Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YLR044C (PDC1)5.122ON56356328690.0
Smik_12.1065.122ON56356328300.0
Skud_12.1105.122ON56356328160.0
Suva_10.1285.122ON56356328100.0
Suva_10.227na 1ON56356326220.0
Skud_12.203na 1ON56356326020.0
YLR134W (PDC5)na 1ON56356325980.0
CAGL0M07920g5.122ON56456325740.0
TDEL0E050805.122ON56356225700.0
Smik_12.197na 1ON56356325650.0
KAFR0E020205.122ON56456325550.0
NCAS0D016605.122ON56456325360.0
NDAI0C031105.122ON56456325310.0
TBLA0B075205.122ON56356325040.0
KLLA0E16303g5.122ON56356224940.0
NDAI0A01400na 2ON56356224850.0
KLTH0B01188g5.122ON59356224830.0
Kpol_1010.485.122ON56356324830.0
SAKL0G14894g5.122ON56456324770.0
ZYRO0F01606g5.122ON56356324710.0
ACL134C5.122ON58656324610.0
TPHA0H009505.122ON56356324590.0
SAKL0G10164gna 3ON56456324580.0
YGR087C (PDC6)na 4ON56356324560.0
TPHA0Q00120singletonON56356324450.0
Suva_7.369na 4ON56356324400.0
NCAS0A14630na 2ON56356224280.0
Kwal_33.155405.122ON56456224260.0
Ecym_24795.122ON56456324010.0
TBLA0B10060singletonON56456324010.0
KAFR0E01520singletonON56356323840.0
SAKL0F04334gsingletonON56456323830.0
TBLA0E03070singletonON56356323660.0
AAL073Wna 3ON56356223470.0
NDAI0A02510singletonON56356323350.0
KNAG0J01340singletonON56556223340.0
TBLA0D02840singletonON56356323210.0
KNAG0J01330singletonON56456323110.0
KNAG0M012505.122ON56356323030.0
NCAS0A14240singletonON56556422900.0
NDAI0D03270singletonON52152122540.0
KLTH0D08272gsingletonON56356222490.0
CAGL0G02937gna 4ON56456320900.0
Ecym_3185na 3ON56356320370.0
SAKL0E04972g2.390ON61155018620.0
ZYRO0A08426g2.390ON58454916190.0
KLTH0E09702g2.390ON60755116060.0
YDL080C (THI3)2.390ON60955616050.0
Suva_4.1672.390ON62055616030.0
Kwal_47.178782.390ON61055115740.0
TDEL0G032102.390ON60656715690.0
Skud_4.1752.390ON62056115580.0
Smik_4.1562.390ON62155615500.0
KNAG0A059002.390ON62055815320.0
TPHA0G026202.390ON68859315360.0
NCAS0A040002.390ON62556815100.0
CAGL0L06842g2.390ON63857515090.0
KAFR0F029902.390ON60856114760.0
TBLA0B088202.390ON63558814680.0
NDAI0E017002.390ON62156814600.0
Ecym_60552.390ON59256113590.0
ADR254W2.390ON58155412821e-171
Kpol_1046.92.390ON59856211031e-143
KLLA0F16962g2.390ON5785558601e-107
CAGL0A03102g5.456ON6496018391e-104
SAKL0G03036g5.456ON6376028281e-102
Kpol_1062.125.456ON6305968251e-102
ACR211W5.456ON6295968211e-101
KLTH0F15510g5.456ON6256038131e-100
Skud_4.6515.456ON6356058013e-98
Suva_2.5545.456ON6356098014e-98
NCAS0A118305.456ON6376117995e-98
YDR380W (ARO10)5.456ON6356137901e-96
Smik_4.6495.456ON6356127865e-96
KAFR0E037305.456ON6356107796e-95
TPHA0J026805.456ON6486287701e-93
TBLA0A026705.456ON6406077657e-93
Kpol_440.45.456ON6366017561e-91
KNAG0C047905.456ON6376077456e-90
ZYRO0G04378g5.456ON6136067383e-89
TPHA0E016005.456ON6516167317e-88
KLLA0E02707g5.456ON6316027272e-87
TBLA0A064205.456ON6386157221e-86
TDEL0D024505.456ON6756107136e-85
SAKL0D00220gsingletonON5775756682e-79
TDEL0C07020singletonON5605666168e-72
TDEL0F00150singletonON5605666141e-71
KLTH0D00418gsingletonON5615646132e-71
NDAI0A044505.456ON5615566096e-71
NCAS0F015002.441ON6843821992e-15
YMR108W (ILV2)2.441ON6873101973e-15
Skud_7.383na 4ON86911764e-15
NDAI0H023802.441ON6853001966e-15
CAGL0K03465g2.441ON6773101912e-14
KAFR0A005702.441ON6823101912e-14
Smik_13.2972.441ON6873101912e-14
KNAG0E023602.441ON6933071902e-14
Kpol_297.122.441ON6713101893e-14
TBLA0I014002.441ON7103151894e-14
NCAS0A043202.441ON6893141885e-14
KNAG0A062502.441ON6803161822e-13
Kwal_26.75822.441ON6793021804e-13
TPHA0G024402.441ON6913031805e-13
SAKL0E03740g2.441ON6793111788e-13
Suva_13.2872.441ON6873031788e-13
KLLA0B12584g2.441ON6913041779e-13
KLTH0D04532g2.441ON6783021733e-12
TDEL0A021602.441ON6823041706e-12
Skud_13.2672.441ON6873031699e-12
ZYRO0E03454g1.450ON5494971681e-11
TPHA0G028852.441ON6883031672e-11
ZYRO0G19954g2.441ON7003111662e-11
Ecym_61072.441ON6893861644e-11
NDAI0E020502.441ON6903111626e-11
NCAS0G039601.450ON5775221591e-10
TDEL0B055201.450ON5552911545e-10
AEL305C2.441ON6683081546e-10
TPHA0B039401.450ON5755191288e-07
Skud_5.761.450ON5602921252e-06
Ecym_13601.450ON5444981232e-06
Smik_5.871.450ON5605091233e-06
YEL020C1.450ON5605061215e-06
AEL055C1.450ON5452451207e-06
KNAG0H015801.450ON5602661118e-05
Suva_5.681.450ON5615101045e-04
Kwal_34.161161.450ON5532951000.002
SAKL0D10934g1.450ON550134900.029
KLTH0H14102g1.450ON551289830.16
TDEL0C027907.418ON2786150771.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR044C
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...  1109   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...  1094   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...  1089   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...  1087   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...  1014   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...  1006   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...  1005   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   996   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   994   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   992   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   988   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   981   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    979   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   969   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   965   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              961   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   961   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   961   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   958   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   956   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   952   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   951   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   951   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   950   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      946   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   944   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   939   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   939   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   929   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   929   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   922   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   922   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              915   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   908   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   904   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   903   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   898   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   894   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   891   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            886   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              872   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   870   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   809   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   789   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   721   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   628   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   623   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   622   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   622   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   610   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   608   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   604   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   601   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   594   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   596   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   586   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   585   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   573   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   570   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    566   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   528   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   498   e-171
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   429   e-143
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   335   e-107
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   327   e-104
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   323   e-102
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   322   e-102
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   320   e-101
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   317   e-100
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   313   3e-98
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   313   4e-98
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   312   5e-98
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   308   1e-96
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   307   5e-96
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   304   6e-95
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   301   1e-93
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   299   7e-93
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   295   1e-91
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   291   6e-90
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   288   3e-89
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   286   7e-88
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   284   2e-87
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   282   1e-86
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   279   6e-85
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   261   2e-79
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   241   8e-72
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                241   1e-71
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   240   2e-71
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   239   6e-71
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    81   2e-15
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    80   3e-15
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    72   4e-15
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     80   6e-15
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    78   2e-14
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    78   2e-14
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    78   2e-14
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    78   2e-14
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    77   3e-14
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    77   4e-14
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    77   5e-14
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    75   2e-13
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    74   4e-13
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    74   5e-13
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    73   8e-13
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    73   8e-13
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    73   9e-13
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    71   3e-12
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    70   6e-12
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    70   9e-12
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    69   1e-11
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     69   2e-11
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    69   2e-11
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    68   4e-11
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    67   6e-11
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    66   1e-10
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    64   5e-10
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    64   6e-10
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    54   8e-07
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    53   2e-06
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    52   2e-06
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    52   3e-06
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    51   5e-06
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    51   7e-06
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    47   8e-05
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    45   5e-04
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    43   0.002
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    39   0.029
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    37   0.16 
TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7....    34   1.2  

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score = 1109 bits (2869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/563 (97%), Positives = 549/563 (97%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/563 (96%), Positives = 545/563 (96%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPIDMSLK NDAESEKEVIDTIL+LVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLT IADAAKGYKPVAVPA TPANAAVP
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEWMWNQLG+FLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQ WDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/563 (95%), Positives = 543/563 (96%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPIDMSLKPNDAESEKEVIDTI+ALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPRYGGVYVGTLSKP VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPA TPANAAV 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQ WDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/563 (95%), Positives = 543/563 (96%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL QVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPIDMSLKPNDAESEKEVIDTILALVKDAKNP+ILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRYGGVYVGTLSKPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTT+ADAAKGYKPVAVPA TPANAAVP
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEWMWNQLG FLQEGDVVIAETGTSAFGINQ  FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQ WDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFN+NSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/563 (87%), Positives = 522/563 (92%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL QV+ NTVFGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPIDM+LKPNDAE+E EV+ T++ +++DAKNPVILADAC SRHDVKAETKKLIDLTQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y+TKNIVEFHSDH+KIRNATFPGVQMKF LQ+LL+ I +  K YKPVAVPARTPAN A+P
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTP+KQEWMWNQL  FLQEGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNE+Q WDHL+LLPTFGAKDYETHRV TTGEWDKLTQDK F DNS+IRMIE+ML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLV+QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/563 (86%), Positives = 518/563 (92%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL QVN NTVFGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIA+AP+EIDRCIRTT+ TQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPIDMSLKPNDAE+E EV+ T++ ++KDAKNPVILADAC SRHDVKAETKKLI+LTQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQHPRYGGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSDH+KIRNATFPGVQMKF LQKLL  I +  K YKPVAVPAR P N A P
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A+T +KQEWMWNQLGNFLQEGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNE+Q WDHLSLLPTFGA+DYETHR+ TTGEWDKLTQDK F DNS+IRMIE+ML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLV+QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/563 (86%), Positives = 520/563 (92%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL QVN NTVFGLPGDFNLSLLDK+YEV+GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDIA APAEIDRCIRTTY TQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EV+ T++ L+KDAKNPVILADAC SRHDVKAETKKL+DLTQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPRYGGVYVGTLS+PEVK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKF LQKLL  I +  K YKPVAVPAR P   + P
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A+TP+KQEWMWN LGNFL+EGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQGWDHL+LLPTFGA++YETHRVATTGEW+KLTQDK F DNSKIRMIE+ML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLV+QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/563 (86%), Positives = 514/563 (91%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND E+E EV+DT+L L+K AKNPVILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  + +A KGYKPV VPAR P N +  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQEWMWNQ+  FLQEGDVVI ETGTSAFGINQT FPNN YGISQVLWGSI     
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQ WDHL+LLPTFGAKDYE HRVATTGEWDKLTQDK FN NSKIRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP +L+EQAKLTA+ NAKQ
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQ 563

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/562 (83%), Positives = 509/562 (90%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV+ NT+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLK NDAE+E+EV+D +LAL+K AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  + D AK YKPV VPARTP NAA  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQ+ FPN TYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KAQYN+IQ W +L LLPTFGAKDYETHRV+TTGEW+KLT D  FN NSKIRMIE+ML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/563 (85%), Positives = 514/563 (91%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL QV  NTVFGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKG++CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDLNVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EV+ T++ ++KDAKNPVILADAC SRHDVKAETKKLI+LTQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPRYGGVYVGTLS+PEVKE VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKF LQKLL  I    K YKPVAVPAR P N   P
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A+TP+KQEWMWNQL NFLQEGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A YNEIQGWDHL+LLPTFGAKDYE HR+ATTGEWDKLTQDK F DNS+IR+IE+ML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAP+NLV+QA+LTA+ NAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/563 (85%), Positives = 511/563 (90%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+EKEV+DTIL+L+KDAKNPVIL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL ++ADAAKGYKPVAVPAR P N A  
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPL QEWMWNQ   F QEGDV+I ETGTSAFGINQ+ FPNN+ GISQVLWGSI     
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQ W HL LL TFGAKDYE HRVATTGEWD L  DK FN NS+IRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QAK+TAATNAKQ
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQ 563

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/563 (84%), Positives = 514/563 (91%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL Q++V T+FGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLK NDAE+E EVI+TIL LVK AKNP+ILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSD++KI+NATFPGVQMKFVLQKLLT IA AAKGYKPVAVPA+  AN A  
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEW+WNQ+G FLQEGDVVI+ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQ W+HL+LLPTFGAKDYE HRV+TTGEWDKLT +K FN N++IRMIEIML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/563 (85%), Positives = 516/563 (91%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLK ND E+E EV++TIL L+KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD++KI+NATFPGVQMKF LQKLL ++A+AAKGYKPVAVPA+  ANAAV 
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A+TPLKQEWMWNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ WDHLSLLPTFGAKDYE HRVATTGEW KLT++K FN NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QA+LTA  NAKQ
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQ 563

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/563 (83%), Positives = 511/563 (90%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSA ISETTAMITDIATAPAEIDRCIRTTYV QR VYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EVI+T+L LV++AKNP+I+ADACCSRHDVK+ET++LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E+HPR+GGVYVGTLS+PEVK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH+K++NATFPGVQMKFVLQKL++ I  A KGYKPVAVPA  PAN  VP
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A+TPLKQEW+WNQLGNFLQEGD+V+ ETGTSAFGINQTTFP +TYGISQVLWGSI     
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEI+P KR ILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQGW+HL +LPTFGAKDYE  RVATTGEW KLT DK+F  NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QAKLTAATNAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/562 (83%), Positives = 505/562 (89%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV V T+FGLPGDFNLSLLD IYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMS+NISETTAMITDI TAPAEIDRCIRTTYV+QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPND E+E+EVI+ +L L+K+AKNPVILADACCSRHD KAETKKLIDLTQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD+ KIR+ATFPGVQMKF LQKLLT +ADAAKGYKPV VP+    N AV 
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+W Q+G FL+EGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN IQ W HL LLPTFGAKDYE  RV+TTGEW+KLT D+ F DN++IR+IE+ML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           P  DAP NLV+QA+LTAATNAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/562 (84%), Positives = 513/562 (91%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QVNVNT+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EV++ +L+L+K+AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLL ++  A KGYKPV VPA  PAN  V 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMWNQ+G FLQEGD+VI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPK+RVILFIGDGSLQLTVQEISTM+RW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W+HL LL TFGAKDYE HRVATTGEW+KL ++K FN NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAPQ+L++Q +LTA  NA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 498/562 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+Y+FERLKQV+V TVFGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMITD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID++LKPND ++E+EVI T+L ++KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSDH+KIRNATFPGVQMKFVLQ LL  +    K YKPV VP     NAAV 
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ W+HL LLPTFGAKDYE  RV+TTGEW+KL +DK FN NSKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/563 (83%), Positives = 505/563 (89%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSA ISETTAMITDIA APAEIDRCIRTTY+TQR VYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND E+E EV+DTILA+VK+AKNP+ILADAC SRHDVKAETK+LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y+TKN+VEFHSDH KI+ A+FPGVQMKFVLQKL+  I  A K YKPVA PA   +NA  P
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEW+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W HL +LPTFGAKDYE  RVATTGE++KL +DK+FN+NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/563 (83%), Positives = 507/563 (90%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTA +TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPND E+E EV++T+L L+KDAKNPVILADAC SRH+VK+ETK+LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPR+GGVYVGTLS  +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL+ + +  K YKPVAVPA+   N A  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W +L LLPTFGAKDYET+RVATTGEWDKL QD++FN NS+IRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/563 (80%), Positives = 499/563 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV+ NT+FG+PGDFNLSLLDK+YEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KG++ +ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  YV QRPVYLGLPANLVD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLK ND E+E EV+DT+L L+K+AKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSDH+KIRNATFPGVQMKFVL+KLL  + +A K YKP  VPA    NA V 
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            ST LKQEW+W Q+G+FL+EGDVVI ETGTSAFGINQT FPN TYGISQVLWGSI     
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  A+YN IQ W HL LL TFGAKDYE HRV+T GEW+KLTQD  FN+NS+IRMIE+ML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
            V DAP +LV QA+LTAATNAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  952 bits (2461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/563 (81%), Positives = 507/563 (90%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+Q+ V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANIS TTAMI+DI +APAEIDRCIRT Y+TQRPVYLGLPAN+VDL VPA L
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID++LKPND E+E EV++T+L ++  AKNPVIL+DAC SRHDVKAET KLID+TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSI EQHPR+GGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSDH+KIRNATFPGVQMK+VL+KL+  +A+  K Y PV VP++   N  + 
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ++TPLKQEW+WNQ+G FL+EGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+DP +RVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN+IQ W HL+LLPTFGAKDYE  RV+TTGEWD LTQDK+FN+NSKIRMIE+ML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTAATNAKQ
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQ 585

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/563 (81%), Positives = 500/563 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS+ITLGKYLFERLKQV   T+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPND ++E EV+  IL L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y TKNIVEFHSDH+KIR A+FPGVQMKFVL+KL+  +    KGYKPVA+PA  PAN A P
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A TPLKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W HL +LPTFGAKDYET RVATTGEWDKL  DK+FN+NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTAATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/563 (82%), Positives = 504/563 (89%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTA +TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPND E+E EV++++L L+KDAKNP+ILADAC SRHDVK ETK+LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPR+GGVYVGTLS  +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL+ I    K YKPVAVP +   N A  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTMIRWGL+PYLFVLNNDGYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W +L LLPTFGAKDYET+RVATTGEWDKL QD++FN NS+IRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/563 (81%), Positives = 505/563 (89%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERLKQVNVNT+FGLPGDFNLSLLDKIYEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKG+S ++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETT+MITDIATAP+EIDR IRTT++TQRP YLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+ PID+SLKPND E+EKEVIDT+L L++++KNPVIL+DAC SRH+VK ET+KLIDLTQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPRYGGVYVGTLSK +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSD++K++NATF GVQMKF LQ LL  I D  KGYK V VP +TPAN  VP
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEW+WN+L  FLQEGDV+I+ETGTSAFGINQT FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDP KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ WDHL+LLP FGAK YE H++ATTGEWD LT D  F  NS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAP++L++QA+LTAATNAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/563 (80%), Positives = 499/563 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS+ITLGKYLFERLKQV  NT+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPND ++E EV+  IL L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y TKNIVEFHSDH+KIR A+FPGVQMKFVL+KL+  +    KGYKPVA+PA  PAN A P
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A TPLKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ W HL +L TFGAKDYE HRVATTGEWDKL  D++FN+NSKIR+IEIML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ QAKLT ATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/563 (80%), Positives = 504/563 (89%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQVNVNT+FGLPGDFNLSLLDKIYEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKG+S +ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMS NISETT+MITDIATAP+EIDR IRTT+VTQRP YLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L  PID+SLKPND E+EKEVIDT+L L++ +KNP+IL+DAC SRH VK ET+KLIDLTQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPRYGGVYVGTLSKP+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSD++K++NATFPGVQMKF LQKLL+ I    K YK V VP +T  N  V 
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTPLKQEW+WN+L  FLQEGDV+++ETGTSAFGINQT+FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+DP +RVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ WDHL+LLPTFGAK YE H+VATTGEWDKLT D  F  NS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAP++L++QA+LTAATNAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/562 (80%), Positives = 500/562 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQVNVNT+FGLPGDFNL+LLDKIYEV GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMS+NISETTAM+TD+A A +EIDRCIRTTYVTQR VYLGLPAN+ DL V A L
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPNDA +E EV++TIL+LVKDAKNP+ILADACCSRHDVKAETKKLID+TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PRYGGVYVGTLS P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSDH+KI++ATFPGVQMKFVLQKLL  I   AKGYKPVAVP R   N   P
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A+TP+KQEWMWN+L  F QEGDV+I ETGTSAFGINQT FP N YGISQVLWGSI     
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQ W+HL+LL TFGAKDYE HRV+TTGEW+KLT +K FN NS+IR+IEIML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
            V DAP NLV QA+LTA+ NAK
Sbjct: 541 EVMDAPSNLVAQAQLTASINAK 562

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/562 (83%), Positives = 506/562 (90%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+QV  NT+FGLPGDFNL LLD+IYE EGMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAMI+D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDA +E+EV+ T+L L+K+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLT + D  K YKPVA+P     NAAV 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYET RVATTGEW+KL +D+ FN NSKIRMIE+ML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/563 (80%), Positives = 500/563 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEIT+G YLF+RLKQV V T+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISE+TAMITD+ATA  EIDRCIRT Y++QRPVYLGLPANLVD  VPA L
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID SLKPNDAE+E EV+ T+L ++ ++KNPVIL+DAC SRHDVK ETK+LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPR+GGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH K+RNATFPGVQMKFVL+KL+  + D AK Y PV VP +    + V 
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPL+QEW+W ++  FL+EGDVVI ETGTSAFGINQT FPN+TYGISQVLWGSI     
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN+IQ WDHL LLPTFGAKDYE  RV+T GEW +LTQDK+F++NSKIRMIE+ML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTAATNAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQ 563

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/563 (82%), Positives = 504/563 (89%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS+ITLGKYLFERL QV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF  FHRMSA ISETTAMITDIA APAEIDRCIRTTYVTQR VYLGLPANLVDL VPA L
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID++LKPN  ESE EVI+TIL +VK+AKNP+I+ADAC SRH+VK ET++LID+TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSI+E+HPR+GGVYVGTLS+PE+K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y+TKNIVEFHSDHMKI+NATF GVQMKFVL+KL+  I D  K YKPVAVPA  PAN  VP
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           A TPLKQEW+WNQLGNFLQEGD+V+ ETGTSAFGINQTTFP +TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEI+P KR ILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQGW+HL +LPTFGAKDYE  RVATTGEWDKLT DK+FN NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QA+LTAA NAKQ
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 492/563 (87%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTA++TDIATA AEIDRCI+TTY+TQRPVYLG+PAN+ D  +PAKL
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND E+E EVID IL+LVK AKNPVIL+DAC SRH+V+ ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPRYGGVYVGTLS+PEVK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKN+VEFHSD+ KI+NATFPGVQMKFVLQKL   I    KGYKP+ VPA+ P+N    
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPL QEWMWNQ   F QEGD++I ETGT+AFGINQ+ FP +  GISQVLWGSI     
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  +RVILFIGDGSLQLTVQEISTMIRW L+PYLFVLNN+GYTIEKLI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W HL LL TFGAKDYE HR+ATTGEWD L  +K FN NS+IR+IEIML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QAK+TAATNA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/563 (78%), Positives = 501/563 (88%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV V T+FGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSCI+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMS+ ISETTA+ITDI  AP EIDRCI+ TY  QRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+S+ PNDA++E EV++T+LA+V  AKNPVILADACC+RHDVK ETKKLIDLTQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDE HPR+GGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD+ K+RNATFPGVQMK VLQKLL+ ++DAA GYKPV VP  T +N  V 
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           +STPLKQEW+WN + ++L+EGDVVI ETGTSAFGINQ+ FPN+TYGISQVLWGSI     
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  +RVILF+GDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN++Q W HL+LLPTFGAKDY++ R++TTGE+ KLT+D++F+ NSKIR+IE+ML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP  LV+QA+LTAATNAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 487/563 (86%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERLKQVNVNT+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS ++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF VFHRMS  ISETTAMITD++ A ++ID CIR TY TQRPVYLG+PAN+ D  +PAKL
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPI+M L PN+ ESE EV++TIL +VK AKNPVI+ADACCSRH+VKAET+KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSI+E HPR+GGVYVGTL++PEVK+AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y+TKNIVEFHSDH+KI+NATF GVQMKFVL +L+  I D  K YKPV VPA  P N   P
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL+QEW+WNQLGNFLQEGD+V+ ETGTSAFGIN T FP NTYGI+QVLWGSI     
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRV LFIGDGSLQLTVQEISTMIRW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQGWDHLS+LPTFGA DYE  RVAT GEW+KLT D  FN NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ Q KLT A NA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/562 (78%), Positives = 491/562 (87%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV V T+FG+PGDFNLSLLDK+YEV+GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+K +SC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SAQAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANIS+TTA+ITDI++APAEIDRCIR  YV QRPVYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L T ID+SLKPND E+E+EV+ T+L LV +AK+PVIL+DAC SRHDVK ETK+LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPR+GGVYVGTLS P+VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSDH KIR+ATFPG++MK VLQ L+  I +AAKGY+P  VP     N    
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPLKQEW+WNQ+ +FL+EGD+VI ETGT+AFGINQT FP++T GISQVLWGSI     
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDP KRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN IQ W HL LLPTFGAKDYETHRVATTGEW  LT+ + FN NS IRMIEIML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
            V DAP +L++QAKLTAATNA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/563 (75%), Positives = 479/563 (85%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V+T+FGLPGDFNL+LLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVG PS ++QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTY+ QRPVYLG+PAN  DL VPA L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SL  N+ E+EKE +  +L LVK +KNP+I+ DAC SRHDVKAET KLI+LTQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+I+EQHPRYGGVYVGTLS+PEVKEAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y TK++VEFHSD+++I+ ATFPGVQMKF+L KL   I +  + YKP  VP R P NA + 
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            ST LKQ W+WNQL  FL+EGD+VI ETGTS FGIN+TTFP N   ISQVLWGSI     
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+DPK+RVILF GDGSLQLTVQEISTMIRW LKPYLFVLNN GYTIEKLI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A YNEIQ W+HL LL TFGAKDYE +RV+TTG W+++T DK FN+NSKIRMIE+ML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP++L++Q +LTA  N+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 478/562 (85%), Gaps = 1/562 (0%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS I+LG YLFERLKQV VNT+FGLPGDFNL LLDKIY+V G+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  +QA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF VFHRMSA ISETT MITD   A  +IDRCIRTTYV QR VYLG+PAN+ D  +P  L
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLK N+  SE++V+DTIL  VKDAKNP+I++DAC SRHDVK ET++LI++TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDE HPRYGG+YVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPAN-AAV 359
           Y+TKN+VEFHSDHMKI+NA FPGVQM+ +L+KLL  I    KGY PVAVPA+ PAN  ++
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 360 PASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
            A+ PL+QEWMWNQL  FLQEGD++I ETGTSAFGIN TTFP N  GISQVLWGSI    
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKL 479
                     EEIDPKKRVILFIGDGSLQLTVQEISTMI+W LKPYLF+LNN+GYTIEKL
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIM 539
           IHGP A+YNEIQ WDHL LLPT GAKDYE  RVAT GEW+KLTQDK FN NS+IR+IE+M
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVFDAPQNLVEQAKLTAATNA 561
           LPV DAPQ+L+EQ KLT   NA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/563 (76%), Positives = 485/563 (86%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS++TLG+YLFERL Q+ + T+FGLPGDFNL LLDKIYE+ GMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ AQAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF  F+RMS+ ISET  MI D+ TAPAEIDRCI+T YV QRPVYLGLP NLV+  VP  L
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LQTPID+SL+PNDA+SE EVI TIL +VK AKNP+I+ADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI+EQHPR+GGVYVGTL++PEVK+AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y+TKN++EFHSDH KI+NA + G+QMKFVL KL+T I +  K YKPVAVPA   AN    
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL+QEW+WNQLGNFLQEGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRV+LFIGDGSLQLTVQEISTM+ W LKPYLFVLNNDGYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W++L LL TFGAKDY+  RVATTGEW+ LTQ+  FN NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           P  DAP NL+ QA+LTA+ NAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/563 (77%), Positives = 483/563 (85%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERLKQV VNT+FGLPGDFNL LLDKIY++ GMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  +QAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF VFHRMSA ISETTA+ITD++ A +EIDRCIRTTYV QR VYLG+PAN+ D  +P  L
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLK N+ ESE EV+DTIL LV  AKNP+ILADAC SRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDE HPRYGG+YVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y+TKNIVEFHSDH+KIRNA FP +QMK +LQKL+T I      Y PVAVPAR PANAAV 
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMW +LGNFLQEGD+VI ETGTSAFGIN TTFP NT GISQVLWGSI     
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDP +RVILFIGDGSLQLTVQEIST I+W LKPYLF+LNN+GYTIEKLI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W+HL LLPTFGAKDYE  R+AT GEW+KLTQDK FN NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP++L++Q +LTAA NAK+
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKK 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 481/563 (85%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMSANISETTAM+TDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID++LKPND E+E EVI+T+L L+++A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKFVL KLL  +  A KGY PV +P R   N   P
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             T L+QEWMWN++  F ++GD+++ ETGT+AFGINQ+ FPNNT GISQVLWGSI     
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A YN IQ W H  LL  FGA DYE  ++ TTGEW  LTQDK FN+ SKIRMIE+ML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTA  N+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/564 (76%), Positives = 483/564 (85%), Gaps = 2/564 (0%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS I+LG+YLFERL QV+V+T+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFTVFHRMS+NISETT+++TD+A APAEIDRCIR TY+ QRPVYLG+PAN  DL + AKL
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SL  ND E+E E ID +L LVKDA NP+IL DAC SRHDVK ETKKLID+TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+I+EQHPRYGGVYVG L+ P +KEAVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
            KTKN+VEFHSD++KIRNA+FPGVQMKFVLQKL   +    K YKPV VP +T +N  V 
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
           ASTP+KQEWMWNQL  FLQEGD+VI+ETGTS FGINQT+FPNNT GISQVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EEIDPKKRVILF GDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEI 538
           HG  A YNEIQ W+HL L   FGAK+  +E HRV+TTGEW+KLT+ K F DN+KIRMIE+
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVFDAPQNLVEQAKLTAATNAK 562
           MLPV DAP +L++QAKLTA+ NAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/521 (78%), Positives = 448/521 (85%)

Query: 43  MRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGNANELNAAYAADGYAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRP 162
           S ++QAK LLLHHTLGNGDFTVFHRMS+N+SETTAMITD+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLNVPAKLLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACC 222
           VYLG+PAN  DL VPA LL TPID+ L PN+ E+EKE +D IL L+KD+KNP IL DAC 
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLI 282
           SRHDVKAET KLI+LTQFP FVTPMGKG+I+EQHPRYGGVYVGTLSKPEVK+AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAK 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSD++KIRNATFPGVQMKFVL KL   I +   
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPN 402
           GYKP AVPAR PAN AV  +TPLKQ WMWNQL  FL+EGDVVI ETGT  FGIN+TTFP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGL 462
           N  GISQVLWGSI              EE+DP KRVILF GDGSLQLTVQEISTMIRW L
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLT 522
           +PYLF+LNN+GYTIEKLIHGP AQYNEIQ WDHL LL TFGAKDYE HRVATTGEW KLT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 QDKSFNDNSKIRMIEIMLPVFDAPQNLVEQAKLTAATNAKQ 563
           ++K FN NS+IR+IE+MLPV DAP++L++Q +LTA  NAK 
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/562 (74%), Positives = 474/562 (84%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ITLG+YLFERL+QV   T+FGLPGDFNL LLD+IYEVEGMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KG++C+ITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS+++QAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF VFHRMSANIS+TTAM+TD+ATAP EIDRCIRTTYVTQRPVYLGLPAN+V+  V  +L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SL+PND ++E+EV+  +LALV+ A+NP+ILADACCSRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E+HPR+GGVYVGTLS P+VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y T+N+VEFHSDH K+RNA FP V MKFVLQKL+  I  A + Y P  VP R   NA  P
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL QEW+W Q+G FL+EGDVV+ ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEIS+M+RWGL+PYLFV NNDGYTIEKLI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W HL LLPTFGA DYE  RVATTGEWD LT D +FN NS+IR++E+ML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
            V DAP +LV QA+LTAATNA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/563 (68%), Positives = 458/563 (81%), Gaps = 1/563 (0%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL Q++++T+FGLPGDFNL+LLDKIYEVEG+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  ++AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DF  FHRMS+ ISETT +++D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D  V +KL
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID++L+PN  ++E+EV+D I+ ++K +K P+ILADAC SRHDVK ETK+LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE  PR+GGVYVG LS PEVK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKP-VAVPARTPANAAV 359
             T+N++EFHSDHMKIRNATFPGVQMKFVL+KLL  +    KG      VP +   +  +
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 360 PASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
                +KQEWMW  +G FLQEGDVV+ ETGTS FGI ++ FP NT GISQVLWGSI    
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKL 479
                     +EIDPKKRVILFIGDGSLQLTVQE+ST  RWGL PY+FVLNN+GYTIE+L
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIM 539
           IHG    YN+IQ WDH  +LP FGAK+YE  RVAT GEW+ +  DK FN N K+RMIE+M
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVFDAPQNLVEQAKLTAATNAK 562
           LP  D P+NL +QAKLTA+ NAK
Sbjct: 541 LPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/563 (64%), Positives = 451/563 (80%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEI++G+YLFERL QV V T+FGLPGDFNLSLLDK+YEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+ GM C++TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           DFT FHRM   I++TTA+++D ATA +EIDRCI+T  +T  PVYLG+PAN+    + A L
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+S + ND ++E EVID +L L+++A+NP+IL+DAC SR+D+K E K LID+TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGK S++EQHPRYGGVY G++SKPEVK+AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360
           Y TK+IVEFHS    I+NATF GVQMKFVLQKL   + D  + Y PV + ++   N  + 
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL Q+W+W ++  FL+EGD+VIAE+GT AFGIN+ T P  T  ISQ+LWGSI     
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480
                    +EIDP +RVILFIGDGSLQL VQE+STMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP+AQYN+IQ W+HL LLP FGAK+YE  R++T G W +LTQD  FN++SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           P  D+   LV+QAK+    N+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/550 (60%), Positives = 427/550 (77%), Gaps = 1/550 (0%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I+LG YLF+RL+Q+ V T+FGLPGDFN++LLDKIYEV G+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           IKG+ C++TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  AQ K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ V   +LQ 
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+SLK ND E EK+V+++I+  +K AKNPVI+ADAC +RHDV  ET++L+DLTQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDEQHPR+GGVYVG++S PEV+E V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
           KN+V  +++H K++NA +P +++KFVLQ LL ++++    YKP  VP        +  + 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
           PL+QEW+WNQ+ ++  EGD+VI ETGTSAFGINQT FPNNT  ISQVLWGSI        
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIH-G 482
                 EE+  K RVILF+GDG+LQLTVQEISTMIRWGLKPYLFV+NN GYTI++L+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPV 542
             A Y++IQ WD+L LLP FGA +Y+  +V T G++ KL  D  F  + K++MIE++LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 FDAPQNLVEQ 552
            DAP  L+ +
Sbjct: 554 MDAPPALLNK 563

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/549 (51%), Positives = 387/549 (70%), Gaps = 1/549 (0%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           IT+  Y F RLKQ+ V T+FGLPG+FN  L+DK+Y +EG+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CII+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  SAQ +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHRM+  +S  +A+I D      E+D CIR  Y+ QRPVY+G+P NLV + V +  L  
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           PID+S+ PND   E EVID IL     A NPVI+ADAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P++GGVY G++S P V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
             +V  +   +K ++AT+P + +K +L  LL  + +    Y+    P        +P + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
           PL+QEW+WNQ+  +  EGDV+I ETGTSAFGINQT FP +T GISQ LWGS+        
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGP 483
                 +E     RV+LF+GDG+ QLT QE+ST+IRWGL PY+F++NN GY++++ +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 KAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVF 543
            A Y +IQ W++ +L   FGAKDYE+ ++ T G++  +  D +F+   +IR++EIMLP  
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPQNLVEQ 552
           D PQ L E+
Sbjct: 551 DVPQALREK 559

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/551 (50%), Positives = 399/551 (72%), Gaps = 1/551 (0%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           EI L +Y+  RL+Q+ + T+FG+PG FN+ LL +I  V  M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK ++C++TTFGVGELSA+NG+AGS+AEHVG+LH VG+P ++AQ ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
            VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V + LL 
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
            P+D+S    + E +++ ++ IL+ +   ++P I+ DAC SRH+V AE ++L++LTQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPR+GG +VG++S P+V+E V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAS 362
            KN     S + +++NA +P +++K  L+ LLT +  +   Y+P  VP        + ++
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
            PL+QEW+WNQ+ N+ +EGD+VI ETGTSAFG+NQ+ FPNNT  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIH- 481
                   E     RVILF+GDG+LQLTVQE+STMIRWGLKP +FV+NN GYTI++L+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 482 GPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLP 541
              A Y++IQ WD+L LLP FGA DY+T  V T G++  L  D  F  N+KI+M+E++LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VFDAPQNLVEQ 552
             DAP  L+++
Sbjct: 554 PMDAPPALMDK 564

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/556 (50%), Positives = 398/556 (71%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q+N++T+FGL G+F++ LLDK+Y +  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  IL+ +  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
           KN    +S  +K++NAT+P + +K +LQK+L  + ++   Y+P   P+          + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++ ++ Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  +  D +F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/556 (50%), Positives = 398/556 (71%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q+N++T+FGL G+F++ LLDK+Y++  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  IL+ +  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
           KN    +S  +K++NAT+P + +K +LQKLL T+ ++   Y+P   P+          + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++  + Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  +  D +F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/551 (49%), Positives = 390/551 (70%), Gaps = 1/551 (0%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +ITL ++L  RL+Q+ + T+F +PG F++  + +IY+   M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK + C+ TTFGVGELSA+NG+AG++AEHVG+LHVVG+P ++AQ KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
            VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL 
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
            P+D+     + ++E+  ++T+L  +    NP I+ADAC SRH+V+AE K L+DLTQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQHPR+GG +VG++S P+V+E V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAS 362
           TKN V   SD+ K++NA +P + +K VL+ +L  +  +   Y+P  VP        + ++
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
            PL+QEW+W Q+  + +EGD+VI ETGTSAFG+NQ  FP++T  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIH- 481
                   E     RVILF+GDG+LQLTVQEISTMIRWGL P +F++NN GYTI++L+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 482 GPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLP 541
              A Y++IQ WD+L +LPTFGA +YE   V T G++  L  D  F  N KI+M+E++LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VFDAPQNLVEQ 552
             DAP  L+++
Sbjct: 554 PMDAPPALMDK 564

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/567 (49%), Positives = 398/567 (70%), Gaps = 8/567 (1%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I++ +YLF RLKQ+++ T+FGLPG FN +LLDK+ E+ G+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CIITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHRM++ ++  + +I D      E+D CI   +  Q+PVY+G+P NLVD +V ++ L T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
            ++++L  ND ++E E++  IL  +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P +GGV++G++S PEV+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
           K  V  +   +K ++A +P +++K ++  LL  + ++   Y+    P      + +P+  
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+ EW+WNQ+ ++ QEGD++I ETGTSAFGINQT FP+++ GISQ LWGS+        
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 XXXXXXEEIDPKK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
                  E+   +      RVILF+GDG+ QLTVQE+STMIRWGL PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 KLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L L+P FGA+ YET ++ T G++ ++  D  F  N KIRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EIMLPVFDAPQNLVEQAKLTAATNAKQ 563
           EIMLP  D PQ L+++  LT   N K+
Sbjct: 553 EIMLPPMDVPQALMDRW-LTEQENKKR 578

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/561 (50%), Positives = 401/561 (71%), Gaps = 17/561 (3%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q+N++T+FGL G+F++ LLDK+Y++  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  IL+++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
           KN    +S  +K++NAT+P + +K +LQKLL ++ ++   Y+P   P     N  VP   
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQP-----NMMVPRPY 369

Query: 364 P-----LKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXX 418
           P     L+QEW+WN++  + Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+   
Sbjct: 370 PAGNVLLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYT 429

Query: 419 XXXXXXXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
                      +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN 
Sbjct: 430 MGACLGAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQ 489

Query: 473 GYTIEKLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNS 531
           GY++++ +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  L  D +F  N 
Sbjct: 490 GYSVDRFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAIND 549

Query: 532 KIRMIEIMLPVFDAPQNLVEQ 552
           KIRMIEIMLP  D PQ L+++
Sbjct: 550 KIRMIEIMLPPRDVPQALLDR 570

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 397/556 (71%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RL Q+N++T+FGL G+F++ LLDK+Y +  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           VFHR++++++  T +I D      E+D+CIR  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  IL+ +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAST 363
           KN    +S  +K++NAT+P + +K +LQKLL ++ ++   Y+P   P+          + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++ ++ Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
                 +EI        K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQVLLDR 570

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/558 (49%), Positives = 380/558 (68%), Gaps = 9/558 (1%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL+Q+ V T+FGLPG+FN+ LLDKIY +  MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK + C++TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
            VF+RM+ +++  T ++ D      E+D+C+   +  Q+P YLG+P N VDL V +  L 
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           TP+++  +PN+ E E +V+ TIL  +   +NP I+ DAC  RHD+  ETK+   +T FP 
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    +GGV+ G+LS P V+E V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAS 362
           TKN    HS  +K++NAT+P + +K ++Q LL+ +  +         P    +   +  +
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
             LKQEW+WN+L ++ Q+GD++I E GTSAFGINQT FP  T GISQ LW S        
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 XXXXXXXEEIDP--------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGY 474
                  +E+          + RV+LF+GDG+ Q+T+QEISTMIRW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIEKLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKI 533
           ++++ +H   KA Y ++Q W +L     FGA DYET ++ T G+   +  DK F  + KI
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEIMLPVFDAPQNLVE 551
           RM+EIMLP  D PQ LVE
Sbjct: 556 RMLEIMLPSTDVPQVLVE 573

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/593 (48%), Positives = 400/593 (67%), Gaps = 43/593 (7%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           E+T+ +YLF RLKQ+NVNT+FGLPG+FN+SLLDK+Y VEGMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+K + C++TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
            +FHR+S +I   +A++T       EID+C+   +++Q+PVYLGLP NLV + V + LL 
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           TP+D+ L  ND ++E   ID IL  +  AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE   ++GGV+VG++S  +V+E V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVP------------ 350
           TK+IV   S  +K++N  +P + +K  L KL+  I      YKP+  P            
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 351 --------ARTP-ANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFP 401
                   ++TP  N +    T LKQEW+WN+   + +EGD++I ETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNTYGISQVLWGSIXXXXXXXXXXXXXXEEI---DP---KKRVILFIGDGSLQLTVQEIS 455
           N T GISQ LWGS               EEI   +P   K RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMIRWGLKPYLFVLNNDGYTIEKLI----------------HGPKAQYNEIQGWDHLSLL 499
           TM++W L PY+F++NN GY++++ +                      Y +IQ WD+L+L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVEQ 552
             F A +YET++V +  +  K+   KSF++  +IRM+EI+LP  D P++L+E+
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/568 (47%), Positives = 389/568 (68%), Gaps = 15/568 (2%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +IT+ +YLF RLKQ+++ T+FGL G++N+ L+DK+Y+V  +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+KG+  +ITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
           +VFHR++++I+    +I D      E+D+CI   ++ QRPVY+G+P N V+L V +K L 
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
            P+D+ +  N  E   E+ + IL  +   K+P I+ DAC  RH+   E ++    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P +GGV++G+LS P V+E V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAS 362
            K+ V   SD +KI+N+ +  + +K +++ LL ++ ++   Y     P+       +P  
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
             L+QEW+WN++ ++ +EGD++I E GTSAFGINQT FPN   GISQ LWGS        
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 423 XXXXXXXEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFV 468
                  +E +               K RVILF+GDG+ QLT+QE+ST+IRW L PY+FV
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNDGYTIEKLIH-GPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSF 527
           LNN+GY++++ +H    A Y +IQ W++L L+ TF AK+YET ++ T G++  + QD  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NDNSKIRMIEIMLPVFDAPQNLVEQAKL 555
             N KIRM+EI+LP  D PQ LV+  KL
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/575 (48%), Positives = 385/575 (66%), Gaps = 29/575 (5%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S+I++ +YLF RL Q+ + T+FGLPGDFN+ LLDK+Y +  MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           +R+K + C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLL 181
           ++VF+R++ +I+  TA+I D      E+D CIR  +  Q+PVYLG+P N VD+ V +  L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 QTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
             PID+S+     E++ +VID +L  +  A  P+I+ DAC  RHD   ET  L +LT FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  +GGVY G+LS PEV+E  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYK-----PVAVPARTPAN 356
           K KN        +KI+ ATFP + +K  LQ L+ TI  +   YK      +  P   P++
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 357 AAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIX 416
           + +     L+QEW+WN++ ++ +E D++I ETG+SAFGINQT FP NT GI+Q LWGS+ 
Sbjct: 371 SNL-----LRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVG 425

Query: 417 XXXXXXXXXXXXXEE------------------IDPKKRVILFIGDGSLQLTVQEISTMI 458
                        EE                  I  + R ILF+GDG+ QLTVQE+ST+I
Sbjct: 426 FALCSCLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTII 485

Query: 459 RWGLKPYLFVLNNDGYTIEKLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGE 517
           RW LKPY+F++NN+GY++++ +H    A Y ++Q W++L LL  FG   +ET ++ T  +
Sbjct: 486 RWKLKPYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSD 545

Query: 518 WDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVEQ 552
           + +L  D+SF    KIRMIEIMLP  D P+ L+ +
Sbjct: 546 FKELLADESFAKPDKIRMIEIMLPQSDVPKTLIAR 580

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/561 (47%), Positives = 381/561 (67%), Gaps = 14/561 (2%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           EIT+  YLF RLKQ++V T+FGLPG+FN+ LLD++Y + G++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+KG+ CIITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
            VFHRM+ ++S  + +I D      E+D+CI   Y+ Q+PVYLG+P N V+L V +  L 
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
             +   +  N+ + E E I+ IL  +   ++P I+ DAC +R D   ET++ I LT FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P +GGV+ G++S P V+E V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPAS 362
           +KN V    D ++ + + +P + +K +++ +L+ +      ++P +     P    VP S
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTS-DCNNP--MIVPKS 368

Query: 363 TP-----LKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXX 417
            P     L+QEW+W++  ++ QEGD++I E GTS+FGINQ  FP++T GISQ LWGS   
Sbjct: 369 KPSDDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGY 428

Query: 418 XXXXXXXXXXXXEE-----IDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
                        E        ++RVILFIGDG+ Q+T+QEISTMIRW L PY+F+LNN 
Sbjct: 429 SMGSCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQ 488

Query: 473 GYTIEKLIHGPK-AQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNS 531
           GY+I++ +H  K     ++Q W++LS    FGA DYET ++ T G+  ++  ++ F+   
Sbjct: 489 GYSIDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRAD 548

Query: 532 KIRMIEIMLPVFDAPQNLVEQ 552
           +IRM EIMLP  D P+ +V++
Sbjct: 549 RIRMAEIMLPSMDVPKAIVDK 569

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/588 (46%), Positives = 390/588 (66%), Gaps = 28/588 (4%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           ++ITL  YLF RL Q  ++TVFGLPG+FN+ L+DK+  +  ++WAGNANELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           ARIKG+ C++TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLL 181
           +TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +   + + LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 QTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
              +D +L+ N+  S+ +VI+ IL  +   K PVI+ DAC +RH+++ ET++L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P + GV+ G++S P+V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP- 360
           K+K+ +   SD++K RN TF  + +K +++KLL  + D +K  K   +      N  +P 
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLAL-DVSK-IKNFQLQENNNGNIYIPN 368

Query: 361 ----ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIX 416
                +  L+QEW+WNQL ++ Q+GD++I ETGT+AFGINQT FP+N  GISQ LWGS  
Sbjct: 369 IKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTG 428

Query: 417 XXXXXXXXXXXXXEEID--------------------PKKRVILFIGDGSLQLTVQEIST 456
                         EI                     PK RVILFIGDG+ QLTVQE+ST
Sbjct: 429 YSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELST 488

Query: 457 MIRWGLKPYLFVLNNDGYTIEKLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATT 515
           +IRWGL PY+F++NN GY+ ++ +H    A Y +I  WD+L LL  FGAK YE+ ++ T 
Sbjct: 489 IIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITV 548

Query: 516 GEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVEQAKLTAATNAKQ 563
           G+++K+  + +F  +S +RMIEI+LP  D PQ L+++ +L      K+
Sbjct: 549 GDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/568 (46%), Positives = 380/568 (66%), Gaps = 15/568 (2%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S IT+ +Y+F RLKQ+ + T+FGLPG+FN+ L+DK+Y++  +RWAG+ANELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           +R+KG+  ++TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLL 181
           + VF R+++ ++  T +I D      E+D+CI   +  Q+PVY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 QTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
             P+ +S   N  +   +V+  +L  +  + +PVI+ D C  RH    E ++ I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P + GV+ G++S P V+E V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPA 361
           K+KN    +SD +K  NAT+P V +K +LQ LL  + ++   Y P   P        +P 
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
              L+QEW+WN++ ++ QEGD++I ETGTSAFGINQT FPN   GISQ LWGS+      
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 XXXXXXXXEEI--------------DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF 467
                   +E                 K RVILF+GDG+ QLT+QE+ST++RW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNDGYTIEKLIHG-PKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKS 526
           +LNN GY++++++H    A Y +IQ WD+L+L+ TF A D +T ++ T G+   + +D  
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNDNSKIRMIEIMLPVFDAPQNLVEQAK 554
           F  +++IRMIE+MLP  D P+ LV+  K
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALVDTWK 578

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 369/561 (65%), Gaps = 12/561 (2%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +I LGKYLF RL Q+NV T+FGLP +FN  LLD+IY++  MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK +SC++TTFGVGE+S LNGIAGS++EHV VLHVVG+P  SAQ K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQ 182
            +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    V +K L 
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDMSLKPNDAESE--KEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           +P+ +    N   S+  +E++D +L  +  A++PVI+AD C SRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  RY GVY+G++S P+V+E V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIVEFHSDHMKIRNA-TFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAV 359
           YK KNIV     + K+    T+P V++K VLQ L   +      Y    +P  +      
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVKP 372

Query: 360 PASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
            A+TPL+QEWMW +L ++ + GDV++ E GTS  G+NQ  FP+ T  +SQ LWGS+    
Sbjct: 373 DANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYSV 432

Query: 420 XXXXXXXXXXEEID-----PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGY 474
                     +E          R+ILF+GDG+LQLTVQEIST+I+WGL PY+FV+NN GY
Sbjct: 433 GACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQGY 492

Query: 475 TIEKLI----HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDN 530
           TI++L+    H   A Y  IQ W++LS++P FG  +Y+  +V   G+ D+L +D+ F++ 
Sbjct: 493 TIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSNQ 552

Query: 531 SKIRMIEIMLPVFDAPQNLVE 551
             ++M+EI+LP  DAPQ L+E
Sbjct: 553 DILKMVEIILPSMDAPQALLE 573

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  498 bits (1282), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 241/554 (43%), Positives = 344/554 (62%), Gaps = 6/554 (1%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S I L +YLF RL+Q+ V T FGLP D+N+ LLD +  V  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           AR++ +SC+++TFGVGELS +NGIAGS+AEHV VL +VG+P  SAQ ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLL 181
           + VF R++++I   + ++    TA   +D CI   Y  Q+PVY G+P NL +  +P+  L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 QTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
             P+ +  +P       E++  +L  +  AK+PV++ DAC +RH    + ++L   T FP
Sbjct: 192 DVPLPLLDEP--CAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  R+ GVYVG+LS P+V+E V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPA 361
           K KNI   H+ H ++    FP   ++ +L  L+      A       VP  +    A   
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
           +TPL+ EW+W +L  +   GD++++ETGTSAFG+ QT  P     +SQ LWGS+      
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 422 XXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI- 480
                       P +RV+LF+GDG+LQLTVQE+STM+R  L P +FVLNN GY+ ++L+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 481 ---HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIE 537
              H   A+Y ++Q W +L+L P FGA  Y+   V T GE D L  D +F   S ++M+E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 538 IMLPVFDAPQNLVE 551
           + LP  D P  L++
Sbjct: 550 VALPSMDGPPALLD 563

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  429 bits (1103), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 226/562 (40%), Positives = 333/562 (59%), Gaps = 44/562 (7%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S IT+ +YLF RLKQ+++ T+FGLPG+FN+ L+DK+Y++  +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           AR+K + C+ITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+    G+  
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLILFRNGDYK 131

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLL 181
           F +  R             DI   P    R +    +     ++            A +L
Sbjct: 132 FPMKAR-------------DILVTPRISHRNLWDEMIKPNQAWIS----------SAGIL 168

Query: 182 QTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
                   K    +        +        +  +     C R +     +K     +FP
Sbjct: 169 AYRYWRGSKIPKGKGADXXXKNLQCRTSYLSSRSLRFKEQCRRCNSDYSVRK----QKFP 224

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FV P  +    E + ++GGV+ G++S P V+E V+ ADL++ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 302 KTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGY---KPVAVPARTPANAA 358
           + K++V   S ++KIRN  +P + +K +L  LL+ +  +   Y   KP+ VP      + 
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPT-----SK 338

Query: 359 VPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXX 418
           +P+ + L+QEW+WN++ ++ QE DV+I ETGTSAFGINQT FP  ++GISQ LWGS+   
Sbjct: 339 LPSKSVLRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYS 398

Query: 419 XXXXXXXXXXXEEIDPK-------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN 471
                      +E+           RVILF+GDG+ QLT+QE+STMI+W LKPY+F++NN
Sbjct: 399 LGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNN 458

Query: 472 DGYTIEKLI-HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDN 530
            GY+I++ + H   A+Y +IQ W++L+LL  FGA DYE  ++ T  ++  + +D +F  N
Sbjct: 459 QGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARN 518

Query: 531 SKIRMIEIMLPVFDAPQNLVEQ 552
            KIRMIEIMLP  D PQ+L+EQ
Sbjct: 519 DKIRMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/555 (34%), Positives = 309/555 (55%), Gaps = 38/555 (6%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I L +YLF RL Q+N  TVFG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
             G+SC +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
           +FH              D+   P+EID C+RT +  +RPVY+GL +      VP+  L  
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PI--DMSLKPNDAESE--KEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQ 239
            I   M +K    +++  K VID I+A V  +  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P + G ++GT+S+P V+E + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAK--GYKPVAVPARTPANA 357
           +YK+KN +   +D +KI N   P + +  +L +L+ ++ D  K    +PV +P   P   
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASL-DTTKIVNSRPVTIPNMIPRVE 361

Query: 358 AVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXX 417
             P  T L+QE++W ++  +L++GDV+I+E+GTSA G+ Q  FP+NT  +SQ +W S   
Sbjct: 362 PQPV-TFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGY 420

Query: 418 XXXXXXXXXXXXEEIDP--KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYT 475
                        ++    K R+IL +GDGSLQ T QE+ST++  G KPY+FV+NN GYT
Sbjct: 421 SIGACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYT 480

Query: 476 IEKLIHGPK----AQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNS 531
           +++ ++  K    A Y +IQ W+ L L   F +++Y   R  + GE + L  DK FN + 
Sbjct: 481 VDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSD 540

Query: 532 KIRMIEIMLPVFDAP 546
           +++++E++LP  D P
Sbjct: 541 QLKIVELILPSMDVP 555

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/601 (34%), Positives = 310/601 (51%), Gaps = 54/601 (8%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE---VEGMRWAGNANELNAAYAAD 59
           EIT G+Y+F RL      +VFG+PGDFNL+LL+ +Y+    + +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQL---LLHH 115
           GY+R    + C+ITT+GVGELSALNG+AGS+AE V VLH+VGV S     K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLNVPAK-LLQTP---IDMSLKP--NDAESEKE-VIDTILALVKDAKNPVILAD 219
           +PA+  D+ V  + L+  P   ++ ++ P     ES+ E ++  +  L+ ++ NP IL D
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGD 269

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESA 279
               R+ V  +   LI   Q   F T MGK  IDE +P Y G+Y G      V E     
Sbjct: 270 VLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKC 329

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDHMKIRNAT------FPGVQMKFVL 330
           DLIL  G   ++ N G ++  Y      N+VEFHSD+++  N+         GV    VL
Sbjct: 330 DLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVL 389

Query: 331 QKLLTTI-ADAAK-GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAET 388
            +L   I AD     Y+  +  +   +     +S  + QE++ + +  +L  GDV++ ET
Sbjct: 390 NRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCET 449

Query: 389 GTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX-----------XXXXXXXEEIDPKKR 437
           G+  FG+    FP+N   +SQ  + SI                         EEI+ + +
Sbjct: 450 GSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEPK 509

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDHLS 497
           +ILF GDGS Q+T+QE+STM+   +K  +F+ NNDGYTIE+ I GP   YN+I  W+   
Sbjct: 510 LILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWTK 569

Query: 498 LLPTF----GAKDYETHRVATTGE--WDKLTQDKSFNDN---SKIRMIEIMLPVFDAPQN 548
           +   F    G+K    ++V +T E    +L + K    N    +I ++E+ + V D P+ 
Sbjct: 570 MFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPEQ 629

Query: 549 L 549
           L
Sbjct: 630 L 630

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/602 (33%), Positives = 315/602 (52%), Gaps = 54/602 (8%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           I  G+Y+FERL      +VFG+PGDFNLSLL+ +Y    + + ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
                + N +F       +H M    IS +T  + ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLNVPAKLLQTPIDMSLKPNDAES-EKEVIDT----ILALVKDAKNPVILADA 220
            +PA+  D  V A+ L T   ++L+   ++   +EV+D+    I+ L+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESAD 280
            C R     E +  + +T+  AF + MG+  +DE  P + GVY G  S P + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDHMKI------RNATFPGVQMKFVLQKL 333
           LIL  G L ++ N G +S+S+      VE HSD++              GV    VL ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LTTIADAAK---GYKPVAVPAR--TPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAET 388
           +  I D  K    Y  + V     TPA    P S  + Q+++ N +  +L  GDV + ET
Sbjct: 392 IQLI-DVTKINLKYPDLTVNPEMATPAGIHSPESQ-ITQKFLQNAMSEYLSPGDVFVVET 449

Query: 389 GTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE-------------IDPK 435
           G+  F +    FP N   ISQ  + SI              ++             +D  
Sbjct: 450 GSFQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYT 509

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDH 495
            ++IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN GYT+E+ I GP   YN+I  W  
Sbjct: 510 PKLILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKW 569

Query: 496 LSLLPTFGAKD---YETHRVATTGEW-DKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVE 551
             LL  FG  D    E  +V   GE+ D +   K   + SK+R+IE+ML + D P+ L+ 
Sbjct: 570 TKLLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLA 629

Query: 552 QA 553
            A
Sbjct: 630 MA 631

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/596 (33%), Positives = 310/596 (52%), Gaps = 49/596 (8%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY------EVEGMRWAGNANELNAAYA 57
           +  G Y+F+RL      ++FG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHT 116
           ADGY+R    + CI+TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGL 167
           L N         ++ VF  M   ++S +T  I ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLNV-PAKLLQTPI-----DMSLKPNDAESEKEVIDTILALVKDAKNPVILADAC 221
           P N   L V P  L +TP       +++ P+  E    + D I + +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADL 281
             R+   +   + I  T    F T MGK  +DE    Y GVY G     +V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDHMKI------RNATFPGVQMKFVLQK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  ++++          F GV+  ++L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLTTI--ADAAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGT 390
           +L  +  ++    Y P +  + T  +    A+  + Q+ +   + ++++ GDVV+ +TGT
Sbjct: 384 MLKMVNPSNLHLNY-PTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGT 442

Query: 391 SAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------DPKKRV 438
             F +    F +    +SQ  + SI               +             + K R+
Sbjct: 443 FQFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRL 502

Query: 439 ILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDHLSL 498
           ILF GDG+ Q+TVQE+STM+R+ +   +F+ NNDGYTIE+ I GP   YN+IQ W+   L
Sbjct: 503 ILFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYL 562

Query: 499 LPTFG-AKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVE 551
              FG AK+   + H+V TT E D +  +    D + I  +E+ L + D P+ L +
Sbjct: 563 FKAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMPKILTD 618

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 205/596 (34%), Positives = 307/596 (51%), Gaps = 44/596 (7%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYA 57
           +E+ LG+Y+F RL      TVFG+PGDFN+ LL+ +Y      EG++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   +AQ    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLNVPAK-LLQTPIDM----SLKPNDAESEKEVIDTILALVKDAKNPVILAD 219
           L +PA++ ++ V ++ L+Q P  M     L+  +  +   +   IL  +  +  P IL D
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSSTPAILCD 267

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESA 279
             C R  +  + ++L++LT    F T MGK  +DE  P Y GVY G  SK E    ++  
Sbjct: 268 GLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSK-ERNALLQEC 326

Query: 280 DLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDHMKI-RNA---TFPGVQMKFVLQKLL 334
           DLIL +G +  + NT  +++ +  ++ I+E H +++ + RN          +  VL+ +L
Sbjct: 327 DLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSIL 386

Query: 335 TTIADAAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFG 394
             +  A   +       R P      A  P+ Q  + + +   L  GDV++ +TGT  F 
Sbjct: 387 AHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTFQFS 446

Query: 395 INQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE-----IDPK-------KRVILFI 442
           +    FP +   ISQ  + SI               E     + PK        R++L  
Sbjct: 447 VFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVLCE 506

Query: 443 GDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDHLSLLPTF 502
           GDG+ Q+T+QE+ST IR+ L   + + NNDGYT+E++I GP   YN+I  WD   LL  F
Sbjct: 507 GDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLRVF 566

Query: 503 GAKDYETHRVATTGEWDKLTQD----KSFNDNSKIRMIEIMLPVFDAPQNLVEQAK 554
           G  D          +++ L +     KS    SKIR++E++L   D    L E AK
Sbjct: 567 GDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAK 622

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 202/603 (33%), Positives = 319/603 (52%), Gaps = 55/603 (9%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAA 58
            I LG+Y+FER+      T+FG+PGDFNLSLL+ IY  E    G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SAQAKQLL 112
           DGY+R    + C+ITT GVGELSALNGIAG++AE V +LH+VGV PS     SAQ+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
            H      D  +    HR+        +S ++  + DI++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLNVPAKLLQTPIDMSLKP-------NDAESEKEVIDTILALVKDAKNPVIL 217
           + +PA+  D  V A+ L+    + L+        ND + + E+ + IL  +  +  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVE 277
           AD  C R+D+ +  ++L++ T    F + MGK  +DE +  + GVY G+ S+ +V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKT-KNIVEFHSDHMKIRNA-----TFPGVQMKFVLQ 331
           + D +L VG + ++ NTG +SY +    NIVE H  ++   +A      +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLLTTIADAAK---GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAET 388
            ++T + D  K   GY+  ++P+RT      P S+ +   ++      FL  GDV + +T
Sbjct: 380 DMMTQMIDPTKLHLGYQE-SIPSRTQEYCGPPHSS-VTHSYLQTHFPKFLSSGDVFVVDT 437

Query: 389 GTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPK 435
           G+  FG+    FP++   ISQ  + SI              ++              + +
Sbjct: 438 GSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQ 497

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDH 495
            R+IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+E+ I GP   YN+I  W+ 
Sbjct: 498 PRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEW 557

Query: 496 LSLLPTFGAKDYETHRVATTGEWDKLTQ-DKSFNDNSK----IRMIEIMLPVFDAPQNLV 550
             LL  FG    E          D++++  K+F  + K    +R++E+ML V D P+ L 
Sbjct: 558 TELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQLK 617

Query: 551 EQA 553
             A
Sbjct: 618 AMA 620

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  313 bits (801), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 207/605 (34%), Positives = 307/605 (50%), Gaps = 61/605 (10%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAY 56
           ++ I+ G+Y+F RL      +VFG+PGDFNLSLL+ +Y    E  G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL-- 112
           AADGY+R    + C++TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI +++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLNVPAK-LLQTP----IDMSLKPNDAESEKEVIDTILALVKDAKNPVIL 217
            Y+ +PA+  D++V  + L+  P     D    P+  +   +++D I + +  +K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQL-FDILDRITSWMYSSKTPAIL 260

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVE 277
            D    R+ V     KLI  T    F T MGK  IDE +P+Y G Y G     +V E  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHMKI------RNATFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    I++FH ++++           F G+    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVL 380

Query: 331 QKLLTTIA---------DAAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEG 381
            +L   I               Y    +    P N     S  + Q  +   +  FL  G
Sbjct: 381 MELYKGIDVSRLSLQYDSGVTSYTNETMQLEDPTN---DQSNNITQVHLQKVMPKFLSPG 437

Query: 382 DVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP------- 434
           DVV+ ETG+  F +    FP     ISQ  + SI              ++          
Sbjct: 438 DVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDEN 497

Query: 435 -----KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNE 489
                K R+ILF GDG+ Q+T+QE+ST+++  +   +F+ NN+GYTIE+ I GP   YN+
Sbjct: 498 IGEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYND 557

Query: 490 IQGWDHLSLLPTFGAKDYETHRVATTGEWD-----KLTQDKSFNDNSKIRMIEIMLPVFD 544
           +  W    LL  FG  D   H  +T  E+      KL + KS N    I ++E+ L V D
Sbjct: 558 VMSWKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLD 616

Query: 545 APQNL 549
            P+ L
Sbjct: 617 FPEQL 621

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  313 bits (801), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 216/609 (35%), Positives = 310/609 (50%), Gaps = 64/609 (10%)

Query: 6   LGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAADGY 61
            G+Y+F RL  +   +VFG+PGDFNLSLL+ +Y    E +G++W G  NELNAAYAADGY
Sbjct: 27  FGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAADGY 86

Query: 62  ARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQLLLHH- 115
           +R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+  LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLHHL 146

Query: 116 --TLGNGDFT-----VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGL 167
              L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P Y+ +
Sbjct: 147 VPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYVFV 206

Query: 168 PANLVDLNVPA-KLLQTPIDMSLKPNDAESEKE---VIDTILALVKDAKNPVILADACCS 223
           PA+  D++V    L+  P         + SE +   +ID I   +  ++ P IL D    
Sbjct: 207 PADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVLTD 266

Query: 224 RHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLIL 283
           R+ V     KLI  ++   F T MGK  IDE +P Y G+Y G     +V E  ES DLIL
Sbjct: 267 RYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDLIL 326

Query: 284 SVGALLSDFNTGSFSYSYK-TKNIVEFHSDHMKI------RNATFPGVQMKFVLQKLLTT 336
             G  +++ N G +S++YK    I++FH ++++           F GV    VLQ+L   
Sbjct: 327 HFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELYQC 386

Query: 337 IADAAK----------GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIA 386
           I D +K           Y    +    P N     ST + Q  +   +  FL  GDVV+ 
Sbjct: 387 I-DVSKLSLQYDSRVTPYTNETMKLEDPTN---DQSTDITQIHLQKVIPKFLNPGDVVVC 442

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP------------ 434
           ETG+  F +    FP     ISQ  + SI              ++  P            
Sbjct: 443 ETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINEG 501

Query: 435 -KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGW 493
            K R+ILF GDG+ Q+T+QE+ST++++ +   + + NN+GYTIE+ I GP   YN+I  W
Sbjct: 502 YKPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSW 561

Query: 494 DHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNS--KIRMIEIMLPVFDAPQNL 549
               L   FG  D  Y  + +  T     L      N ++  +I ++E+ L V D P+ L
Sbjct: 562 KWTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQL 621

Query: 550 ---VEQAKL 555
              VE A L
Sbjct: 622 RCMVEAAAL 630

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  312 bits (799), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 204/611 (33%), Positives = 317/611 (51%), Gaps = 52/611 (8%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYAAD 59
           I  G+YL +R+      ++FG+PGDFNLSLL+ +Y      +G+RW G  NELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL---LH 114
           GY+R    MSC+ITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ +++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPANLVDLNV-PAKLLQTPI---DMSLKPNDAESEKEVIDTILALVKDAKNPVILADAC 221
            +PA+  D+ V P+ L+  P+   + ++    +   +EV   +L  + D+K P I+ D  
Sbjct: 208 FVPADFSDMLVNPSNLVSNPVITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDVL 267

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADL 281
             R     E  KLI +T    F T MGK  IDE +P+Y G+Y G      V E     DL
Sbjct: 268 TDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCDL 327

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHMKI------RNATFPGVQMKFVLQKLL 334
           +L  G  +++ N G ++Y Y +   IVE H ++++           F GV    +L++LL
Sbjct: 328 VLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRLL 387

Query: 335 TTIADAAKGYK-PVAVPARTPANAAVP--ASTPLK--QEWMWNQLGNFLQEGDVVIAETG 389
             +      +  P  V   +     +P  +S+ LK  Q  + N++ ++  +GDVV+ ETG
Sbjct: 388 EKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCETG 447

Query: 390 TSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKK------------- 436
           +  F +    FP+    ISQ  + SI              ++  PK              
Sbjct: 448 SFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSYQP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDHL 496
           R+ILF GDG+ Q+TVQE++TM+R  +   + +LNN+GYTIE+ I GP   YN+I  W   
Sbjct: 507 RLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKWT 566

Query: 497 SLLPTFGAKDYE---THRVATTGEWDKLTQDKSFND-NSKIRMIEIMLPVFDAPQNLVEQ 552
            L   FG  D +      V T  E D++ +D  +   ++ I ++E+ L V D P+ L   
Sbjct: 567 KLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQSM 626

Query: 553 AKLTAATNAKQ 563
               A   +K+
Sbjct: 627 VDAAAFKRSKK 637

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  308 bits (790), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 210/613 (34%), Positives = 317/613 (51%), Gaps = 68/613 (11%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           I  G+Y+F+RL  ++  +VFG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI +++       LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLNVPA-KLLQTPI----DMSLKPNDAESEKEVIDTILALVKDAKNPVILADA 220
            +PA+  D++V    L+  P     D  + P++ +   ++I+ I + +  +K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQLS-DIINKITSWIYSSKTPAILGDV 263

Query: 221 CCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESAD 280
              R+ V     KLI  T    F T MGK  IDE +P Y G Y G     +V E  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHMKIRNA------TFPGVQMKFVLQKL 333
           L+L  G  +++ N G ++++YK    I++FH +++++ +        F G+    +L++L
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKEL 383

Query: 334 LTTIADAAK----------GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDV 383
              I D +K           Y    +    P N     S+ + Q  +   +  FL  GDV
Sbjct: 384 YKRI-DVSKLSLQYDSNVTQYTNETMRLEDPTNGQ---SSIITQVHLQKTMPKFLNPGDV 439

Query: 384 VIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI----------- 432
           V+ ETG+  F +    FP+    ISQ  + SI              ++            
Sbjct: 440 VVCETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVK 499

Query: 433 -DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQ 491
            D K R+ILF GDG+ Q+T+QE+ST+++  +   + + NN+GYTIE+ I GP   YN++ 
Sbjct: 500 EDYKPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVM 559

Query: 492 GWDHLSLLPTFGAKDYETHRVATT------GEWDKLTQDKSFNDNSKIRMIEIMLPVFDA 545
            W    L   FG  D++     +T          KL + K+ N  S I ++E+ L   D 
Sbjct: 560 SWKWTKLFEAFG--DFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDF 617

Query: 546 PQNL---VEQAKL 555
           P+ L   VE A L
Sbjct: 618 PEQLKCMVEAAAL 630

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  307 bits (786), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 212/612 (34%), Positives = 315/612 (51%), Gaps = 60/612 (9%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAY 56
           ++ I  G+Y+F RL  +   +VFG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQL 111
           AADGY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLNVPA-KLLQTP----IDMSLKPNDAESEKEVIDTILALVKDAKNPVIL 217
            Y+ +PA+  D++V A  L++ P     D    P + +   ++ID I + +  +K P IL
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQL-LDIIDKITSWMYSSKTPAIL 260

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVE 277
            D    R+ V     +LI  T+   F T MGK  IDE +P Y G Y G     +V +  E
Sbjct: 261 GDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHMKIRNA------TFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    I++FH ++++  +        F GV    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVL 380

Query: 331 QKL--LTTIADAAKGYKPVAVPARTPANAAVP-----ASTPLKQEWMWNQLGNFLQEGDV 383
           ++L  L  +A  +  Y    V + T     +       S+ + Q  +   +  FL  GDV
Sbjct: 381 KELYKLIDVARLSLQYDS-NVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPGDV 439

Query: 384 VIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI----------- 432
           V+ ETG+  F +    FP     ISQ  + SI              ++            
Sbjct: 440 VVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVK 499

Query: 433 -DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQ 491
            D K R+ILF GDG+ Q+T+QE+ST+++  +   + + NN+GYTIE+ I GP   YN+I 
Sbjct: 500 EDYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIM 559

Query: 492 GWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFND-----NSKIRMIEIMLPVFDAP 546
            W    L   FG  D   H  +T  E+      K          ++I ++E+ L V D P
Sbjct: 560 SWKWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDFP 618

Query: 547 QNL---VEQAKL 555
           + L   VE A L
Sbjct: 619 EQLKCMVEAAAL 630

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  304 bits (779), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 202/610 (33%), Positives = 322/610 (52%), Gaps = 60/610 (9%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYAA 58
           +I  G+Y+F+R+      +VFG+PGDFNL LL+ +Y+     +G+RW G  NELNAAYAA
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  DGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQA---KQLLL 113
           DGY+R  +G+ C+ITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI +Q    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPANLVDLNVPAK-LLQTPI----DMSLKPNDAESEKEVIDTILALVKDAKNPVILAD 219
           + +P + V++ V  K LLQ P     D  L+ +      ++ + IL  +  +K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESA 279
               R+       + I LT+   F T  GK  I+EQ+P Y G+Y G      V +     
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHMKIRNA------TFPGVQMKFVLQK 332
           DLI++VG  +++ N G +++SY+    ++E H  ++++ +        F G+    VL++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLTTIADAAK---GYKPVAVPARTPANAAVPASTP----LKQEWMWNQLGNFLQEGDVVI 385
           +L  I D  +    Y P             P++ P    + Q ++   + ++L +GDV++
Sbjct: 384 MLIKI-DIKRFDFDYDPSVTKFDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDGDVLV 442

Query: 386 AETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK---------- 435
            ETG   F       P+    I+Q  + SI              ++  P+          
Sbjct: 443 VETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKIPET 501

Query: 436 --KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGW 493
              R+IL  GDG+ Q+TVQE+S+ IR+ +   + +LNNDGYTIE+ I GP   YN+I  W
Sbjct: 502 YNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAW 561

Query: 494 DHLSLLPTFGAKDYETHRVATTGE-----WDKLTQDKSFNDNSKIRMIEIMLPVFDAPQN 548
           +   +    G  D +   V TT +      +K  Q K+  + +KI  IE++L V D P+ 
Sbjct: 562 NWTKIFEALGDFDNKA-TVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDYPEQ 620

Query: 549 L---VEQAKL 555
           L   VE AK+
Sbjct: 621 LKSMVEAAKV 630

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 209/628 (33%), Positives = 326/628 (51%), Gaps = 77/628 (12%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY-------EVEGMRWAGNANELNA 54
           + ITL +Y+F RL+     ++FG+PGDFNL LL+ +Y       EVE + W G  NELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISA-QAKQLL 112
           AYAADGY+R    + C++TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMI--TDIATAPA-----EIDRCIRTT 156
           +HH++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YVTQRPVYLGLPANLVDLNVPAKLL----QTPIDMSLKP---NDAES-EKEVIDTILALV 208
           +++ +P YL +P+N+ ++ V +  L    Q  +D +LK    N +E+ E ++I+ I  L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KDAKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLS 268
             +K P IL D    R D + +  +LI       F T +GK  IDE + R+ G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 KPEVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHMKIR------NATF 321
              VK+  ES DLIL +G   ++ NTG +S+SY     I+E   D++KI       +   
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFVLQKLLTTIADAA------------KGYKPVAVPART-PANAAVPASTPLKQE 368
             + ++ V+QKLL  I D+               YK   +  ++   N    A   + Q+
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 369 WMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX------ 422
            +  ++     +GDVV+ ETG+  F I    FP  T  I+Q  + SI             
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 423 ------XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI 476
                        E+  PKK +ILF GDG+ Q+T+QE+S+++R+ +   +F+ NN+GYT+
Sbjct: 495 MRDYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTV 553

Query: 477 EKLIHGPKAQYNEIQGWDHLSLLPTFGAKDYE-----THRVATTGEWD-KLTQDKSFNDN 530
           E++  G K  YN+I  W  ++LL  FG  D+E     +  ++T  E   K+ + K+ N  
Sbjct: 554 ERIFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQ 611

Query: 531 SKIRMIEIMLPVFDAPQNL---VEQAKL 555
             I +IE+ L   D P+NL   VEQ KL
Sbjct: 612 KIIELIEVKLGEMDIPKNLKHIVEQMKL 639

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  299 bits (765), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 203/607 (33%), Positives = 308/607 (50%), Gaps = 63/607 (10%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY---------EVEGMRWAGNANELNA 54
           IT G Y+F+RL  +   +VFG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SAQAK 109
           AY+ADGY+R    +SC+ITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLNVPAK-LLQTP---IDMSLKPNDAESE------KEVIDTILALVKD 210
           RP YL +P+N  D+ V  K L+  P   +D +L  N  +S       K++   IL ++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKP 270
           ++ P ++ D    R+  K    + I+ T+   FVTP+ K +IDE +  Y G+Y G  S  
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 EVKEAVESADLILSVGALLSDFNTGSFSYSYKTK-----------NIVEFHSDHMKIRNA 319
           +V E  E++DL+L  G   ++ NTG +S+SY               +VE+ + H      
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHS--EL 380

Query: 320 TFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQ 379
            +  V    +L++LL  I  +   +K   +  R        +   + Q  +     +   
Sbjct: 381 IYRDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQASLGQAFPSTFN 440

Query: 380 EGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEID------ 433
            GD+++A+TG   F I    F +    I+Q  + SI              ++        
Sbjct: 441 PGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAMQDYPLEHVYD 500

Query: 434 ----PKK---RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQ 486
               PK    R+IL  GDG+ Q+TVQE+STMIR  +   +++ NNDGYTIE+ I GP   
Sbjct: 501 KSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTIERAIMGPTRS 560

Query: 487 YNEIQGWDHLSLLPTFGAKDYE-THRVATTGEWD---KLTQDKSFNDNSKIRMIEIMLPV 542
           YN+I  W+  +LL +FG  + + T+ V    + D   KL   K  ++N  I  +E+ML  
Sbjct: 561 YNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKCIEFMEVMLGK 620

Query: 543 FDAPQNL 549
            D P  L
Sbjct: 621 VDYPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 196/601 (32%), Positives = 313/601 (52%), Gaps = 56/601 (9%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEG---MRWAGNANELNAAYAAD 59
           +I LG+YL  RL  +   + FG+PGDFNL LL+ +Y  +G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISAQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  ++ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLNVPAK-LLQTP-IDMSLKPNDAESEK--EVIDTILALVKDAKNPVILADAC 221
            +P++  +  V +K L+  P I++S   N    EK   + + I+ L+ ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADL 281
             R          I +T+F  F T MGK  IDE    Y G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHMKIRNAT---------FPGVQMKFVLQ 331
            L  G  +++ N+G++S+ + K   I+E + +++KI             +P V M  +L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLL--TTIADAAKGYKPVAVPARTPANAAVPAST----PLKQEWMWNQLGNFLQEGDVVI 385
            L+    I DA   Y   +V +   +   +P        + Q  +  +L NFL  GDV++
Sbjct: 376 GLIAKVNIHDANTNYDK-SVKSYDTSELVLPLQQEDEEKITQVHLQRELPNFLNPGDVLV 434

Query: 386 AETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK---------- 435
            ETG+  F +    FP+N   ISQ  + SI              ++  PK          
Sbjct: 435 CETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDHSLAR 493

Query: 436 ---KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQG 492
               R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NN+GYT+E+ I GP   YN+I  
Sbjct: 494 NYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYNDIMP 553

Query: 493 WDHLSLLPTFGAKDYETHRVATTGEWDKLTQD----KSFNDNSKIRMIEIMLPVFDAPQN 548
           W+   LL   G  + E +R  T  +  +L++     K   DN+ I++IE+ L   D P+ 
Sbjct: 554 WNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDIPRQ 613

Query: 549 L 549
           L
Sbjct: 614 L 614

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  291 bits (745), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 199/607 (32%), Positives = 302/607 (49%), Gaps = 55/607 (9%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV----EGMRWAGNANELNAAYAA 58
           +I LGKYLF+R+      ++FG+PGDFNL LL+ +YE     +G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTL 117
           DG++R    + C+ITT+GVGELSALNG+AG++AE+V +LH+VGV   SA+ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
            N   + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLV-DLNVPAKLLQTPI---DMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSR 224
            + V +L     LL TP+   + SL   D  +  EV   I   +  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILS 284
           +D        I LT+   F T  GK  IDE +P Y G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIVEFHSDHMKIRNAT------FPGVQMKFVLQKLLTTI 337
            G  +++ N G +++ YK    IVE H  +++  +        F G+   FVL++L+  I
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 --ADAAKGY-----KPVAVPARTP--ANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAET 388
              +    Y     K  +   +TP   N    AST + Q  +   + ++L  GD+V+ ET
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEAST-ITQNKLSKMIPDYLNPGDIVVCET 445

Query: 389 GTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPK 435
           G+  F +     P     +SQ  + SI              ++              + K
Sbjct: 446 GSFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYK 505

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDH 495
            R+IL  GDG+ Q+TVQE+++MIR+ +   + + NN+GYT+E+ I GP   YN+I  WD 
Sbjct: 506 PRLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDW 565

Query: 496 LSLLPTFG---AKDYETHRVATTGEWDKLTQDKSFNDNSK-IRMIEIMLPVFDAPQNL-- 549
             L   FG    K   +  + TT +            N   I M+E+ L V D P  L  
Sbjct: 566 TKLFAAFGDFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDIIEMVEVKLGVMDYPHQLKH 625

Query: 550 -VEQAKL 555
            VE AK+
Sbjct: 626 MVEAAKV 632

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  288 bits (738), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 193/606 (31%), Positives = 305/606 (50%), Gaps = 52/606 (8%)

Query: 3   EITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAA 58
            I  G+YLF++L Q    ++FG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHH-- 115
           DGY+R    ++ +ITT+GVGELSA+NG+AGS AE+V VLH+VGV  + + A +   HH  
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 116 -TLGNGDFT------VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
             L + +F        +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLNVPAKLLQTPIDM--SLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHD 226
           A+  D  V    L   I++  S++   +E    ++D +L  +  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVG 286
           + ++  + I+ TQ   F T MGK  IDE +PRY G+Y G      V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIVEFHSDHMKIRNAT------FPGVQMKFVLQKLLTTIAD 339
              ++ N  +  + Y  +  ++EFH  ++++ +        F  V    VL  L   I D
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRI-D 371

Query: 340 AAK---GYKPVAVPARTPANAAVPA--STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFG 394
            +K    Y         P+   +P   ++ + Q ++  +    L  GD+++++TG+  FG
Sbjct: 372 ISKLNLQYDKAIFTTYEPSQLNLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFG 431

Query: 395 INQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP-------------KKRVILF 441
           +     P  +  ++Q  W SI              ++                K +++L 
Sbjct: 432 VRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLG 491

Query: 442 IGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWDHLSLLPT 501
           +GDG+ Q+TVQE++TM+R+ +   +FV NN+GYTIE+ I G  + YN+I  W    L   
Sbjct: 492 VGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEA 551

Query: 502 FG---AKDYETHRVATTGEWDKLTQDKSFNDNSK-IRMIEIMLPVFDAPQNLVEQAKLTA 557
           FG    K   +  V T  E D+  +D   N   K I ++E+ L V D P  L  Q  L+ 
Sbjct: 552 FGDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL--QMMLSN 607

Query: 558 ATNAKQ 563
             NAK+
Sbjct: 608 MKNAKK 613

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  286 bits (731), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 197/616 (31%), Positives = 317/616 (51%), Gaps = 59/616 (9%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEG------MRWAGNANELNAA 55
           + I  GKY+F RL+     +VFG+PGD+NL+LL+++Y+ E       ++W G  NELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLH 114
           YAADGY+R    + C+ITT+GVGELSA+NGIAG++ E+V +LH+VGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H + N +        + +   M  N IS +T  + +IATA  + D  +R  +   +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANLVDLNVP-AKLLQTP---IDMSLKPNDAESEKEVIDTILALVKD----AKNPVIL 217
            +P    +L V  A L   P   ++ S+ P+    +   ID +  + KD    +K P I+
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDS--IDRLTQITKDLIYQSKRPAII 273

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVE 277
            D    R        +LI  T    F T MGK  I+E +  Y G++ G   K EV + + 
Sbjct: 274 GDILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIR 333

Query: 278 SADLILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDHMKIRNATFPGV----QMKFV- 329
             DLIL  G   ++ N+G ++   Y  K   I+EFHS+++KI++ +   V     + F+ 
Sbjct: 334 QCDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIH 393

Query: 330 LQKLLTTIADAAK---GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIA 386
           + K L  I D +K    Y  ++   +T  +    ++  + Q+++ + +   L  GD+++ 
Sbjct: 394 VLKRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLC 453

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE------------IDP 434
           +TGT  F +     P     ISQ  + SI              ++            I  
Sbjct: 454 DTGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKT 513

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQGWD 494
           + ++IL  GDG+ Q+T+QEIST+IR+ +   +F+ NNDGYTIE+ I GP   YN+IQ W+
Sbjct: 514 QPKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWN 573

Query: 495 HLSLLPTF--GAKDY-ETHRVATTGEWDKL---TQDKSFNDNSKIRMIEIMLPVFDAP-- 546
              L+ +F    K + +T++V    E+  L    +  +FN++S +  IE+ L   D P  
Sbjct: 574 WTMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVPHI 632

Query: 547 -QNLVEQAKLTAATNA 561
            Q+ +++ K  A   A
Sbjct: 633 LQDFMDRMKKRATAKA 648

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  284 bits (727), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 191/602 (31%), Positives = 307/602 (50%), Gaps = 62/602 (10%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAY 56
           +  I  G Y+FERL      ++FG+PGDFNL LL+ +Y+      G++W G  NELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISAQAKQLL-- 112
           AADGY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
            +HH +   D          F  +   +  ++A + DI TA   +D+ I       +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANLVDLNVPAK-LLQTPI-DMSL---KPNDAESEKEVIDTILALVKDAKNPVILAD 219
           + +P +  D  V  K L+Q PI DM        D  + K   D +L  + ++  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESA 279
               R +++ E ++ I+      + T MGK ++DE++P+Y G+Y G  +  E++  V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNIVEF----HSDHMKIRNATFPGVQMK 327
           DLIL  G   ++ N G +S+ +         + NI++F      +   +  A F  V +K
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFIDIKDKNASTVEEANFVSV-LK 387

Query: 328 FVLQKLLTTIADAAK---GYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVV 384
           +V   L     D +K    Y PV    ++  +     +  + Q+ +   + N+  +GDV+
Sbjct: 388 YVNDNL-----DKSKLSFSYPPVP---KSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVL 439

Query: 385 IAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX----------XXXXXXEEIDP 434
           I ETG+  FG+    F      I+Q  + SI                        + + P
Sbjct: 440 IVETGSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVP 499

Query: 435 KK---RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNEIQ 491
           K    R+IL  GDG+ Q+T+QE ++ IR+ +   + V NN+GYT+E+ I+GP   YN+I 
Sbjct: 500 KDYIPRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIA 559

Query: 492 GWDHLSLLPTFGAKDYETHRVATTGEWDKLTQD----KSFNDNSKIRMIEIMLPVFDAPQ 547
            +   +LL  FG  + + +   T  + D+L Q     KS  + + I++ E+MLPV D PQ
Sbjct: 560 PFKWTALLNVFGDFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQ 619

Query: 548 NL 549
            L
Sbjct: 620 EL 621

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 188/615 (30%), Positives = 310/615 (50%), Gaps = 76/615 (12%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAAD 59
           + LG+YL+ +L Q+   T+FG+PGDFNLSLL+ +Y  +    G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPA 169
              ++        V+  M +  +    A ITD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLNVPAKL-----------LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILA 218
           +  D  +P  +           ++  +++ L P  +     V D IL+L+  +K P I+ 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLP--SLEMVSVCDYILSLLYSSKTPCIIG 263

Query: 219 DACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVES 278
           D    R  V  +   LI  T+   F T M KG ++E +P Y GVY G LS+  + + ++ 
Sbjct: 264 DILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQM 323

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDHMKIRN------ATFPGVQMKFVLQ 331
            DLI+  G + ++ NTG +S++YK  ++ ++ H D+++I          + G++ +    
Sbjct: 324 CDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFR---- 379

Query: 332 KLLTTIADAAKGYKPVAVPARTPANAAVPAST-----PLKQE--------WMWNQLGNFL 378
              T +    KG +P ++   T  N     S+     PL+QE        ++   +  ++
Sbjct: 380 ---TFVDMVTKGVQPNSI--NTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYI 434

Query: 379 QEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE------- 431
             GDVV+ ETG+  F +  T   ++   I+Q  + SI               +       
Sbjct: 435 NPGDVVVCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLS 494

Query: 432 -------IDP--KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHG 482
                  + P  K R+IL  GDG+ Q+TVQEI+ +I++ +   + +LNN GYTIE+ I G
Sbjct: 495 KKSSHSNVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKG 554

Query: 483 PKAQYNEIQGWDHLSLLPTFGAKDYETHR----VATTGEWDKLTQDKSFNDNSKIRMIEI 538
              ++N+I  W+   LL   G    ET       +TT  ++KL Q K +        +E+
Sbjct: 555 ADKEFNDICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEV 614

Query: 539 MLPVFDAPQNLVEQA 553
           +L   + P  L++ A
Sbjct: 615 ILNKLNIPTTLIKMA 629

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  279 bits (713), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 194/610 (31%), Positives = 307/610 (50%), Gaps = 66/610 (10%)

Query: 2   SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV-------EGMRWAGNANELNA 54
           ++I  G Y+F+RL  V V ++FG+PGD+N+ LL+ +Y+        + + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISAQA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVT 159
           +   LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVDLNVPAK-LLQTP---IDMSLKPNDAESEKEVIDTILALVKDAKNPV 215
            +P YL +P + VD  V  K L++ P   +   ++ +  +  K V + IL L+  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 216 ILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEA 275
           ++ D    R+ ++ E    I+      F T  GK  IDE  P Y G Y G  S P V E 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHMKIRNAT------FPGVQMKF 328
           + + DL+L  G   ++ N G++++ +K+   IVE H  +++  + T      + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 329 VLQKL-----LTTIA----DAAKGY--KPVAVPARTPANAAVPASTPLKQEWMWNQLGNF 377
           +L  L     L+ ++       K Y  + + +  R   N     ++ + Q  +   + N+
Sbjct: 420 ILDLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGN---DETSDITQGTLQKSMPNY 476

Query: 378 LQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI----- 432
           L  GDV+I++TGT  F I   + P+    I+Q  + SI               +      
Sbjct: 477 LNPGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHV 536

Query: 433 -DPKK-------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPK 484
            D +K       +VILF GDG+ Q+TVQE+STMIR  +   +F+ NN+GYTIE++I GP 
Sbjct: 537 WDVEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPT 596

Query: 485 AQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEW-----DKLTQDKSFNDNSKIRMIEIM 539
             YN+IQ W    LL  FG  D   H  AT  E      +KL++ K  +    I  +E+ 
Sbjct: 597 RPYNDIQPWKWTKLLEAFGDFD-GKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVK 655

Query: 540 LPVFDAPQNL 549
           L   D P  L
Sbjct: 656 LATMDVPSQL 665

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  261 bits (668), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 180/575 (31%), Positives = 285/575 (49%), Gaps = 37/575 (6%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE--GMRWAGNANELNAAYAA 58
           MS + LG YLF RL QV   TVFG+PGDFNL+LL+ +Y  +   ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLL---HH 115
           DGY+RI    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ A+     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMITD--IATAPAEIDRCIRTTYVTQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLNVPAKL-LQTPIDMSLKPN-DAESEKEVIDTILALVKDAKNPVILADACCSRH 225
           P+NL D  +P  L  Q   D   K   D  +  E++   L  +  ++NP  + D    R 
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIVDQFM-RF 238

Query: 226 DVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSV 285
           D++ +    ++   F  + T   +G  DE  P + GV+   LS     E ++  D IL +
Sbjct: 239 DLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILHL 297

Query: 286 GALLSDFNTGSF----SYSYKTKNIVEFHSDHMKI--RNATFPGVQMKFVLQKLLTTIAD 339
           G   ++ N  S+    S     K+++    D+ ++        G+      ++LL  +  
Sbjct: 298 G---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMNS 354

Query: 340 ----AAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGI 395
                 K  K  A+            S  + Q  +   +   L+E DV+I E  +  F +
Sbjct: 355 KTMPKVKTRKSTAL--YNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFEM 412

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIS 455
               +      + Q  +GSI              ++     RVILF GDGS Q+T+QE++
Sbjct: 413 PNIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQELA 472

Query: 456 TMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNE-IQGWDHLSLLPTFGAKDYE---THR 511
           + IR+ + P +F+LNN GY++E++I GP   YN+ I  WD  ++L  FG ++ +   +++
Sbjct: 473 SYIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSYK 532

Query: 512 VATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAP 546
           V   GE   +   +    + KI+M+EI+L   D P
Sbjct: 533 VEKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  241 bits (616), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 163/566 (28%), Positives = 269/566 (47%), Gaps = 21/566 (3%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL +V +   F +PGD+NL+LLDK+     +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQTP 184
              M+  I+     I     AP+ ID  IR     ++P Y+ +P N   ++  +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDMSL--KPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           I+  L   P++ ++    +D    L+     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP+Y GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKG---YKPVAVPARTPANAAV 359
             + +E  SD++K  +  +  +++   L  L   ++   K    Y+ +  P      AA 
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLR-PVPPAIKAAE 359

Query: 360 PASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
           P++   +QE M  Q+   +     + AETG S F   Q   P       ++ WG I    
Sbjct: 360 PSAAITRQE-MARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSV 418

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKL 479
                         P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE  
Sbjct: 419 PACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVE 474

Query: 480 IH-GPKAQYNEIQGWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           IH GP   YN I+ W++ +L+  F A D   +  +V T  E  +  + K+ ++     +I
Sbjct: 475 IHDGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIK-KAKSNTRGPTLI 530

Query: 537 EIMLPVFDAPQNLVEQAKLTAATNAK 562
           EI +   D    L+      A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 163/566 (28%), Positives = 269/566 (47%), Gaps = 21/566 (3%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL +V +   F +PGD+NL+LLDK+     +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQTP 184
              M+  I+     I     AP+ ID  IR     ++P Y+ +P N   ++  +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDMSL--KPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           I+  L   P++ ++    +D    L+     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP+Y GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKG---YKPVAVPARTPANAAV 359
             + +E  SD++K  +  +  +++   L  L   ++   K    Y+ +  P      AA 
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLR-PVPPAIKAAE 359

Query: 360 PASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
           P++   +QE M  Q+   +     + AETG S F   Q   P       ++ WG I    
Sbjct: 360 PSAAITRQE-MARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSV 418

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKL 479
                         P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE  
Sbjct: 419 PACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVE 474

Query: 480 IH-GPKAQYNEIQGWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           IH GP   YN I+ W++ +L+  F A D   +  +V T  E  +  + K+ ++     +I
Sbjct: 475 IHDGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIK-KAKSNTRGPTLI 530

Query: 537 EIMLPVFDAPQNLVEQAKLTAATNAK 562
           EI +   D    L+      A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  240 bits (613), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 159/564 (28%), Positives = 267/564 (47%), Gaps = 17/564 (3%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL Q  +   F +PGD+NL LLDK+ E   +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVD-LNVPAKLLQT 183
            + M+  I+     I     AP+ ID  IR     ++P Y+ +P N+   +  P   + +
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 184 PIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
            ++    P D  S  + ++  +  +     P +LA       D +    +L +  +    
Sbjct: 183 LVNSVPTPKDVLS--QAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKCAVA 240

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           V P  K    E HP++ GVY G +S  +    +E +DL +  G + +D++T  ++    +
Sbjct: 241 VQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQPS 300

Query: 304 KNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPA--NAAVPA 361
            + +E  +D+++    +F  + +   L  L   +++  K         ++P    AA P 
Sbjct: 301 SHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAADPK 360

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
           +   ++E M  Q+   +     + AETG S F   Q   P       ++ WG I      
Sbjct: 361 AAITRKE-MARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSVPA 419

Query: 422 XXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIH 481
                       P +R+I  +GDGS Q+T QE+S M+R      +F++NN GYTIE  IH
Sbjct: 420 SLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVEIH 475

Query: 482 -GPKAQYNEIQGWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEI 538
            GP   YN I+ W++ +L+  F A +   +  +  T GE     + K+  + S   +IEI
Sbjct: 476 DGP---YNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIE-KAQANVSGPTLIEI 531

Query: 539 MLPVFDAPQNLVEQAKLTAATNAK 562
            +   D    L+      A  NA+
Sbjct: 532 QINRDDCTNELITWGHFVALANAR 555

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  239 bits (609), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 170/556 (30%), Positives = 276/556 (49%), Gaps = 60/556 (10%)

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQLL 112
           ADG++R    + C+ITT+GVGELSALNGIAG+++E+V VLH+VGV     S S       
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLNV-PAKLLQTPIDMSLKPNDAESEKEVID----TILALVKDAKNPVILA 218
           Y+ +P +  D+ V P+ L + P +++L+   + +   V+D     +L  + ++K P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVES 278
           D  C R    +    LI LT    F T MGK  IDE +  Y G+Y G  S   V E    
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHMKIRNAT------FPGVQMKFVLQ 331
           +DL+L  G  + + N G ++ +YK    ++EFHS++++  +A+      F GV    VL+
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLTTIADAAKGYK-PVAVPARTPANAAVPAS----TPLKQEWMWNQLGNFLQEGDVVIA 386
           +L+ TI      ++ P  +         +P      T + Q ++   + ++L  GDV++ 
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVC 361

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------- 432
           ETG+  F I     P+    I+Q  + SI              ++               
Sbjct: 362 ETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVE 421

Query: 433 ---DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPKAQYNE 489
              D + R+IL  GDG+ Q+T+QE+++M+R+ +   + +LNN+GYTIE+ I GP   YN+
Sbjct: 422 IPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYND 481

Query: 490 IQGWDHLSLLPTFGAKDYETHRVAT------TGEWDKLTQDKSFNDNSKIRMIEIMLPVF 543
           +  WD   LL  FG  D++  R  +      +    KL Q K+    + I ++EI L   
Sbjct: 482 VMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTM 539

Query: 544 DAP---QNLVEQAKLT 556
           D P   Q++V+ A  T
Sbjct: 540 DFPKQLQSMVDAAAFT 555

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 94/382 (24%), Positives = 163/382 (42%), Gaps = 46/382 (12%)

Query: 7   GKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E +K+ NV+TVFG PG   L + D IY  E   +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVPAKLLQT 183
              +S + ++   M+  +A  P  I+         +  PV + LP      +V A +L+ 
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPK-----DVTAAILRE 257

Query: 184 PIDM-SLKPNDAESE----------KEVIDTILALVKDAKNPVI-LADACCSRHDVKAET 231
           PI + S  P+   ++           + I+    L+  AK PV+ + +   +  D     
Sbjct: 258 PIPIKSTLPSGTLTQIKSIAQEDFLADSINRAADLINLAKKPVLYVGNGIFNNEDGPRLL 317

Query: 232 KKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSD 291
           K+L +  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA   D
Sbjct: 318 KELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGARFDD 376

Query: 292 FNTGSFSYSYKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPA 351
             TG         NI +F  +  +  N    G+    +  K +  + +A      VAV  
Sbjct: 377 RVTG---------NIAKFAPEARRAANEGRGGIIHFEISPKNINKVVEAQ-----VAVEG 422

Query: 352 RTPAN--AAVPASTPLKQEWMW 371
              AN    +PA  P+K+   W
Sbjct: 423 DAAANIDKMLPAIFPIKERTEW 444

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 136/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LQTPIDMSLK-PNDA----------ESEKEVIDTILALVKDAKNPVILADACCSRH-DVK 228
           L+ PI      P++A          E   + I+    L+  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T  G GS D++ P+   + +G         AV++ADLI++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 72.4 bits (176), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGS 446
           ETG S    NQ     + + ISQVLW  I              E+IDP  R ILF GD  
Sbjct: 2   ETGASTLASNQAILLKDAHDISQVLWRPIRFANGATLSA----EDIDPG-RAILFSGDRP 56

Query: 447 LQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           L LTVQE+ T IRW LKPYLFV NND   +E
Sbjct: 57  L-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 137/300 (45%), Gaps = 18/300 (6%)

Query: 7   GKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E +K+ NV+TVFG PG   L + D IY  +  ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MS-CIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
            +  ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LNVPAKLL 181
              +S + ++   M+  +A  P  I+         +  PV + LP ++    L  P  + 
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPIK 265

Query: 182 QT-PIDMSLKPNDAES-EKEVIDTILALVKDAKNPVI-LADACCSRHDVKAETKKLIDLT 238
            T PI   LK    E+   E I+    L+  AK PV+ + +   +  D     K+L D  
Sbjct: 266 STLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDRA 325

Query: 239 QFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFS 298
           Q P   T  G G+ D++ P+   + +G         A+++ADL++++GA   D  TG+ +
Sbjct: 326 QIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTGNIA 384

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 144/310 (46%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+  +  ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+ ++A  P  I+   +  T     PV + LP      +V A +
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPK-----DVTAAI 247

Query: 181 LQTPIDM-SLKPNDA-------ESEKEVIDTILA---LVKDAKNPVI-LADACCSRHDVK 228
           L+TPI + S  P+ A         ++ VI+ I     L+  AKNPV+ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G G+ D++ P+   + +G         AV+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 367 FDDRVTGNIT 376

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 141/310 (45%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D IY+ +  ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMSCII-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G   I+  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   MI ++A  P  I+      T     PV + LP      +V A +
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 252

Query: 181 LQ--TPIDMSLKPN------DAESEKEVIDTI---LALVKDAKNPVI-LADACCSRHDVK 228
           L+   P+  SL  N      +   ++ V+D I     L+  AKNPV+ +        D  
Sbjct: 253 LRDAIPVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDGP 312

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI+++G  
Sbjct: 313 KLLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTR 371

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 372 FDDRVTGNIA 381

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 135/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LQTPIDMSLK-PNDA----------ESEKEVIDTILALVKDAKNPVILADACCSRH-DVK 228
           L+ PI      P++A          E   + I+    L+  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L    Q P   T  G GS D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 136/307 (44%), Gaps = 23/307 (7%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D IY  E  ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+ ++A  P  I+         +  PV + LP + V   V  + 
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKD-VTAAVLREA 266

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILA--------LVKDAKNPVI-LADACCSRHDVKAET 231
           + T   +      A +   V D  LA        L+  AK PV+ + +   +  D     
Sbjct: 267 IPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNEDGPRLL 326

Query: 232 KKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSD 291
           K+L D  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA   D
Sbjct: 327 KELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGARFDD 385

Query: 292 FNTGSFS 298
             TG+ +
Sbjct: 386 RVTGNIT 392

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 139/310 (44%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D IY  +  ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 241

Query: 181 LQTPIDM-SLKPNDA----------ESEKEVIDTILALVKDAKNPVILADACCSRHDVKA 229
           L+ PI + S  P++A          E  +E +    +L+  AK PV+        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              ++L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 361 FDDRVTGNIA 370

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/315 (26%), Positives = 138/315 (43%), Gaps = 33/315 (10%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M  +T G+   E +++ NV+TVFG PG   L + D IY  E  ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVP 177
                    +S + ++   M+  +   P  I+         +  PV + LP      +V 
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPK-----DVT 276

Query: 178 AKLLQTPIDM---SLKPNDAESE----------KEVIDTILALVKDAKNPVILADA-CCS 223
           A +L+ PI +   SL P  A S            E I     L+  AK PVI A A   S
Sbjct: 277 AAVLKNPIPVLNNSL-PYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILS 335

Query: 224 RHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLIL 283
             +     K+L + +Q P   T    G+ D+Q P+   + +G         A+++ADLI+
Sbjct: 336 NLNGPTLLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLII 394

Query: 284 SVGALLSDFNTGSFS 298
           ++G    D  TG+ S
Sbjct: 395 ALGGRFDDRVTGNIS 409

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 143/314 (45%), Gaps = 38/314 (12%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+T+FG PG   L + D I++ +  ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTY---VTQRPVYLGLPANLVDL--NV 176
                 +S + ++   M+  +   P    RCI   +   ++ RP  +     LVDL  +V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPV-----LVDLPKDV 255

Query: 177 PAKLLQTPIDM-SLKPNDAESE----------KEVIDTILALVKDAKNPVILADA-CCSR 224
            A +L+ PI + S  P+ A S+           E I+   AL+  AK PV+   A   + 
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNN 315

Query: 225 HDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILS 284
            D     K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++
Sbjct: 316 VDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIA 374

Query: 285 VGALLSDFNTGSFS 298
           +G    D  TG+ +
Sbjct: 375 LGTRFDDRVTGNIT 388

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/316 (25%), Positives = 138/316 (43%), Gaps = 44/316 (13%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+ ++A  P  I+         +  PV + LP      +V A +
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPK-----DVTAAI 249

Query: 181 LQTPIDM-SLKP-----------NDAESEKEVIDTILALVKDAKNPVI-LADACCSRHDV 227
           L+ PI + S  P           +DA + KE I+    L+  AK PV+ +     +  + 
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFT-KERIEKAAKLINIAKKPVLYVGGGILNNPEG 308

Query: 228 KAETKKLIDLTQFPAFVTPMGKGSIDEQHPR------YGGVYVGTLSKPEVKEAVESADL 281
               K L D  Q P   T  G G+ D++ P+        G  V  LS       +++ADL
Sbjct: 309 PKLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDMLGMHGSAVANLS-------IQNADL 361

Query: 282 ILSVGALLSDFNTGSF 297
           I+++G    D  TG+ 
Sbjct: 362 IIAIGTRFDDRVTGNL 377

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 136/302 (45%), Gaps = 34/302 (11%)

Query: 7   GKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E +++  V+TVFG PG   L++ D IY  +   +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 196

Query: 126 H--RMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVPAKLL 181
               +S + ++   M+  +   P  I+       V+ RP  +     LVDL  +V + +L
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPV-----LVDLPKDVTSAIL 250

Query: 182 QTPIDM-SLKPNDAESE----------KEVIDTILALVKDAKNPVI-LADACCSRHDVKA 229
           +TPI + S  P DA S+          K  I  +  L+  AK P++ +      R D   
Sbjct: 251 KTPIPVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPK 310

Query: 230 ETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALL 289
             ++L D  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++GA  
Sbjct: 311 LLRQLADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARF 369

Query: 290 SD 291
            D
Sbjct: 370 DD 371

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 132/303 (43%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +K+ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  I   P  I+      T     PV + LP      +V A +
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPK-----DVQASI 259

Query: 181 LQTPIDMSLK-PNDA----------ESEKEVIDTILALVKDAKNPVI-LADACCSRHDVK 228
           L+TPI +    P++A          +  +  I     L+  AK P++ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T    G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGAR 378

Query: 289 LSD 291
             D
Sbjct: 379 FDD 381

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 134/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++  V+TVFG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  S +A          +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVSTTA----------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAK 179
                  +S + ++   M+  I   P  I+      T     PV + LP      +V A 
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAA 248

Query: 180 LLQTPIDM-SLKPNDA--ESEKEVIDTILA--------LVKDAKNPVILADACCSRHDVK 228
           +L+ PI   S  P+DA  +  K  +D            L+  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 AE-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGA 287
            +  K+L +  Q P   T  G G+ D++ P+   + +G         AV++ADLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 368 RFDDRVTCNIS 378

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 133/303 (43%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LQTPIDMSLK-PNDA------ESEKEV----IDTILALVKDAKNPVILADACCSRH-DVK 228
           L+ PI      P++A       ++ E     I+    L+  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 133/304 (43%), Gaps = 32/304 (10%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  + SA          +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSA----------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAK 179
                  +S + ++   M+  I   P  I+      T     PV + LP      +V A 
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAA 260

Query: 180 LLQTPIDM-SLKPNDA----------ESEKEVIDTILALVKDAKNPVILADACCSRHDVK 228
           +L+ PI M S+ P+D           E   E I     L+  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 AE-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGA 287
            +  K+L D  Q P   T  G G+ +++  +   + VG         A+++ADLI+++GA
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLDM-VGMHGNAAANLAIQNADLIIALGA 379

Query: 288 LLSD 291
              D
Sbjct: 380 RFDD 383

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 138/302 (45%), Gaps = 34/302 (11%)

Query: 7   GKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E +++  VNTVFG PG   L++ D IY  E   +    +E  A + A+GYAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 195

Query: 126 H--RMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVPAKLL 181
               +S + ++   M+ ++   P  I+       V+ RP  +     LVDL  +V + +L
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPV-----LVDLPKDVTSAIL 249

Query: 182 QTPIDM-SLKPNDAESE------KEV----IDTILALVKDAKNPVI-LADACCSRHDVKA 229
           +TPI + S  P++A S+      KE     +     L+  AK P+I +      +     
Sbjct: 250 RTPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPK 309

Query: 230 ETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALL 289
             ++L +  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++GA  
Sbjct: 310 LLRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARF 368

Query: 290 SD 291
            D
Sbjct: 369 DD 370

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 134/304 (44%), Gaps = 32/304 (10%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I++ +   +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVPAK 179
                 +S + ++   M+  I   P  I+       V+ RP  +     LVDL  +V A 
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPV-----LVDLPKDVTAA 251

Query: 180 LLQTPIDMSLK-PNDA----------ESEKEVIDTILALVKDAKNPVILADACCSRHDVK 228
           +L+ PI      P+++          ES  E I     L+  AK PV+   A    +   
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTADLLNKAKTPVLYVGAGILNNPAG 311

Query: 229 AE-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGA 287
            +  K+L +  Q P   T    G+ D+Q P+   + +G         A+++ADLIL+VG+
Sbjct: 312 PKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVGS 370

Query: 288 LLSD 291
              D
Sbjct: 371 RFDD 374

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 131/303 (43%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LQTPIDMSLK-PNDA----------ESEKEVIDTILALVKDAKNPVILADA-CCSRHDVK 228
           L+ PI      P++A          E   + I     L+  AK PV+   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G GS D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 112/497 (22%), Positives = 200/497 (40%), Gaps = 73/497 (14%)

Query: 9   YLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM- 67
           Y    L+   V+TVFG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDFTV 124
             ++   G G + AL GI  S +    +L + G  S  AQ +   Q L   +L       
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG--SSEAQHRGGFQELDQVSL----LKP 118

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQTP 184
           + + S  ++ +     D+ T     D      Y T    YL +P NL+   V    L  P
Sbjct: 119 YVKFSGQLNSSN---IDVLT----YDALRLVQYTTAGATYLDIPGNLIGSTVKKDSL-PP 170

Query: 185 IDMSLKPN---DAESEKEVIDTILALVKDAKNP--VILADACCSRHDVKAETKKLIDLTQ 239
           +     P    D  + +EV D I       KNP  V++     + H    E ++ +D  Q
Sbjct: 171 VKNIYVPKSSPDPSAVQEVTDLI------RKNPENVLVVVGKGAVH-ASQEIRQFVDRFQ 223

Query: 240 FPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLS--------- 290
            P   TPMGKG + + HP         +S    + A++ A ++L +GA L+         
Sbjct: 224 LPFLPTPMGKGVVPDSHPL-------NVSSARSR-ALQEAKVVLVLGARLNWILHFASAP 275

Query: 291 -----------DFNTGSFSY-SYKTKNIVEFHSDHMKIR--NATFPGVQMKFVLQKLLTT 336
                      D +T +  + ++K++++  +    + +R   A+      + +   L + 
Sbjct: 276 KWNPDALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSN 335

Query: 337 IADAAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGIN 396
           IA  A         A+  +  +   S+ L    ++  L   + +   +I   G +     
Sbjct: 336 IARNA---------AKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKA 386

Query: 397 QTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIST 456
           + +FP + Y + ++  G+               +  +P K V++  GD +   +  +I T
Sbjct: 387 RVSFPTD-YPLQRLDAGT-NATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIET 444

Query: 457 MIRWGLKPYLFVLNNDG 473
             R GL   + V+NN G
Sbjct: 445 ATRSGLALIVIVMNNGG 461

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 130/303 (42%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +K+ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPK-----DVQASI 256

Query: 181 LQTPIDMSLK-PNDA----------ESEKEVIDTILALVKDAKNPVI-LADACCSRHDVK 228
           L+ PI +    P++A          +  +  I     L+  AK P++ +     +  +  
Sbjct: 257 LRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGP 316

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T    G+ D+  P+   + +G         A+++ADLI++VGA 
Sbjct: 317 RLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGAR 375

Query: 289 LSD 291
             D
Sbjct: 376 FDD 378

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 136/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V+TVFG PG   L + D I+E +   +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + SA          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVPAK 179
                  +S + ++   M+ ++   P  I+         +  PV + LP      +V A 
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPK-----DVTAA 268

Query: 180 LLQTPIDM-SLKPND--AESEKEVIDTILA--------LVKDAKNPVILADA-CCSRHDV 227
           +L+ PI   S  P+D  A+  K   D   +        LV  AK P++   A   +  D 
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDG 328

Query: 228 KAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGA 287
               K+L +  Q P   T  G G+ D++  +   + +G         A+++ADLIL+VGA
Sbjct: 329 PRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGA 387

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 388 RFDDRVTCNIS 398

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 165/386 (42%), Gaps = 48/386 (12%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++  V+T+FG PG   L + D IY  +  ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTASV 259

Query: 181 LQTPIDM-SLKPNDAESE--KEVID--------TILALVKDAKNPVILADACCSRHDVKA 229
           L++PI M S  P++   E  + V+D            L+  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-KKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGAL 288
           +  K+L +  Q P   T  G G+ D+  P+   + +G         A+++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVA 348
             D  TG         N+ +F  +  K       G+    +  K +  + DA      VA
Sbjct: 379 FDDRVTG---------NVAKFAPEARKAAAEGRGGIVHLEISPKNINKVIDAQ-----VA 424

Query: 349 VPARTPANAA--VPASTPL--KQEWM 370
           V     AN A  +P   P+  + EW+
Sbjct: 425 VEGDVTANLAKILPLIDPVETRPEWL 450

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 134/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVPAK 179
                 +S + ++   M+  +   P  I+       +++RP  +     LVDL  +V A 
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPV-----LVDLPKDVTAA 259

Query: 180 LLQTPIDMSLK-PNDAESE----------KEVIDTILALVKDAKNPVILADA-CCSRHDV 227
           +L+ PI +    P+ A S+           E I     L+  AK PV+   A   +  + 
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEG 319

Query: 228 KAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGA 287
               K L    + P   T  G G+ D++ P    + +G         AV+++DLI++VG 
Sbjct: 320 PRILKDLSQRAKIPVTTTIQGLGAFDQEDPLSLDM-LGMHGCATANLAVQNSDLIIAVGT 378

Query: 288 LLSDFNTGSFS 298
              D  TG+ S
Sbjct: 379 RFDDRVTGNIS 389

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 115/522 (22%), Positives = 204/522 (39%), Gaps = 95/522 (18%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T  +Y    LKQ  ++TVFG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGMSCIITTF-GVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           + G   ++    G G + AL GI  S +    ++ + G  S +++  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMITDIATAPAEIDRCIRTTYVTQRPV---YLGLPANLVDLN-- 175
               ++S      + T  +  I    A  +      +  Q P+   Y+  P NL++ N  
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFN---AYNFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 176 VPAKLLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNP--VILADACCSRHDVKAETKK 233
           V A+    P+ +  +   +     V +    +++++ N   VIL       H    +  K
Sbjct: 176 VQAQPATNPVSIPRRVRCSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFHK---DINK 232

Query: 234 LIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFN 293
            I+    P   TPM KG + + H          +S    K A++ A+++L +GA L+   
Sbjct: 233 FINTFNLPFLPTPMAKGILPDSHNL-------NVSSARSK-ALKDANIVLVLGARLNWIL 284

Query: 294 TGSFSYSYKTKNI-VEFHSD--HMKIRNATFPGVQMKFVLQKLLTTIADAA-------KG 343
               S  +  K I ++  +D  ++ + N T   + +   L   + +++DA        K 
Sbjct: 285 HFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLNWKY 344

Query: 344 YKPVAVPAR-----------TPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSA 392
            K ++   R                 +     L    ++  L   + E   V+   G ++
Sbjct: 345 EKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEGANS 404

Query: 393 FGINQTTFPNNT------------------YGISQVLWGSIXXXXXXXXXXXXXXEEIDP 434
             I + +FP++                   YGI+  L                   E+  
Sbjct: 405 MDIARISFPSSVPKQRLDAGTNATMGIGLGYGIAACL------------------NELRN 446

Query: 435 KKR---VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
            KR   VIL  GD +   +  EI T +R+ L   + V+NN G
Sbjct: 447 GKRGKDVILIQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 125/291 (42%), Gaps = 35/291 (12%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           +Y  + L+Q  V+TVFG+ G   + L D +   +G+++    NE +A+YAA  Y  + G 
Sbjct: 7   EYFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGK 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFH 126
              ++   G G + AL GI  S +    ++ + G                L  G F    
Sbjct: 66  PGVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAGS------------SEDLHKGGFQELD 113

Query: 127 RMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQTPID 186
           ++S  +S+       + T P  I+     TY   R    G P  +  ++ P  L+   I+
Sbjct: 114 QVSL-LSDHLKFTGKLTTDPDVIEL---VTYNAMRLTTTGTPG-VTYIDFPGSLISESIE 168

Query: 187 MSLKPNDAES------EKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
            S  P  + S      + E +  ++ L+   +N  IL        +   E +KLI+    
Sbjct: 169 RSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNL 228

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVK-EAVESADLILSVGALLS 290
           P   TPM KG + + HP         L+    + +A++ A+++L +GA L+
Sbjct: 229 PFLSTPMAKGVVPDSHP---------LNASSARSKALKEAEIVLVLGARLN 270

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 130/308 (42%), Gaps = 32/308 (10%)

Query: 7   GKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E +++ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVPAKLLQT 183
              +S + ++   M+  +   P  I+      T     PV + LP      +V A +L++
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAAILRS 241

Query: 184 PI------------DMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAE- 230
           PI             ++ +  D +  + + D    L+  A+ PV+   A         E 
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLADAS-RLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLS 290
            ++L +  Q P   T    G+ D++  +   + +G          V++ADLI+++GA   
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFD 359

Query: 291 DFNTGSFS 298
           D  TG+ +
Sbjct: 360 DRVTGNIA 367

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 110/519 (21%), Positives = 211/519 (40%), Gaps = 79/519 (15%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS I++  Y+   LK+ +++TVFG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK-----QLLLH 114
           Y  +      ++T  G G + AL GI  S   +  ++ + G   I +Q K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + ++ + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LNVPAKLLQT-----PI---DMSLKPND---AESEKEVIDTILALVKDAKNPVILADACC 222
            +V   +  +     PI    ++  PND    E+ K + D +    +D    VI+     
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRK--RDQNMLVIVGKGAI 223

Query: 223 SRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLI 282
                 +  +  I+    P   TPM KG I++ +     V  G         A++ AD+I
Sbjct: 224 G---ASSALRHFINCFNLPFLPTPMAKGIIEDSNEL--NVSSGR------SMALKDADVI 272

Query: 283 LSVGA----LLSDFNTGSFSYSYKTKNIVEFHSDHMKIRNATFPGVQMKFV------LQK 332
           L  GA    +L   +T  F  + K    ++  ++   I      G+Q   +      ++K
Sbjct: 273 LVFGAKLNWILHYGDTPKFKDNVK---FIQVDNNTKTIGLNNQRGLQNSLIGDIESTVKK 329

Query: 333 LLTTIADAAKG----YKPV--AVPARTPANA------------AVPASTPLKQEWMWNQL 374
           L   I     G    YK +  A+  +  +NA             VP +  L    ++ +L
Sbjct: 330 LTMMINHLQNGQMITYKGLSKAIKEKILSNAIKLNEKENATPRVVPNANSLNYNVVFGRL 389

Query: 375 GNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP 434
               ++ + ++   G +   + + +FP + +   ++  G++                  P
Sbjct: 390 KTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLATMGIGLGYAISTKLS-KP 447

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
            K V+L  GD +   +  E+ T +R+ L   + ++NN G
Sbjct: 448 NKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG 486

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 127/292 (43%), Gaps = 31/292 (10%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           ++  + L++  ++TVFG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDFT 123
              ++   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAK--- 179
            F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++   P +   
Sbjct: 122 PFLKFTGKLTPDNVDMVTQKA-----LNHCIQGTAGVS---YIDVPADFIESEKPLEGND 173

Query: 180 LLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQ 239
            +   + M L P     +   I  I+ L+   ++  IL            E ++LI+   
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSHEIRRLINKFN 233

Query: 240 FPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVK-EAVESADLILSVGALLS 290
            P   TPM KG + +  P         L+    + +A+++AD++L +GA L+
Sbjct: 234 LPFLPTPMAKGIVPDSSP---------LNVSSARSQALKTADVVLVLGARLN 276

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/498 (18%), Positives = 190/498 (38%), Gaps = 85/498 (17%)

Query: 14  LKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           LKQ  V  VFG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    ++ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVG------------VPSISAQAKQLLLHHTLGNG 120
             G G + AL G+  S+     +L + G            +  +S  ++    +  +  G
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAGSSENEYYEGFQELDQLSVMSRWCKFYGRINTG 129

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180
           + +  H +       TAM               +T+ +     Y+ +P  L++    +  
Sbjct: 130 NLS--HLV------YTAM---------------KTSMLQNAVTYIDIPGGLIEEKAKSS- 165

Query: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
            + P  M +       + + +  +  +++  K  +++     + +   AE +  ++  Q 
Sbjct: 166 DELPKKMEIAHIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQL 223

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKE-AVESADLILSVGALLS--------- 290
           P   TPM KG + + H          L+    +  A++SA+++L +GA L+         
Sbjct: 224 PFLPTPMAKGIVPDTH---------ELNVNGARSLALKSAEVVLILGARLNWILHFGLEP 274

Query: 291 -----------DFNTGSFSYSYKTKNIVEFHSD---HMKIRNATFPGV-QMKFVLQKLLT 335
                      D +  +   +         HSD    ++  +   P   +   V +K+L+
Sbjct: 275 KWSDDACFIQVDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILS 334

Query: 336 TIADAAKGYKPVAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGI 395
            I    K  K   +         +P  + L+   ++ +L  F+ +   ++   G +   I
Sbjct: 335 KIHSNGKAMKEKEI---------IPEGSALRYHGVYAKLREFIDDKSTIMVLEGANTMDI 385

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIS 455
            + +FP  +Y   ++  G+               +  +P K V+   GD +   +  E+ 
Sbjct: 386 ARVSFP-TSYQKHRLDAGT-SATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELE 443

Query: 456 TMIRWGLKPYLFVLNNDG 473
           T+ R  L   + V+NN G
Sbjct: 444 TIARNKLGIVVVVMNNGG 461

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 111/509 (21%), Positives = 204/509 (40%), Gaps = 66/509 (12%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYARIK 65
           +Y  E L++  ++TVFG+ G   + L D +   +G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDF 122
               +I   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  PGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAK-- 179
           + F + +  ++ +   MIT  A     ++ CI+ T       Y+ +PA+ ++   P +  
Sbjct: 121 SPFLKFTGKLAPDNIRMITQKA-----LNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 180 -LLQTPIDMSLKPN----DAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKL 234
             +   + + L PN    D    KEV+  IL   ++    VI   A  + H+V+    +L
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVR----RL 228

Query: 235 IDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVK-EAVESADLILSVGALLSDFN 293
           I+    P   TPM KG + +  P         L+    + +A+++AD++L +GA L+   
Sbjct: 229 INKFNIPFLPTPMAKGIVPDSSP---------LNVSSARSQALKTADIVLVLGARLNWIL 279

Query: 294 TGSFSYSYKTKNI-VEFHSDHMKI-RNATFPGVQMK------FVLQKLLTTIADAAKGYK 345
               S  + +++I ++F S+   +  N   PG  +         +  L+  +      +K
Sbjct: 280 HFGASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWK 339

Query: 346 PVAVPARTPANAAVPASTPLKQE----------WMWNQLGNFLQEGDVVIAETGTSAFGI 395
              +            +  LK+E           ++  L   + +    +   G +   I
Sbjct: 340 YSGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDI 399

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIS 455
            + +FP N     + L                  +   P+  V+L  GD +   +  EI 
Sbjct: 400 ARVSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIE 457

Query: 456 TMIRWGLKPYLFVLNNDGYTIEKLIHGPK 484
           T +R  L   + V+NN G     + HG K
Sbjct: 458 TAVRCQLALVIVVMNNSG-----IYHGEK 481

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 109/506 (21%), Positives = 201/506 (39%), Gaps = 52/506 (10%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L++  ++TVFG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGN 119
             K    ++   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKP-GVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPA 178
              + F + +  ++ +   MIT  A     ++ CI+ T       Y+ +PA+ ++   P 
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQKA-----LNYCIQGTAGVS---YIDVPADFIEYEKPL 169

Query: 179 K---LLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLI 235
           +        + M L PN    +   I  ++ L+   KN  IL            E ++L+
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLV 229

Query: 236 DLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P    + V +       +A++ AD++L +GA L+     
Sbjct: 230 NTFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKIADIVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNI-VEFHSDHMKI-RNATFPGVQMK------FVLQKLLTTIADAAKGYKPV 347
             S  + +++I ++F S+   +  N   PG  +         +  L+  +      +K  
Sbjct: 282 GTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYS 341

Query: 348 AVPARTPANAAVPASTPLKQE----------WMWNQLGNFLQEGDVVIAETGTSAFGINQ 397
            V         +  +  L++E           ++  L   + +   ++   G +   I +
Sbjct: 342 GVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 TTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTM 457
            +FP  T    + L                  +   P+  V+L  GD +   +  EI T 
Sbjct: 402 ISFP--TDAPRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWGLKPYLFVLNNDG-YTIEKLIHG 482
           +R  L   + V+NN G Y  EK I G
Sbjct: 460 VRCQLALVIVVMNNSGIYHGEKDIEG 485

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 101/245 (41%), Gaps = 19/245 (7%)

Query: 14  LKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           LKQ  +  VFG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      ++ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++     +L + G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQTPIDMSLKP 191
           +     M+             ++T  +     YL +P  L++++    L   P+D+    
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHVR 179

Query: 192 NDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGS 251
           +  +S +  +     L++D +N +++    C+ +      +  ++  + P    PM KG 
Sbjct: 180 SGPDSSR--VQGAAKLLQDGRNILVVVGRGCAEY--PGVVRSFLERYRLPFLPVPMAKGI 235

Query: 252 IDEQH 256
           + + H
Sbjct: 236 VPDSH 240

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 109/266 (40%), Gaps = 33/266 (12%)

Query: 4   ITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T+ + +   L+   V+ VFG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           + G    ++   G G + +L G+  S      ++ + G              H    G F
Sbjct: 62  LTGKPGVLLVVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHG---------HDQYRGAF 112

Query: 123 TVFHRMS--ANISETTAMITDIATAPAEIDRCIRTTY-----VTQRPVYLGLPANLVDLN 175
               ++S      + +  +T+       +D  + + Y      T+   Y+ +P NL++  
Sbjct: 113 QELDQISLLKPYVKFSGKLTE-----GNVDHVLFSAYNIALQGTKGVTYVDIPGNLIETQ 167

Query: 176 V-----PAKLLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAE 230
                 P  L   P  +   P D  + K V   IL   +D K  V++           A 
Sbjct: 168 AVCAGTPGLLPPVPQPIKCSP-DPHTVKRVASLILE-NRDKKVLVVVGKGS---QGAFAA 222

Query: 231 TKKLIDLTQFPAFVTPMGKGSIDEQH 256
            ++ ID   FP   TPMGKG + ++H
Sbjct: 223 VRRFIDEFNFPFLPTPMGKGVVPDEH 248

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 108/510 (21%), Positives = 201/510 (39%), Gaps = 61/510 (11%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L++  ++TVFG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGN 119
             K    ++   G G + +L GI  S +    +L + G  S +   K   Q L   +L  
Sbjct: 63  NDKP-GVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPA 178
              + F + +  + S+   M+T  A     ++ CI+ T       Y+  PA+L++ N   
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTRKA-----LNHCIQGTMGVS---YIDFPADLIE-NEKK 168

Query: 179 KL-----LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKK 233
            L     L   + M L PN    +   I+ I+ L+   ++  IL            E ++
Sbjct: 169 SLAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQNRDKNILIVIGKGAVKNSHEIRR 228

Query: 234 LIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVK-EAVESADLILSVGALLSDF 292
           L+     P   TPM KG + +  P         L+    + +A+++AD++L +GA L+  
Sbjct: 229 LVSSFNLPFLPTPMAKGIVPDSSP---------LNVSSARSQALKTADIVLVLGARLNWI 279

Query: 293 NTGSFSYSYKTKNI-VEFHSDHMKI-RNATFPGVQMK------FVLQKLLTTIADAAKGY 344
                S  +  +++ ++F S    +  N T  G  +         +  L+  +A     +
Sbjct: 280 LQFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRPRW 339

Query: 345 KPVAVPARTPANAAVPASTPLKQEWM----------WNQLGNFLQEGDVVIAETGTSAFG 394
           K   V         V  +   ++E M          +  L   +++   ++   G +   
Sbjct: 340 KYSGVNNALREKIHVNETRLQEKEKMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANTMD 399

Query: 395 INQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEI 454
           I + +FP  T      L                  +   P+  V+L  GD +   +  EI
Sbjct: 400 IARVSFP--TDAPRHRLDAGTNATMGIGLGYALASKASRPELDVVLIQGDSAFGFSAMEI 457

Query: 455 STMIRWGLKPYLFVLNNDGYTIEKLIHGPK 484
            T +R  L   + V+NN G     + HG K
Sbjct: 458 ETAVRCQLALVIVVMNNSG-----IYHGVK 482

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 123/295 (41%), Gaps = 29/295 (9%)

Query: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+  +   ++ + L    ++TVFG+ G   + + D I     +R+ G  NE  A+YAA  
Sbjct: 1   MTTESFPAHISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASA 60

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGN 119
           Y  + G    ++   G G + AL G+  S +    +L + G                L  
Sbjct: 61  YGYLTGKPGVLLVVGGPGLIHALAGVYNSISNKWPLLVLAGS------------SEDLNR 108

Query: 120 GDFTVFHRMSANISETTAMITDIATAPAE--IDRCIRTTYVTQRPV-YLGLPANLVDLNV 176
           G F    ++ A +S      + +  +     +   +R + V    V YL +P +L++ +V
Sbjct: 109 GGFQALDQI-AVLSRYVKFSSRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSV 167

Query: 177 PAKLLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLID 236
             +      +++    + +  K+ +  +  L+ +     +L        D   E +K I+
Sbjct: 168 EKEKYNCVRNIT--KVEYQPSKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIE 225

Query: 237 LTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKE-AVESADLILSVGALLS 290
             Q P   TPM KG + + HP         L+    +  A+ SAD++L +GA L+
Sbjct: 226 RFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLALRSADIVLVLGARLN 271

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%), Gaps = 23/134 (17%)

Query: 164 YLGLPANLV------DLNVPAKLLQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVIL 217
           Y+ +P NL+      +  +  K++ +P+  S  P        V+  +  L+ + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKE-AV 276
                   +   E ++ +D  Q P   TPM KG + + HP         L+    +  A+
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLAL 256

Query: 277 ESADLILSVGALLS 290
             AD++L +GA L+
Sbjct: 257 RKADVVLLLGARLN 270

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 122/289 (42%), Gaps = 31/289 (10%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           +YL E L    +  VFG+ G   + L D +     +++ G  NE  A+YAA  Y  + G 
Sbjct: 6   EYLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGR 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK-QLLLHHTLGNGDFTVF 125
              ++   G G + AL G+  S +    ++ + G    S +   Q L    L     + +
Sbjct: 66  PGVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNRGGFQELDQIAL----LSKY 121

Query: 126 HRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAK---LLQ 182
            + S+ +S +     D +   A     + T  V+    YL +PAN++D  V        +
Sbjct: 122 VKYSSRLSNSN---VDQSFYDALRQAVLGTPGVS----YLDIPANVIDQEVEKNESFSRR 174

Query: 183 TPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
               +S +P DA  ++     +  L+   ++  IL        +   + +  +D  Q P 
Sbjct: 175 HIAKISYQPTDAALQR-----VAKLLNANRDKNILCVIGKGATENAQQIRPFVDEFQLPF 229

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKE-AVESADLILSVGALLS 290
             TPM KG + + H          L+    +  A++SAD++L +GA L+
Sbjct: 230 LSTPMAKGVVPDSH---------ALNVSSARSLALKSADIVLVLGARLN 269

>TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7.418
            YBL088C
          Length = 2786

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 71/150 (47%), Gaps = 18/150 (12%)

Query: 146  PAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKLLQTPIDMSLK-PNDAESEKEVIDTI 204
            P  ID   ++ Y+T + +    P        P+K +Q  +   ++  ND E+  E ++TI
Sbjct: 1873 PQRIDSKEKSLYLTLKKISYDAPH-------PSKTIQDSLVQVVECKNDFETPSEWVETI 1925

Query: 205  --LALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGV 262
              +AL+K+      L+D   +  ++ A  +K ID  +   +V        + Q  RY   
Sbjct: 1926 AEMALLKE------LSDCMSNPENLVATLRKTIDFDRRALYVHDFSDYKSNIQ-SRYMLS 1978

Query: 263  YVGTLSKPEVKEAVESADLILSVGALLSDF 292
             +  L++ +   ++ SADL +  GALL+++
Sbjct: 1979 KL-LLNRSDEFPSISSADLTICTGALLANY 2007

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,227,448
Number of extensions: 2378090
Number of successful extensions: 6285
Number of sequences better than 10.0: 139
Number of HSP's gapped: 6207
Number of HSP's successfully gapped: 152
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)