA 357

Query: 363  SQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLEL 422
            +++ ++S D + F+ NN+T V+W+  +QDFAFVN +PV+S+ F+AL+SYG SVG++G EL
Sbjct: 358  AKSKAASTDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFEL 416

Query: 423  YQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRV 482
            Y+D FS YANDS N   CS+              W  G + E Y+    + + ++  P V
Sbjct: 417  YEDDFSVYANDSFNVPDCSS-TSNYSKASLSASQWDQGSSDEDYVYT--LVENSQEAPSV 473

Query: 483  KFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKY 542
             FYP I++ G YTIN+ TPGCL D +C +R +VN ++W+  N T++ +  IYQNND  KY
Sbjct: 474  TFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKY 533

Query: 543  DQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETL 602
            D +YSGYL+   ++VLEY   I  T  + ++VA Q++V T   D+ +  +D     K   
Sbjct: 534  DNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS-SVFTDKYKTGK--- 589

Query: 603  LNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRIS 662
            LNG+L Y  SN +S   N     +T L  + V N+ KNS+ + D + N +++   S ++S
Sbjct: 590  LNGLLHYSLSNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVS 649

Query: 663  IVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQ 722
             ++++  F+V +   + +  +V G+   ++GL + G     + + A F +NGSF ++   
Sbjct: 650  KLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIG-TFDGSTKGAKF-YNGSFFDIPLS 707

Query: 723  SRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGA 782
               V +  N +L   + + L N Y +N +++ L RNSS  +L+  +AG N  G+ +F G+
Sbjct: 708  HSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGS 767

Query: 783  VSHMQYGNLNGSVRFXXXXXXXXXXXXG-GIVPYLGAYLNESATAYA-YEVDSLNKIY-- 838
            ++  +Y +LNGS                 G + Y   Y++ S T YA Y+  S N  Y  
Sbjct: 768  LTRNEYTDLNGSFFISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGV 827

Query: 839  -----FSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA-ELSIFDLRNLTMIANET 892
                  + E   S+ W++ +  MLY+ N +LLA+   + T + +L + +L      A   
Sbjct: 828  SIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFE 887

Query: 893  LGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQL 952
              +N  IN+L+ F++N S+LVGGDF  +E NC+GLCL++YE K WS F +N I G I  +
Sbjct: 888  WKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSM 947

Query: 953  SFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTV--TEDSIVAW 1010
               N S L++ G F+  + + + L S +LT+ +   L  G+E  L+   V    D++VA 
Sbjct: 948  KIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAV 1007

Query: 1011 NDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNF 1070
            +   LF   N  W   S   + SS+    + +  I+    NK+     N+   LL+ G+ 
Sbjct: 1008 SANDLFRLTNNNWESISAQFDDSSVFGGLSEFP-IQQGGQNKKREEEKNS---LLITGDL 1063

Query: 1071 NISQYGYLQSLLFDFQKWTPYFISETTNTSN--YNPIIFINRDVSTEFNSQSPLANVNIT 1128
                YG + + L+DF  W PYF +    +++      I+ N+D+S+ FN Q  L +    
Sbjct: 1064 LHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSR-- 1121

Query: 1129 VTXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVF 1188
                                        I RGFVVLIGLALA+GT++V+G+ G+ L + F
Sbjct: 1122 GGNSSSVPSGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFF 1181

Query: 1189 KDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
                  Y+ ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1182 GKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1251 (34%), Positives = 673/1251 (53%), Gaps = 81/1251 (6%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            M +H     A   L ++ + S LE++    DI+    P L++S   +  + +     A  
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
            +Y Y GQQ FT +   + SS  L+YYS  TY+QL    DDT + +I PFG DSFILSG+G
Sbjct: 61   YYNYKGQQLFTGQEQHQGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTG 118

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
             + +  + +Q++YNLSTL +T I  QSL +V  +L D   +YFGG F+Y++G+ +G+SA+
Sbjct: 119  KLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAV 178

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXX 240
             W++ S TT LLPFGGFG  SSVN+I+KL+   +LF G+F  L+  S             
Sbjct: 179  QWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEK 238

Query: 241  XXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDT-----SGSLVC 295
                           LRY++  S G         +CP +N+D+W  P +      G L  
Sbjct: 239  PQLNVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296

Query: 296  NLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYS 355
             + + + P+KIR+YNS+++ +EI +F+I+T PS SIMN+TY+DP +GEL  C  +CPL  
Sbjct: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356

Query: 356  RATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSV 415
            R+ L S +   S   D+   +++ K  +KWT D+Q+FAF+N++ +  +KF+AL+SYG +V
Sbjct: 357  RSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415

Query: 416  GLSGLELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQ 475
            GL G+EL+Q  +  Y N +LN+  C                W+ G T  SY++A  V   
Sbjct: 416  GLVGVELFQTEYDAYVNSTLNQPNCGE--QQLSPFSTTANIWHQGATDASYLSANVV--- 470

Query: 476  NEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQ 535
             E  P V   P I H G YT+N+YTPGC  D TC  RGIVNVT+      T+M T  IYQ
Sbjct: 471  -ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQ 528

Query: 536  NNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSS 595
            NN  LKYD +Y+G+LD +P + +E+VS I +     ++VAD+V+ I  SLD      D  
Sbjct: 529  NNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGL----DDI 584

Query: 596  NAKKETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIG 655
               +E  LNG+ QY  +   S+  N  +     +N  P  + P+  SL   +YD KL++G
Sbjct: 585  RHPREKSLNGLFQYTPAG--SSLDNGIQ---KYINKDPQTDMPEGVSLVGQVYDGKLILG 639

Query: 656  GVS-NRISIVDLN----DDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVF 710
              S   I++V       +D +VT    Q + G ++GI+  ++GL+  G    S+  S+  
Sbjct: 640  VKSTGHIAVVTPKGTDWNDVDVT---RQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSAL 696

Query: 711  LFNGSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAG 770
             ++G+F + F+ +   +S +N+++  ++ ++ +N ++ N S++ ++  SS F LS  +A 
Sbjct: 697  HYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQLSALSAA 755

Query: 771  NNGDGDVLFSGAVSHMQYGNLNGSVRFXXXXX--XXXXXXXGGIVPYLGAYLNESATAYA 828
             N + D+LF+G+++ +++G+ +G+V                 G   + G YLN++ATAYA
Sbjct: 756  ANSNNDLLFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYA 815

Query: 829  YEVDSLNKIYFSNEVY---PSWNWS-----SGITQMLYADNQTLLAVSAG--SSTTAELS 878
            Y   S N    +  V    P  N++     + + +M+Y      L +S      T   L 
Sbjct: 816  YYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALI 875

Query: 879  IFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWS 938
            ++DLR L  +A E L    RIN++V F ++ ++LVGG F+  +  C  LCLYN+  ++WS
Sbjct: 876  LYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRSWS 933

Query: 939  TFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGK-L 997
             F +  I GEI QL F N+  LI  G    +   +I   +F+L  S ++       G+  
Sbjct: 934  AFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAF 993

Query: 998  NSFTVTEDS---IVAWNDTSLFIYRNQEWN-ITSLPGNASSISSVSAIYTDIESNTLNKR 1053
            NS     DS    VA +   ++ Y   EW  +T L G    I  +S +  +    + NKR
Sbjct: 994  NSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLN-NPRSQNKR 1052

Query: 1054 GINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPI----IFIN 1109
              N V N  +++++G  N S+YG + ++ ++F+ W PY+ +  ++      +    IF+N
Sbjct: 1053 --NRVGN-ELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLN 1109

Query: 1110 RDVSTEFNSQSPLANVNITVTXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLAL 1169
            +D+S +  +  PL  V                               + +G+VVLI L L
Sbjct: 1110 QDISRQTTTSLPLEVV------------------VSDSPPTAEPKRKLAKGYVVLIALGL 1151

Query: 1170 ALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            AL T+++LGI GVILAY F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1152 ALATIALLGIIGVILAYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1186 (35%), Positives = 656/1186 (55%), Gaps = 36/1186 (3%)

Query: 40   LNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASD 99
            LN S + +N +Q+LG ++  ++Y Y GQQNFT     +     L+YYSNNT ++L+    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELE-LIYYSNNTLLRLDAVPT 60

Query: 100  DTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNS 159
            D  +  I PF  D FILSG GTI+ I +  QIL NL+ LS  PIF + LG V+++  DN 
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 160  SIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQ 219
             +YFGG+ +YNN  ++G S + W+S +N++ LLPFGGFG NS+VNSI++L N+N+LF GQ
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 220  FYTLDDPSAXXXXXXXXXXXXXXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNT 279
            F  L++ S                       GQ+I LR A+W++  ++    D+ +CPN+
Sbjct: 181  FAKLENNS---FVSKTNRTRNFSISMEDSEVGQQISLRQATWNA--NSNLDVDAFICPNS 235

Query: 280  NEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDP 339
            ++ AW    + G + CN P  ++ +KIR+YN+  +D++IS+F+++  P + I+NLTYLDP
Sbjct: 236  DQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDP 295

Query: 340  LSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELP 399
            +S ++K+C E CPL++R TLL+A  NV+   D+I FI+NN T++KW   +Q+FAFVN+LP
Sbjct: 296  ISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLP 355

Query: 400  VSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYN 459
            ++SL+FVA NSY  +VGLSG ++YQD+F  + N+S NE  C +              W+ 
Sbjct: 356  ITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFT 415

Query: 460  GLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTM 519
                 SY+A  Y+P+Q    P + ++  I  PG Y +N+ TPGC +DNTCS RGIVNVT 
Sbjct: 416  VANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTT 474

Query: 520  WNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVN 579
            ++  N  I+ + LIYQNN+NLKYDQI++G L+ S  + +EY SGI  TNT T  V   V 
Sbjct: 475  FDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGI-NTNTGTATVVVGVV 533

Query: 580  VITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTSTRLNET-KVGNTTLNLFPVKNYP 638
             +     +   +SD  +  +   LNGI +Y  SNFT      T K+  T L+ F V N+ 
Sbjct: 534  DVVRVSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFN 593

Query: 639  KNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFG 698
            K +S++A   +  L +G  +  +  ++  +   V S++N  + G ++G+    +GL+IFG
Sbjct: 594  KGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIFG 652

Query: 699  DILSSNNQSAVFLFNGS---FENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNAL 755
             I     +    + N S    + V N S  + ++ N +L  ++ +V DN  + N +S  +
Sbjct: 653  SIAHRGREYGAVILNKSITPLDIVANDS--IQASFNSTLFGSNLLVFDNSTIFNMTSFMV 710

Query: 756  IRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGIVPY 815
              N+S  +L L  AG N + D+L  G + +      N S+                    
Sbjct: 711  FENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIE 770

Query: 816  LGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA 875
               YLN++   Y+    ++N    S++    W W S +  + Y++ Q LL     +S  +
Sbjct: 771  GAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKS 830

Query: 876  ELSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESK 935
            ++ + DL +  +I +    +  +INA+VNF  N + LVGGDF ++ P C GLCLYNY + 
Sbjct: 831  QIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNS 890

Query: 936  TWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEG 995
             WS+FLNN+I G I+Q+ F N +++++SG  E  +   I L S NLT++    LL  +  
Sbjct: 891  NWSSFLNNSITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSV 949

Query: 996  KLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGI 1055
             L+ F +  + +V WN T +FI    +W             S   I+ D  + T+N+   
Sbjct: 950  VLDDFILVRNLVVGWNSTDIFIRNVTQW-------------SNLNIFDDGTNATINRIEN 996

Query: 1056 NNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTE 1115
               ++   L++ G F+  +YG + ++++DF  W PYF  +  + +   P+ F +RD S+ 
Sbjct: 997  FGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQT-ATPLFFADRDQSSY 1055

Query: 1116 FNSQSPLANVNITVTXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVS 1175
             N++  + +  I  +                          I RGFVVLIGLALAL T+ 
Sbjct: 1056 GNTRHVVPDHIIVSS-----SHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALATLI 1110

Query: 1176 VLGIAGVILAYVFKDP-EGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            VLGI GV++A +F     GDY  IK    +N     + PEKL++ +
Sbjct: 1111 VLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1232 (34%), Positives = 684/1232 (55%), Gaps = 56/1232 (4%)

Query: 14   LVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKE 73
            L +    S L+ ++S L +E   +PNL++S++ +N VQ+LG    ++  +Y+GQ+NFT E
Sbjct: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73

Query: 74   IG--PETSSHGLVYYSNNTYIQLEDASDDTRI---DKITPFGVDSFILSGSGTINNISVG 128
            +   PE   + L+YYSN T++++  +SD + +   D I PF  D+FILSG+G+I+   + 
Sbjct: 74   VSGNPE---NALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLS 130

Query: 129  NQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNT 188
             Q+L+NLS+L    IF Q L  V  + A+   ++FGG+F Y   + T +S L+WDSI + 
Sbjct: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190

Query: 189  TQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXXXX 248
             ++LPFGGFG+NS+VNSI+ L+N NILFAG F  +D+                       
Sbjct: 191  VEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQ-----LNNINVSNTSNTSVP 245

Query: 249  XXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYP-DTSGSLVCNLPYEVSPTKIR 307
              G +I L+ A+W S G  T    ++ CP+T    WL    T G     +P E  P+K+R
Sbjct: 246  ELGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLR 303

Query: 308  LYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVS 367
            ++N++ SD ++S+F+I+T PS+ IMNLTYLDP +GEL +C  +CPL S   L   S   S
Sbjct: 304  VFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-S 362

Query: 368  SSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTF 427
               D + + + N+T ++W+  FQDFAFVN +PVS L F+AL+SYG SVGL+G+ELY+  +
Sbjct: 363  YPGDQVQYFE-NRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAY 421

Query: 428  STYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPN 487
            S YAN++LN   C+               W +G +  +Y++   V D +E  P V FYP+
Sbjct: 422  SVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTS-VQD-SETNPFVIFYPS 479

Query: 488  IIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYS 547
            II+PG YTI++ TPGCL+D++C  RGI+N T+ + QNNT++ +  IYQNND  K+D +YS
Sbjct: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539

Query: 548  GYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGIL 607
            G+LD   ++ LE+   I +     V+VA +   I V+++ F+     +N      +NG+L
Sbjct: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTSG--FINGLL 594

Query: 608  QYQKSNFTSTRLNET-KVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDL 666
             Y  SN TS+ L+E      T L  + V   PK+S+++A+++++ LV+      ++ + L
Sbjct: 595  HYSTSN-TSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKL 653

Query: 667  NDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTV 726
             ++  +     +TI  D+  I++ + GL+I G   + +++ A   FNG+F N+   + TV
Sbjct: 654  ANNLSIEEYTFETIGKDISTISEYSGGLIIVG-TFNGSSEPAARGFNGTFFNLTEFNSTV 712

Query: 727  NSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHM 786
             +  N++L   + ++ D + ++N ++   I ++S  +L + +AG N   D LF G V   
Sbjct: 713  RTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQN 772

Query: 787  QYGNLNGS--VRFXXXXXXXXXXXXGGIVPYLGAYLNESATAYAY----------EVDSL 834
             Y NLNGS  +              GG +PY  A+++ S TAYAY           V  +
Sbjct: 773  DYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVM 832

Query: 835  NKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAG-SSTTAELSIFDLRNLTMIANETL 893
            N    S        WS  +  M  + N +LLA+      T ++L + +  +   +A+   
Sbjct: 833  ND---SGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKW 889

Query: 894  GSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLS 953
             S   +N+++ F +N S+LVGG F++    C+GLCL+NY+ K WS FLNN+I G I ++ 
Sbjct: 890  DSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRME 949

Query: 954  FTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDS---IVAW 1010
              N+S L+I+G F   E   + L S  L +S+   L  G+   LN F   + S   +VA+
Sbjct: 950  IFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNI-TLNGFVSMDGSSNNVVAF 1008

Query: 1011 NDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNF 1070
            +DTSL    + +W   S     +S      ++   ++    KR     ++  +LL+ G+ 
Sbjct: 1009 SDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRD----SSSKVLLITGSL 1064

Query: 1071 NISQYGYLQSLLFDFQKWTPYFIS-ETTNTSNYN-PIIFINRDVSTEFNSQSPLANVNIT 1128
              +++G + +  +D  +WTP+  S + T++S+     +F+NRD+S   + +  L      
Sbjct: 1065 QHAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGT--F 1122

Query: 1129 VTXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYVF 1188
             +                          I RGF+VLI LALALGT++VLG+ GVI +Y F
Sbjct: 1123 SSNTSSGTSGTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFF 1182

Query: 1189 KDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             D    Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1183 GDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1249 (35%), Positives = 687/1249 (55%), Gaps = 66/1249 (5%)

Query: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60
            M++H+   L   F+  +++ SQ+  + +  +I     P+L++S   ++ + I        
Sbjct: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60

Query: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120
            +Y Y GQQ FT       +S  L+YYSNNTY+QL +  D   I KI P+G DSFILSG G
Sbjct: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118

Query: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180
                  + +Q++YNLS+  +T I  + L  V  +L D   +YFGG F+YN+G+++G+S +
Sbjct: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178

Query: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXX 240
             WD+   ++ LLPF GFG+ S VN+I+KL++ NILF G+F T+D+ +             
Sbjct: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLS 238

Query: 241  XXXXXXXXXXGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPD-TSGSLVCNLPY 299
                           LR++S    G  T  S + VCP  + D+W  P  T G L   +  
Sbjct: 239  NSTNIETNALAS---LRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVIN 293

Query: 300  EVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATL 359
            +++P+KIR+YNS+ S++++++F+I+T PS SIMN+TY+DP++G L  C  +CPL   + L
Sbjct: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353

Query: 360  LSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSG 419
             + ++N +SS+ M  F +NN   VKWT+ +Q+FAFVN +P+  L F+A++S+G +VGL G
Sbjct: 354  SNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLG 412

Query: 420  LELYQDTFSTYANDSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPI 479
            +EL+Q  + TY N++LN+  C +              WY GL  +SY+A  +   +    
Sbjct: 413  IELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---- 468

Query: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539
            P V   P+I +PG YT+N+ TPGCL DNTC+ RGIVNVT+   QN T +    IYQNN+N
Sbjct: 469  PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNEN 527

Query: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKK 599
            LKYD ++ GYLD SP +VLE++  I       V+VAD+V  I  S++     + +SN+  
Sbjct: 528  LKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSN- 586

Query: 600  ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIG--GV 657
              LLNG+ QY  SNFT+T L+ T VG+T ++ +PV+N P +SSL+  IY++ L IG   +
Sbjct: 587  --LLNGLFQYAASNFTNTNLS-TLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSI 643

Query: 658  SNRISIVDLNDDFEVTSSKNQTI--QGDVHGITKTNQGLLIFGDILSSN--NQSAVFLFN 713
                 I    DD+       Q I  +G V GI   + GL +    + SN  N ++   FN
Sbjct: 644  DGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLAL---TVHSNQTNMASSLSFN 700

Query: 714  GSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNG 773
            GS   +F  +    S LN+++  ++ +V DN YV N SS + I NS +  LSL +AG N 
Sbjct: 701  GSISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANL 760

Query: 774  DGDVLFSGAVSHMQYGNLNGSVRFXXXXXXXXXXXXGGI---VPYLGAYLNESATAYAYE 830
            + D++ +G V   ++   NG++                +   + Y G ++N+S++AYAY 
Sbjct: 761  EDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYY 820

Query: 831  VDSLNK----IYFSNEVYPSW--NWSSGITQMLYADNQTLLAV--SAGSSTTAELSIFDL 882
              SL      I    E  P +     S +  MLY  +  LLAV  S  S   A L I DL
Sbjct: 821  SKSLGSSKGGIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDL 880

Query: 883  RNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLN 942
                    ET      IN +V F +N ++LVGG F  T   C  LCLYNY +  W+ F++
Sbjct: 881  SADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMD 938

Query: 943  NTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTV 1002
              I G+I QL F + + L+++GL  + + + ++L   +L+N  +I  L G+        +
Sbjct: 939  GNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVL 998

Query: 1003 T----EDSIVAWNDTSLFIYRNQEW-NITSLPGNASSISSVSAIYTDI-ESNTLNKRGIN 1056
            T       ++A +   +F + + +W NI+      + I+ ++ + TD  + N++ KR  +
Sbjct: 999  TVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKR--D 1056

Query: 1057 NVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPII-----FINRD 1111
             V N  ++++NGNF+   YG + ++ +DF  W PY+ S     SN + +I     F+N+D
Sbjct: 1057 RVGN-ELVVINGNFSSPDYGDINAMYYDFNGWNPYYFS-VPRESNSDEVIPQGQLFLNKD 1114

Query: 1112 VSTEFNSQSPLANVNITVTXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALAL 1171
            VS   +SQ  L+N N                              + + FVVLI LALAL
Sbjct: 1115 VSFTSSSQIYLSNDN----------DNDDTPAASEPATHEKHTKKLAKIFVVLIALALAL 1164

Query: 1172 GTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             TV+VLG+ GV+ AY+F D    Y+P+KPRI+E EML TVPPEKLMKF+
Sbjct: 1165 ATVAVLGVVGVLFAYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1233 (35%), Positives = 681/1233 (55%), Gaps = 72/1233 (5%)

Query: 14   LVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKE 73
            L  + + SQL NI+ LL+I     PN +     S  +  +   + L+   YTGQQNFT +
Sbjct: 14   LAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTGQQNFTVQ 68

Query: 74   IGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILY 133
                 +   L+YYSN+T+++L + S +T +  I P   DSFILSG+G IN +++  QIL 
Sbjct: 69   ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILL 124

Query: 134  NLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLP 193
            NL++L+ +PIF  ++  V  +L  N ++ F GNFS +  + TG+ A++WD ++NTT+L P
Sbjct: 125  NLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFP 184

Query: 194  FGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAXXXXXXXXXXXXXXXXXXXXXXGQR 253
            F GFGENS VNS+VKLN+DNILFAG F  + +  A                       Q 
Sbjct: 185  FKGFGENSIVNSVVKLNSDNILFAGSFQEIQN--ASLLQEFGNATNSSHEDLTSLQFDQS 242

Query: 254  IPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDT-SGSLVCNLPYEVSPTKIRLYNSQ 312
            +PL+ +S   +      SD L+CP+  ++ W   +    +L  +L  E+ P+K+R+YNS 
Sbjct: 243  VPLKLSSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSV 299

Query: 313  RSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDM 372
              +SEIS+F+I+T PS+ IMNLTYLDP SGELK C  +CPL S   L   SQN +++   
Sbjct: 300  EENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKS 359

Query: 373  ITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYAN 432
            +  I+NN T++KW+  +Q+FAFVN++PV+ L+FVAL SYG +  L  +E+++  F  YAN
Sbjct: 360  VG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYAN 418

Query: 433  DSLNEYGCSAXXXXXXXXXXXXXXWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPG 492
            +S NE  C +              WY     ++YI+       ++ IP V F+PNI +PG
Sbjct: 419  NSYNEPNCES-VTEYSKAELSSDNWYTTDESDTYISTNI----DDNIPYVTFHPNITYPG 473

Query: 493  HYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDF 552
             YT N+YTPGCLQDN+CS RGIVNVTM ++  N ++ + LIYQ N+  K+D +Y+G L  
Sbjct: 474  RYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGS 533

Query: 553  SPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKS 612
            +PEI++ +   I  ++  +V+V D++ VIT  +D   T+S SSN      LNG+ QY  +
Sbjct: 534  APEIIVTWDKAIGESD--SVMVVDRLGVITEYID---TISISSN-DTTFHLNGLFQYNTA 587

Query: 613  NFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEV 672
            N T++  +     N T N + + N+P +++LYA   +N ++IGG  N I+ V+LND+  +
Sbjct: 588  NVTASIFST----NDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALI 643

Query: 673  TSSKNQTIQGDVHGITKTNQGLLIFGDILSSNN-QSAVFLFNGSFENVFNQ-SRTVNSAL 730
            +SS+     G   GI + + GLL+ G     N+ +  +  ++G+  N F Q    ++  +
Sbjct: 644  SSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIV 703

Query: 731  NISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGN 790
            N ++  ++ ++ DN Y+ N S+N  + NSS+F ++  +AG N   D L  G+      G 
Sbjct: 704  NFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGE 763

Query: 791  LNGSVRFXXXXXXXXXX---XXGGIVPYLGAYLNESATAYAYEVDSLNKIYF-------- 839
            LNG                     + PY  AY+N+++ AYA +  S + +          
Sbjct: 764  LNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTN 823

Query: 840  SNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA-----ELSIFDLRNLTMIANETLG 894
            S+       WS+ I   LY +   +LA+    S ++     + SI +L     +A     
Sbjct: 824  SSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFS 883

Query: 895  SNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSF 954
            +N R+N++V+F  N S+LVGG +++   NC  LCLYNY++K W++FLN++I G+I Q+ F
Sbjct: 884  TNERVNSMVSFSSNNSILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQF 941

Query: 955  TNSSE-LIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDS---IVAW 1010
             +  + L++ GL +T    +I+L S  + ++    + SG+E  L SF   +DS   I+A 
Sbjct: 942  ADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-SFVPIDDSTDNIIAQ 1000

Query: 1011 NDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGS-ILLLNGN 1069
             ++ +    +  W+      N  SI S   + +  ES    KR     + GS I+LL G 
Sbjct: 1001 MNSEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTES---KKR-----DEGSHIVLLEGT 1052

Query: 1070 FNISQYGYLQSLLFD--FQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNI 1127
             N S++G L S+++D   QKW PYF+          P     ++V+  + S S      +
Sbjct: 1053 LNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQ----TV 1108

Query: 1128 TVTXXXXXXXXXXXXXXXXXXXXXXXXXXIGRGFVVLIGLALALGTVSVLGIAGVILAYV 1187
              +                          I RGF+VLIGLALAL TV+V+G+ G ++ Y 
Sbjct: 1109 LQSNNSDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYF 1168

Query: 1188 FKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            F +  G Y+ +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1169 FINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>Smik_10.154 Chr10 (260576..261574) [999 bp, 332 aa] {ON} YJL088W
           (REAL)
          Length = 332

 Score = 33.5 bits (75), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 347 CGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKF 405
           C +F PL +   LL+  +N   S+D++    N+K  + W  D  +   +N++ ++ LKF
Sbjct: 135 CDKFHPLQAICDLLTIVENFDISLDVVNKGTNSKLKIAWIGDANN--VINDMCIACLKF 191

>YBR123C Chr2 complement(484742..486691) [1950 bp, 649 aa] {ON}
           TFC1One of six subunits of the RNA polymerase III
           transcription initiation factor complex (TFIIIC); part
           of the TauA globular domain of TFIIIC that binds DNA at
           the BoxA promoter sites of tRNA and similar genes; human
           homolog is TFIIIC-63
          Length = 649

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 31/122 (25%)

Query: 40  LNISQNNS---NAVQILGGVDALSFYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLED 96
           LN+S  +S    A+++ GG++ +       ++ F KE GP  S HGL  Y N+     + 
Sbjct: 43  LNVSTKHSSIQKAIKMCGGIEKV-------KEAF-KEHGPIESQHGLQLYLND-----DT 89

Query: 97  ASDDTR--------IDKITPFGVDSFIL-----SGSGTINNISVGNQI--LYNLSTLSMT 141
            SD ++        I K  PF  +S IL      G+ + NN SV + I  L + + L +T
Sbjct: 90  DSDGSKSYFNEHPVIGKRVPFRDESVILKVTMPKGTLSKNNNSVKDSIKSLKDSNKLRVT 149

Query: 142 PI 143
           P+
Sbjct: 150 PV 151

>TBLA0C06140 Chr3 (1485420..1492943) [7524 bp, 2507 aa] {ON}
           Anc_5.206 YJL005W
          Length = 2507

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 15/124 (12%)

Query: 63  EYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTI 122
           E + Q++     G +TS H    ++N  + + +  ++   + +     VD F+     T 
Sbjct: 827 EPSKQESSKYSHGHKTSDHD--RHANPHFRKTQSITNAKSLVEYEKKKVDQFLAHSHRTS 884

Query: 123 NNISVGNQILYNLSTLSMTPIFNQSLG-------------AVQAVLADNSSIYFGGNFSY 169
           +N S  +++L +    S+ PIFN ++               V A L+D+ S    G F +
Sbjct: 885 SNESKDHELLTDKRRHSLAPIFNNTISDAIQKTTSFVINNPVHARLSDHQSTMNNGLFHH 944

Query: 170 NNGS 173
            N S
Sbjct: 945 ENSS 948

>Skud_10.126 Chr10 (236807..237823) [1017 bp, 338 aa] {ON} YJL088W
           (REAL)
          Length = 338

 Score = 32.3 bits (72), Expect = 7.7,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 347 CGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKF 405
           C +F PL +   LL+  +    S+D I    N+K  + W  D  +   +N++ ++ LKF
Sbjct: 141 CDKFHPLQAICDLLTIVEKFDISLDAINKGTNSKLKIAWIGDANN--VINDMSIACLKF 197

>Suva_6.160 Chr6 complement(281992..283005) [1014 bp, 337 aa] {ON}
           YJL088W (REAL)
          Length = 337

 Score = 32.3 bits (72), Expect = 8.4,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 347 CGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFV 406
           C +F PL +   LL+  +    S+D +   DN+K  V W  D  +   +N++ ++ LK  
Sbjct: 140 CDKFHPLQAVCDLLTIIEKFDISLDSLNKGDNSKLKVAWIGDANN--VINDMSIACLKL- 196

Query: 407 ALNSYGGSVGLS---GLELYQD 425
                G SV ++   G+E+  D
Sbjct: 197 -----GMSVSIATPPGIEMDSD 213

>NCAS0B03540 Chr2 complement(622522..627573) [5052 bp, 1683 aa] {ON}
            Anc_8.313 YDR141C
          Length = 1683

 Score = 32.3 bits (72), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (76%), Gaps = 2/30 (6%)

Query: 965  LFETKEYQSIRLGSFNLTNS--TMIPLLSG 992
            +FETKE++S +L + NL N   T++PLL+G
Sbjct: 1608 IFETKEFESNKLNTLNLANQADTVLPLLTG 1637

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,238,116
Number of extensions: 6084552
Number of successful extensions: 22774
Number of sequences better than 10.0: 139
Number of HSP's gapped: 23370
Number of HSP's successfully gapped: 151
Length of query: 1220
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1099
Effective length of database: 39,606,813
Effective search space: 43527887487
Effective search space used: 43527887487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)