Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR098C (UBP11)5.712ON71771735040.0
Smik_11.3625.712ON72172626950.0
Skud_11.3385.712ON71270526640.0
Suva_11.3355.712ON72471724730.0
NDAI0F002005.712ON110545312591e-159
NCAS0G001705.712ON103043712321e-155
TDEL0B020805.712ON102544212021e-151
SAKL0E15136g5.712ON103744011591e-144
Kpol_2001.785.712ON40340310881e-142
Kwal_55.196455.712ON97043210851e-134
KLTH0E00814g5.712ON97443810821e-134
KLLA0A00396g5.712ON101246210841e-134
TPHA0D046605.712ON104544710781e-133
CAGL0H06721g5.712ON108145210801e-133
Suva_9.305.712ON106247910691e-131
Ecym_40095.712ON151743910541e-126
AFR296C5.712ON116946410341e-125
ZYRO0B16544g5.712ON104446410101e-123
KAFR0H001505.712ON6564479301e-115
KAFR0D021605.712ON8464359101e-110
CAGL0G02563gsingletonON6314438631e-105
KNAG0L022005.712ON11612737742e-88
TBLA0E017605.712ON12122687742e-88
Skud_9.125.712ON10642567571e-86
YIL156W (UBP7)5.712ON10712607544e-86
Smik_9.135.712ON10602617377e-84
Kpol_1032.288.188ON8824423484e-33
KAFR0C025908.188ON9784473414e-32
TBLA0F036108.188ON11444693343e-31
Suva_2.2288.188ON9274703291e-30
ZYRO0G06798g8.188ON8774413271e-30
KNAG0D019308.188ON9864403271e-30
Skud_4.3238.188ON9264403262e-30
CAGL0G05247g8.188ON9474673226e-30
TPHA0C027708.188ON9704463201e-29
Smik_5.3098.188ON8054263144e-29
YER144C (UBP5)8.188ON8054253145e-29
KLLA0E10275g8.188ON7964413111e-28
Ecym_61848.188ON8514253111e-28
NDAI0A036808.188ON11164313121e-28
YDR069C (DOA4)8.188ON9264403111e-28
SAKL0H18986g8.188ON8934493102e-28
Smik_4.3078.188ON9294403092e-28
NCAS0B042808.188ON9224513074e-28
Kwal_14.20088.188ON4244462984e-28
CAGL0I06765g8.188ON8874503041e-27
Skud_5.2818.188ON8234253022e-27
Suva_5.2728.188ON7884392984e-27
KLTH0H07678g8.188ON8614442871e-25
NDAI0C059008.188ON8264682861e-25
AFR007W8.188ON8484042834e-25
TDEL0B042208.188ON8252712799e-25
Kpol_304.65.712ON5621282671e-23
KNAG0G015908.188ON6714182451e-20
NCAS0A039108.188ON7954242164e-17
NCAS0I031401.137ON12012231826e-13
AFR627C1.137ON12872111647e-11
ZYRO0C17908g1.137ON12042141574e-10
Skud_10.221.137ON12552121575e-10
Kwal_33.136281.137ON11602081575e-10
NDAI0B004801.137ON12532071558e-10
KNAG0C021801.137ON12312301558e-10
CAGL0L01639g1.137ON11472281531e-09
TDEL0C056401.137ON11782091531e-09
KLTH0F03674g1.137ON11982141522e-09
Suva_6.2761.137ON12562131512e-09
KAFR0F015601.137ON11712121494e-09
YJL197W (UBP12)1.137ON12542211486e-09
Kpol_2001.541.137ON12231941461e-08
Smik_10.371.137ON12472221442e-08
TDEL0A011002.69ON6614201379e-08
KLLA0C03476g1.137ON12522101371e-07
TPHA0A025401.137ON12862101361e-07
SAKL0C04246g1.137ON12972221342e-07
NDAI0F034102.69ON8704371343e-07
Ecym_81401.137ON12642121343e-07
KNAG0F012202.69ON7844221315e-07
TBLA0J006001.137ON14622581299e-07
ABL145W2.69ON7493951281e-06
CAGL0J11352g2.69ON7714071271e-06
TBLA0D010708.742ON4834391243e-06
KLLA0C06974g8.742ON4464261216e-06
YBL067C (UBP13)7.390ON7473671219e-06
NCAS0C021108.540ON4943751209e-06
Suva_2.507.390ON7501221172e-05
Smik_2.497.390ON7451221163e-05
TBLA0H036008.540ON4823841144e-05
Skud_2.387.390ON7481221145e-05
KAFR0A042108.742ON4401291135e-05
ZYRO0C09812g2.69ON7022361145e-05
KNAG0G029308.742ON4591021135e-05
AEL029W1.369ON4461021136e-05
TPHA0O016402.69ON7464231146e-05
TPHA0G005608.742ON4634071128e-05
ZYRO0B03300g7.390ON8131291129e-05
SAKL0H04994g8.742ON4541431111e-04
TPHA0A025101.369ON5051481111e-04
KNAG0B023707.390ON753951111e-04
Ecym_62488.742ON4661431101e-04
Smik_14.1442.69ON7634271111e-04
KLLA0D08459g2.69ON7501081111e-04
NCAS0B005808.742ON4661391101e-04
NCAS0G018002.69ON8754301101e-04
KAFR0A069102.307ON6783661101e-04
SAKL0E13002g2.69ON7394131102e-04
KLTH0B07150g2.69ON7561071092e-04
CAGL0I05522g7.390ON7241251092e-04
TBLA0B097602.69ON8982441073e-04
KNAG0C035807.390ON7761351065e-04
Skud_13.3928.742ON4731401056e-04
YMR223W (UBP8)8.742ON4711381046e-04
TPHA0E008707.390ON715941057e-04
Smik_13.4318.742ON4711381047e-04
CAGL0M11198g8.742ON4611411020.001
ZYRO0A05962g8.742ON4651961020.001
Ecym_27171.369ON4831021020.001
KNAG0E012905.18ON11961061030.001
Suva_13.4955.18ON12301111030.001
NDAI0A016707.390ON8461251010.002
NCAS0E026107.390ON7171271010.002
Smik_5.2447.390ON7491211000.002
NCAS0I016203.270ON795239990.003
Kwal_26.91518.742ON454132990.003
NCAS0A143707.390ON729121990.003
CAGL0A04477g7.390ON770122990.003
Ecym_46857.390ON778122990.003
Suva_13.4078.742ON471138980.004
Suva_14.1562.69ON788107980.004
YER098W (UBP9)7.390ON754121980.005
Kpol_534.231.369ON496157970.005
Skud_14.1482.69ON776107970.005
Klac_YGOB_Anc_5.18b5.18ON1166123980.005
NCAS0D023905.18ON1211105970.006
TDEL0G004105.18ON1186110970.006
YNL186W (UBP10)2.69ON792105960.007
TPHA0J026205.443ON122533970.007
Kpol_1024.448.540ON496378960.007
Kwal_33.144302.69ON511107950.007
AEL242W8.540ON613231960.008
CAGL0K10494g1.369ON495107950.008
Ecym_11668.540ON696216960.008
KNAG0A019708.540ON471472940.012
KLTH0D12760g8.742ON453131940.012
Skud_5.2237.390ON748121940.012
TPHA0P006807.390ON727121940.013
Suva_4.2953.270ON782194940.013
Smik_13.5215.18ON1231112940.013
NDAI0H035501.369ON502106930.014
Kwal_34.162681.369ON449142930.015
KLTH0B09944g5.18ON1189112940.015
TDEL0C015707.390ON765122930.017
ZYRO0G01188g1.369ON500148920.017
Kpol_1045.417.390ON712120930.018
KNAG0C019401.369ON499112920.018
TDEL0B030608.540ON734216930.019
NDAI0E041807.390ON827120920.020
Suva_5.2177.390ON754122920.021
Ecym_56715.18ON1176107920.021
NCAS0D006001.369ON493106910.023
CAGL0M13783g5.18ON1196111920.025
TDEL0D024001.369ON494147910.026
KNAG0J008003.270ON765116910.029
Kpol_1018.937.390ON755129910.031
KNAG0A054502.307ON764275900.034
YMR304W (UBP15)5.18ON1230112900.039
ZYRO0D03982g8.540ON821216890.046
Skud_13.4785.18ON1231112900.046
TDEL0B036708.742ON463133890.047
SAKL0H00418g5.18ON1190112890.047
KAFR0L017307.390ON70132890.051
AGL357W5.18ON1166105880.070
AFR551W8.742ON469133870.071
Kwal_26.95985.18ON1191122880.073
Kpol_1064.488.742ON466408850.12
KAFR0E009308.540ON498455850.12
KAFR0I026005.18ON1213135860.12
KLTH0H13354g1.369ON495142850.14
TPHA0L022905.18ON1193107860.14
ZYRO0G01606g5.443ON1305102860.14
TBLA0C012001.369ON50332850.15
NDAI0A074103.270ON810240850.15
TBLA0C070205.18ON1247120840.20
ZYRO0F01276g3.270ON776186830.26
YDL122W (UBP1)2.307ON809133820.30
ZYRO0D07062g5.18ON1193105820.32
KLLA0E23387g8.540ON78290820.32
TDEL0D035503.270ON780231820.33
Ecym_45145.443ON1246108820.35
SAKL0F12430g7.390ON75442820.37
SAKL0H10076g8.540ON76781810.40
NDAI0C015505.443ON129593820.41
TBLA0D006207.390ON117195810.43
KLLA0E20351g7.390ON69731810.43
YFR010W (UBP6)1.369ON499106810.44
YPL072W (UBP16)8.540ON499415800.52
NDAI0E008108.742ON493140800.54
KAFR0C045201.369ON499105800.59
KAFR0K018107.390ON71427790.70
SAKL0G02728g5.443ON123739790.73
Suva_16.2408.540ON523420790.73
NDAI0I025305.18ON1197105790.76
KAFR0C004103.270ON769189790.80
KAFR0A075802.69ON802203790.81
Smik_4.1152.307ON790290780.92
AGR370W7.390ON74054781.0
CAGL0H05335g8.540ON48387771.2
TPHA0E017105.443ON128327781.2
Kpol_513.255.18ON1190233781.2
CAGL0K10252g5.443ON1267102771.3
Suva_6.831.369ON500109761.5
SAKL0D10120g1.369ON49271761.5
Kwal_27.120308.540ON74981761.5
Skud_16.2098.540ON50372761.6
KAFR0D050705.443ON122798761.6
CAGL0I06600g8.202ON816156761.7
KLTH0E12540g8.540ON75268761.7
TBLA0A064705.443ON132068761.8
Smik_7.3141.369ON499106752.1
TBLA0B019308.202ON1019141752.5
Suva_4.1252.307ON793292742.7
ZYRO0A02420g2.307ON745397743.1
Skud_6.941.369ON49929733.1
KLTH0H07370g8.202ON781140743.1
Suva_8.1765.443ON127041743.2
CAGL0I03718g7.322ON1201105733.8
SAKL0B03036g8.97ON47288734.0
NDAI0B034302.307ON856133734.1
Skud_15.2865.443ON127841734.3
NCAS0H021005.443ON1269134734.4
Smik_15.3015.443ON127241734.6
YOR124C (UBP2)5.443ON127237724.9
Skud_4.1332.307ON787183725.2
Smik_16.1638.540ON50172725.2
AER110W4.305ON1305116708.7
Suva_1.1103.175ON115947709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR098C
         (717 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...  1354   0.0  
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...  1042   0.0  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...  1030   0.0  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   957   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     489   e-159
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     479   e-155
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   467   e-151
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   451   e-144
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   423   e-142
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   422   e-134
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   421   e-134
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   422   e-134
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   419   e-133
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   420   e-133
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   416   e-131
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   410   e-126
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   402   e-125
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   393   e-123
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   362   e-115
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   355   e-110
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   337   e-105
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   302   2e-88
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   302   2e-88
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   296   1e-86
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   295   4e-86
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   288   7e-84
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   138   4e-33
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   135   4e-32
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   133   3e-31
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   131   1e-30
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   130   1e-30
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   130   1e-30
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   130   2e-30
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   128   6e-30
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   127   1e-29
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   125   4e-29
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   125   5e-29
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   124   1e-28
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   124   1e-28
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             124   1e-28
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   124   1e-28
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   124   2e-28
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   123   2e-28
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    122   4e-28
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   119   4e-28
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   121   1e-27
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   120   2e-27
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   119   4e-27
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   115   1e-25
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   114   1e-25
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   113   4e-25
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   112   9e-25
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   107   1e-23
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    99   1e-20
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     88   4e-17
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    75   6e-13
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    68   7e-11
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    65   4e-10
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    65   5e-10
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    65   5e-10
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    64   8e-10
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    64   8e-10
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    64   1e-09
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    64   1e-09
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    63   2e-09
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    63   2e-09
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    62   4e-09
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    62   6e-09
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    61   1e-08
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    60   2e-08
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    57   9e-08
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    57   1e-07
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    57   1e-07
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    56   2e-07
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    56   3e-07
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    56   3e-07
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    55   5e-07
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    54   9e-07
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    54   1e-06
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    54   1e-06
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    52   3e-06
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    51   6e-06
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    51   9e-06
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    51   9e-06
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    50   2e-05
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    49   3e-05
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    49   4e-05
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    49   5e-05
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    48   5e-05
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    49   5e-05
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    48   5e-05
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    48   6e-05
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    49   6e-05
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    48   8e-05
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    48   9e-05
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    47   1e-04
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    47   1e-04
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    47   1e-04
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    47   1e-04
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    47   1e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    47   1e-04
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       47   1e-04
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      47   1e-04
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    47   1e-04
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    47   2e-04
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    47   2e-04
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    47   2e-04
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    46   3e-04
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    45   5e-04
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    45   6e-04
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    45   6e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    45   7e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    45   7e-04
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    44   0.001
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    44   0.001
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    44   0.001
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    44   0.001
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    44   0.001
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    44   0.002
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    44   0.002
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    43   0.002
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    43   0.003
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    43   0.003
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    43   0.003
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    43   0.003
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    43   0.003
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    42   0.004
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    42   0.004
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    42   0.005
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    42   0.005
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    42   0.005
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    42   0.005
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    42   0.006
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    42   0.006
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    42   0.007
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    42   0.007
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    42   0.007
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    41   0.007
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    42   0.008
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    41   0.008
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    42   0.008
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    41   0.012
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    41   0.012
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    41   0.012
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    41   0.013
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    41   0.013
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    41   0.013
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.014
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    40   0.015
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    41   0.015
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    40   0.017
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    40   0.017
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    40   0.018
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    40   0.018
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    40   0.019
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    40   0.020
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    40   0.021
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.021
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    40   0.023
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    40   0.025
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    40   0.026
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    40   0.029
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    40   0.031
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.034
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    39   0.039
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    39   0.046
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    39   0.046
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    39   0.047
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    39   0.047
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    39   0.051
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    39   0.070
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    38   0.071
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    39   0.073
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    37   0.12 
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    37   0.12 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    38   0.12 
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    37   0.14 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    38   0.14 
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    38   0.14 
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    37   0.15 
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    37   0.15 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    37   0.20 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    37   0.26 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    36   0.30 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    36   0.32 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    36   0.32 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    36   0.33 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    36   0.35 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    36   0.37 
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    36   0.40 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    36   0.41 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    36   0.43 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    36   0.43 
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    36   0.44 
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    35   0.52 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    35   0.54 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    35   0.59 
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    35   0.70 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    35   0.73 
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    35   0.73 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    35   0.76 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    35   0.80 
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    35   0.81 
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    35   0.92 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    35   1.0  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    34   1.2  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    35   1.2  
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    35   1.2  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    34   1.3  
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    34   1.5  
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    34   1.5  
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    34   1.5  
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    34   1.6  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    34   1.6  
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    34   1.7  
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    34   1.7  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    34   1.8  
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    33   2.1  
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    33   2.5  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    33   2.7  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    33   3.1  
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    33   3.1  
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    33   3.1  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    33   3.2  
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    33   3.8  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    33   4.0  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     33   4.1  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    33   4.3  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    33   4.4  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    33   4.6  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    32   4.9  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    32   5.2  
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    32   5.2  
AER110W Chr5 (842596..846513) [3918 bp, 1305 aa] {ON} Syntenic h...    32   8.7  
Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W...    32   9.0  

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 1354 bits (3504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/717 (93%), Positives = 668/717 (93%)

Query: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60
           MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT
Sbjct: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60

Query: 61  AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY 120
           AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY
Sbjct: 61  AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY 120

Query: 121 LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI 180
           LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI
Sbjct: 121 LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI 180

Query: 181 VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE 240
           VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE
Sbjct: 181 VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE 240

Query: 241 VXXXXXXXXXXXXXXXXKVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGL 300
           V                KVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGL
Sbjct: 241 VSSQIRDSSQDSSSSLSKVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGL 300

Query: 301 QNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLN 360
           QNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLN
Sbjct: 301 QNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLN 360

Query: 361 GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY 420
           GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY
Sbjct: 361 GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY 420

Query: 421 DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSL 480
           DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSL
Sbjct: 421 DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSL 480

Query: 481 AIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKK 540
           AIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKK
Sbjct: 481 AIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKK 540

Query: 541 KSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHL 600
           KSTIFGF                      TKNAKKRNSKKLTTIKSLDFIVLPPILVIHL
Sbjct: 541 KSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHL 600

Query: 601 SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH 660
           SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH
Sbjct: 601 SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH 660

Query: 661 EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYXXXXXXXXXXXFC 717
           EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY           FC
Sbjct: 661 EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERMDEENYEEEFC 717

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 1042 bits (2695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/726 (72%), Positives = 578/726 (79%), Gaps = 40/726 (5%)

Query: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60
           MLLNPDQ++NLVR VYEVDIKQFYSQLRLKNLRGLLDHAAHLF VYLRD EINQEMEALT
Sbjct: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60

Query: 61  AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY 120
           AFIIG YYLYL+IPQSLQFQTRNNLYSSYAKLKNDYQDE +M YVLK+V++ES +IVDRY
Sbjct: 61  AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY 120

Query: 121 LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI 180
           L++SN I RTI RKRAYSLPLRPLPVHMASLSI N+ +   HE P    K  ND S +DI
Sbjct: 121 LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI 180

Query: 181 VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE 240
             E NQ   S KL A SE    TSK  LS PSY KL+TGKD LFKTLSSPATAP VHS E
Sbjct: 181 PGERNQAHFSKKLGADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAPTVHSFE 240

Query: 241 VXXXXXXXXXXXXXXXXKVEKPKEEEGKI---------------------EAIESSAPKA 279
           V                +VE   E+   I                     + + SSA   
Sbjct: 241 VSS--------------QVEDSTEDLSSISKVEKQKEEEEKEDIDKEREKKTVRSSALNK 286

Query: 280 YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK 339
             LP IEDS  LLS+LSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL T+K
Sbjct: 287 --LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK 344

Query: 340 YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399
           YP+EVQLSRSIYVLFKKMYLNGG AI PN FLKMCKKLRPDLNIPDDQQDTQEFLLI+LA
Sbjct: 345 YPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 404

Query: 400 RIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI 459
           R+HEELSN  V +YYPDLVSYDANA QVNPSKY+KWYE +V+TDGLSPID+I+RGQ+ENI
Sbjct: 405 RLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENI 464

Query: 460 LKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWD 519
           LKCQRCGNSS+SYSTFYVLSLAIPK+SLYSFTSKS+KIKLEDCINLFT DEELSGDN+WD
Sbjct: 465 LKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524

Query: 520 CPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXT-KNAKKRNS 578
           CPNC  TD K+K  E TSQKKKST F F                      T K++KK NS
Sbjct: 525 CPNCGTTDLKTKINESTSQKKKSTFFSFHSRSRSKSPHHHHHHHHHSHDNTEKHSKKWNS 584

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGT 638
           +KLTT+KS DFIVLPPILVIHLSRFYYDLT+KN+TVITYPLILN+ILKN KV+RYKLYGT
Sbjct: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGT 644

Query: 639 VNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDE 698
           VNH GNL+NGHYTS VNKEK+HEIGLNRQVW+TFDDDYI+QH  D  +FEAGKTE+SS E
Sbjct: 645 VNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD--DFEAGKTEVSSSE 702

Query: 699 VYVLFY 704
           VYVLFY
Sbjct: 703 VYVLFY 708

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/705 (72%), Positives = 570/705 (80%), Gaps = 7/705 (0%)

Query: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60
           MLLNPDQILNLVR VYEVDIKQFYSQLRLKNLRGL+DH +HLF+VYLRDLEIN+E+EALT
Sbjct: 1   MLLNPDQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALT 60

Query: 61  AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY 120
           AFIIG YYLYLIIPQSLQFQTR+NLYSSYAKLKN YQDE +M YVL++VRDEST IVD+Y
Sbjct: 61  AFIIGGYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQY 120

Query: 121 LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI 180
           L++SN I  TI RKRAYSLPLRPLPVHMASLSIHN+ D    E+PN L KP ND S +D+
Sbjct: 121 LSDSNRITVTITRKRAYSLPLRPLPVHMASLSIHNQSDDPPREMPNYLAKPINDTSGKDL 180

Query: 181 VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE 240
            RE+N+I   +K +  +E    TS+E+LS PSY KL+TGKD LFKT SSPA A   HS +
Sbjct: 181 RRENNEIRLCSKHDVSAEDIDSTSRESLSIPSYSKLNTGKDTLFKTHSSPAAASTAHSCD 240

Query: 241 VXXXXXXXXXXXXXXXXKVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGL 300
                            K ++      K EA  S   + +  P IEDS  LLS+LSITGL
Sbjct: 241 TSSQAAVSSQDSSSQSKKAKQ------KEEAASSFISETFEPPTIEDSKGLLSKLSITGL 294

Query: 301 QNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLN 360
           QNPCNTCYINSIIQCLFG+T FRDLFLTKKYRLFL T +YPKEVQLSRSIY LFKKMY N
Sbjct: 295 QNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPKEVQLSRSIYSLFKKMYAN 354

Query: 361 GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY 420
           GG AI+PN FLKMCKKLRPDLNIPDDQQDTQEFLLI+LARIHEELSNENV KYY DLVSY
Sbjct: 355 GGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIHEELSNENVTKYYCDLVSY 414

Query: 421 DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSL 480
           D NALQVNP KY+KWYE  ++ DGLSPIDHI+RGQ+ENILKCQRCGNSS+SYSTFYVLSL
Sbjct: 415 DTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMENILKCQRCGNSSFSYSTFYVLSL 474

Query: 481 AIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKK 540
           AIPK S++SFTSKS+KIKLEDCINLFT DEEL+GDNAWDCP CRI DSK K  E +SQKK
Sbjct: 475 AIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWDCPECRIDDSKLKTGENSSQKK 534

Query: 541 KSTIFGFXXXXXXXX-XXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIH 599
           +S +F F                       TKN+ K  SK+LTTIKSLDFI LPPILVIH
Sbjct: 535 RSPLFSFHSRSRSKSPHHHHHYHHHGSDNTTKNSNKWKSKRLTTIKSLDFIFLPPILVIH 594

Query: 600 LSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKS 659
           LSRFYYDLTKKN+ VITYPLILNIILKN KV+RYKLYGTVNHSGNLI GHYTSVVNKE+S
Sbjct: 595 LSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNLITGHYTSVVNKERS 654

Query: 660 HEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
           HEIGLN+QVWVTFDDD+I QH KDR+ FEAGKT+MSS EVYVLFY
Sbjct: 655 HEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLFY 699

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/717 (68%), Positives = 569/717 (79%), Gaps = 19/717 (2%)

Query: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60
           M LNP+QIL+LVR+VY+VDIK  YSQLRLK L+ LL+HAA+LF+VY+RDL+ NQ+  ALT
Sbjct: 1   MFLNPNQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALT 60

Query: 61  AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY 120
           AFI+G +YLYL+IP SLQFQTRNN+YSSYAKLKN YQDE  M YVLK+V+DEST+IVD+ 
Sbjct: 61  AFIVGGFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQC 120

Query: 121 LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI 180
           L++S  I R++KRKRAYSLPLRPLPVHMASLSIHN+ D  L E+P E++KP ND   + +
Sbjct: 121 LSDSKRISRSMKRKRAYSLPLRPLPVHMASLSIHNQLDVPLREMPIEISKPINDTLVKGL 180

Query: 181 VRESNQIASSNKLEAGSEVAYY--TSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVH- 237
            +E N++  SN+LE G++      TS E LS PSYL+L TGKD+LFKTLSSPA A     
Sbjct: 181 AKEENELKFSNELEEGTDTEGRDSTSTEPLSIPSYLRLDTGKDSLFKTLSSPAAAASTRD 240

Query: 238 SLEVXXXXXXXXXXXXXXXXKVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSI 297
           SL+V                 + K KE+E + E + +S  K + LPVIE+S++LLSELSI
Sbjct: 241 SLDVLLQFEEPSQDSSS----ILKSKEQEEE-ETVSASTSKTFKLPVIENSDNLLSELSI 295

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
           TGL+NPCNTCYINS++QCLF TTLFRDLFLTKKY+LFL   KYPK +QLS SIYVLFKKM
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEKYPKGLQLSHSIYVLFKKM 355

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDL 417
           YLNGGRAIIPN FLK+CKKLRPDLNIPDDQQDTQEFL+I+LARIHEELSN NV KYY DL
Sbjct: 356 YLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILARIHEELSNNNVTKYYSDL 415

Query: 418 VSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYV 477
           +  DA ALQVNPSKY+KW E  V++DGLSPIDHI++GQ+ENILKCQRCGNSSYSYSTFYV
Sbjct: 416 ILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQMENILKCQRCGNSSYSYSTFYV 475

Query: 478 LSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITS 537
           LSLAIPK SLYSFTSKS+KIKLEDCIN FT DEELS DNAWDCP CR  + K KK+E  S
Sbjct: 476 LSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDDNAWDCPKCRTAEYKLKKDENLS 535

Query: 538 QKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSK----------KLTTIKSL 587
           QKK+S +F                          +AKK +            KLTTIKSL
Sbjct: 536 QKKRSILFNL-HSRPRSKSPRHRHHHHHHRHKNDDAKKNDDATKNSKKWKSKKLTTIKSL 594

Query: 588 DFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLIN 647
           DFIVLPPILVIHLSRFYYDLTKKN+TVITYPLILNIILKN KV+RYKLY TVNHSGNLIN
Sbjct: 595 DFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSGNLIN 654

Query: 648 GHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
           GHYTSVVNKEKSHEIGLNRQVWVTFDDD I+QH KDR++FE G+TE+SS+EVYVLFY
Sbjct: 655 GHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  489 bits (1259), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 243/453 (53%), Positives = 324/453 (71%), Gaps = 20/453 (4%)

Query: 270  EAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTK 329
            E++  +  + +++P IE S +L   LSITGL+N  NTCYINS++QCLF T LFRDLF++ 
Sbjct: 650  ESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISS 709

Query: 330  KYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQD 389
            K++ F+N +K+P   ++S S  +LFKKMYLNGG +++P  FLK C  LRPDL IPDDQQD
Sbjct: 710  KFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQD 769

Query: 390  TQEFLLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPI 448
            TQEFL+I+L R+H+ELSN+  VV  YP+L+ YD N L+V   +Y+ W+++NVI +GLSPI
Sbjct: 770  TQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPI 829

Query: 449  DHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTG 508
            DHI+ GQ+EN L+CQRCGNSSY+YSTFYVLSLAIPK S  +F S+S+++KLE+CIN+FT 
Sbjct: 830  DHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTF-SRSKRVKLEECINMFTS 888

Query: 509  DEELSGDNAWDCPNCR-------------ITDSKSKKEEITSQKK----KSTIFGFXXXX 551
            DE LSG+NAWDCP C              +  + SKK+ ++S  +    KS  F      
Sbjct: 889  DEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS 948

Query: 552  XXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKN 611
                              +   +   SKKL TIK+L+FIVLPPILVIHLSRFYYDLTKKN
Sbjct: 949  HRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKN 1008

Query: 612  STVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVT 671
            +TVITYPLILNI+LKN +V +Y+LYG VNHSGNLI+GHYTS+VNKE +H++G  +Q W  
Sbjct: 1009 NTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYY 1068

Query: 672  FDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
            FDD+ +++ R +  + + G  ++SS +VYVLFY
Sbjct: 1069 FDDETVKEER-NHGDMDKGILQVSSRDVYVLFY 1100

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 98/158 (62%), Gaps = 7/158 (4%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEM-EALTAFII 64
           +++L  V+ +Y  DIK +Y QL+L+ L  LL+H  +L  ++    + N    + LTAFI+
Sbjct: 15  NELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDVLTAFIV 74

Query: 65  GCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAES 124
           GCYYL+LIIPQS+QFQ++N  Y  Y +LK  Y++E  M  VL +V+DE   ++D  + E+
Sbjct: 75  GCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD--MDEN 132

Query: 125 NGIC----RTIKRKRAYSLPLRPLPVHMASLSIHNKFD 158
           N       R IKR+RAYS+ +  L   + SLSI N  D
Sbjct: 133 NNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSID 170

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  479 bits (1232), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 241/437 (55%), Positives = 311/437 (71%), Gaps = 15/437 (3%)

Query: 281  NLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKY 340
            ++P IE S +L   LSITGL+N  NTCYINS++QCLF T  FRDLFLT KY  FLN +K+
Sbjct: 591  SIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKF 650

Query: 341  PKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLAR 400
            P    +S S  +LFKKMYLNGG +++P  FLK C  LRPDL IPDDQQDTQEFL+I+L R
Sbjct: 651  PNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDR 710

Query: 401  IHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI 459
            +H+ELSN+  VV  YP L+ YD N L+V   +Y+ W+E++VI +GLSPID I++GQ+EN 
Sbjct: 711  LHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQIENG 770

Query: 460  LKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWD 519
            L+CQRCG+SS++YSTFYVLSLAIPK S   F S+S+++KLEDCIN+FT DE LSG+NAWD
Sbjct: 771  LQCQRCGHSSFNYSTFYVLSLAIPKPSPTGF-SRSKRVKLEDCINMFTNDEMLSGENAWD 829

Query: 520  CPNC--------RITDSKS--KKEEITSQKKKSTIFGFXXXXXXXXX--XXXXXXXXXXX 567
            CPNC        R+   +S  KK +    + KS  FG                       
Sbjct: 830  CPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRPHRSLSPFRKSGSSSTNST 889

Query: 568  XXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKN 627
               K+ ++  +KKL TIK+L+FI+LPP+LVIHLSRF+YDLTKKN TVITYPLILNI+LKN
Sbjct: 890  SKIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVITYPLILNIVLKN 949

Query: 628  GKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNF 687
             +V +YKLYG VNH+GNLI+GHYTS+VNKE  H +  N+Q W  FDD+ ++    +  + 
Sbjct: 950  NEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVKA-EGNHGDI 1008

Query: 688  EAGKTEMSSDEVYVLFY 704
            + G +++SS +VYVLFY
Sbjct: 1009 DNGISKVSSKDVYVLFY 1025

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 113/187 (60%), Gaps = 6/187 (3%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  ++ VY+ DIK +Y QL+L+ L  LL+H  +LF ++L         +ALT+FI+G
Sbjct: 16  NELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDALTSFIVG 75

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLA-ES 124
           CYYL+LI+PQS+QFQ+RN  Y  Y+ LK  Y+++  M  VL +V+DE   I+++    E 
Sbjct: 76  CYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEKTAEREI 135

Query: 125 NGICRTIKRKRAYSLP-LRPLPVHMASLSIHNKFDGSLHEIPNE-LTKPTNDNSKEDIVR 182
           N     I R+RAYS+P    L   + SLS+    D +L   P + L   + ++S  D++ 
Sbjct: 136 NETNNRIVRQRAYSVPDSNDLTEQLHSLSVS---DRNLKSPPRKILMNNSFEHSDSDVIN 192

Query: 183 ESNQIAS 189
           E N ++S
Sbjct: 193 EENDMSS 199

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  467 bits (1202), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 234/442 (52%), Positives = 311/442 (70%), Gaps = 17/442 (3%)

Query: 275  SAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF 334
            S  + Y++P IE S++    LSITGL+N  NTCYINS++QCLF TT FRDLF++ K+  F
Sbjct: 585  SLQRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEF 644

Query: 335  LNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFL 394
             N N Y    QLS+S  +LF+KMY+NGG +++P  FLK+   LRPDL IPDDQQDTQEFL
Sbjct: 645  FNQN-YSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFL 703

Query: 395  LIVLARIHEELSNENVVK-YYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453
            ++ L R+H+ELSN+  V   YPDL+ YD + + VN  +Y+KW+E +VI +GL+PIDHI++
Sbjct: 704  MVTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQ 763

Query: 454  GQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELS 513
            GQ+ENIL+CQRCGNSS+SYSTFYVLSLAIPK S  +F S+++++KLEDCIN+FT DE LS
Sbjct: 764  GQIENILECQRCGNSSFSYSTFYVLSLAIPKPSTSTF-SRAKRVKLEDCINMFTNDEILS 822

Query: 514  GDNAWDCPNC--RITD---------SKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXX 562
            G+NAWDCP C   +TD          K KK E+  +++  +  GF               
Sbjct: 823  GENAWDCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKS--GFFRIHSKSKRSKSPFR 880

Query: 563  XXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILN 622
                       +   SK+L+T K+L+FI LPP+L+IHLSRFYYDLTKKN T++TYPL+LN
Sbjct: 881  MLGSTKFPLAMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLN 940

Query: 623  IILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRK 682
            IILKN +  RY+LY  VNH+GNLI+GHYTS+VNKE  H++   RQ W  FDD+ +++  K
Sbjct: 941  IILKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETK 1000

Query: 683  DRNNFEAGKTEMSSDEVYVLFY 704
               N + G  ++SS +VYVLFY
Sbjct: 1001 -HGNIDQGILKVSSSDVYVLFY 1021

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 134/249 (53%), Gaps = 13/249 (5%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V+ +YE DIK +++Q +L+ L  LL+H  +LF  YL+ L      +ALTAFIIG
Sbjct: 14  NELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDALTAFIIG 73

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           CYYLYLI+PQS++FQTRN  YS +  L   YQ++  M  VL +V+DE   I+DR   E  
Sbjct: 74  CYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILDRNAREFK 133

Query: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSL--HEIPNELTKPTNDNSKEDIVRE 183
                  R RAYS+P R     + +L+IHN+    L  H+  ++  +   D +      +
Sbjct: 134 EFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGREDMNNLQNDED 193

Query: 184 SNQIASSNKLEAGSEV-------AYYTSKEALSKP---SYLKLSTGKDALFKTLSSPATA 233
           S+ + ++  LE   ++           S  AL +P     L +ST + AL +  S+    
Sbjct: 194 SSPVWTAPPLEPNDQLRIALDATPLSPSIMALDQPMATKELAISTSRKALSRRASAMGPT 253

Query: 234 P-PVHSLEV 241
           P P+  L++
Sbjct: 254 PYPIEELDI 262

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  451 bits (1159), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 226/440 (51%), Positives = 304/440 (69%), Gaps = 19/440 (4%)

Query: 281  NLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKY 340
            ++P IE S+++   LSITGL+N  +TCYINS++QCLF T  FRD+FL+ KY  ++ +  Y
Sbjct: 596  SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-SKGY 654

Query: 341  PKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLAR 400
                Q+SRS ++LFKKMY+NGG +++P+ FLK C  +RPD  IP+DQQDTQEFLL +L +
Sbjct: 655  IHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQ 714

Query: 401  IHEELSN-ENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI 459
            +H+ELS+ E V   YP L+ +D + LQV+  +Y+KW+E ++  +GLSPID I++GQ+EN 
Sbjct: 715  LHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENC 774

Query: 460  LKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWD 519
            L+CQRCG+SSY+YSTFYVLSLAIP     +F  K++K+ LEDCINLFT DE LSG+NAWD
Sbjct: 775  LQCQRCGHSSYNYSTFYVLSLAIPTPGTSTF-GKTKKVLLEDCINLFTSDEVLSGENAWD 833

Query: 520  CPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTK-------- 571
            CP C  + S S   E  ++KK+  +                         +         
Sbjct: 834  CPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVNNNRTSRFFKFRSKSRSRSSSPFNSSNGH 893

Query: 572  -------NAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNII 624
                    ++K  SKKLTTIK+ +FI +PPILVIHLSRF+YDLTKKNSTVITYPLILNI+
Sbjct: 894  NSGSSMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV 953

Query: 625  LKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
            LKN +V +Y+LYG VNH GNLI+GHYTS+VNK+  HEI   +Q W  FDD+ ++Q   + 
Sbjct: 954  LKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ-DNNH 1012

Query: 685  NNFEAGKTEMSSDEVYVLFY 704
             +F+AG   +SS +VYVLFY
Sbjct: 1013 GDFDAGIASVSSSDVYVLFY 1032

 Score =  119 bits (298), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 122/207 (58%), Gaps = 15/207 (7%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V+ VY  DIK +Y +L+L+ L  LL+HA +LF  Y   L+   + +ALTAFIIG
Sbjct: 11  NELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDALTAFIIG 70

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
            +Y+YLIIPQS+QF TRN  Y  Y  L+  YQDE  M  VL +V    T  VD  L +S 
Sbjct: 71  SFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMV----TKKVDAILCKSR 126

Query: 126 GICRT-IKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDIVRES 184
               T I RKRAYS+P + L   + SL+++N  DG L ++P E++K +  ++  +   + 
Sbjct: 127 DFDDTKITRKRAYSVPSQALANQLRSLTLNNT-DG-LEQLP-EVSKES--DTLTNYADDY 181

Query: 185 NQIASSNKLEAGSEVAYYTSKEALSKP 211
             I S+ KLE   ++     K AL+ P
Sbjct: 182 TTIWSAPKLEPDDQL-----KLALNPP 203

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  423 bits (1088), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 210/403 (52%), Positives = 283/403 (70%), Gaps = 15/403 (3%)

Query: 312 IIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFL 371
           ++QCLFGT L RDLF++ KY  +L + +  +   LSRS  +LFKKMYLNGG +++P  FL
Sbjct: 1   MVQCLFGTKLLRDLFISSKYEKYL-SKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 372 KMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKY-YPDLVSYDANALQVNPS 430
           K C +LRPDL IPDDQQDTQEFL+++L R+H+ELSN+  V   YPDLV YD   L+VN  
Sbjct: 60  KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 431 KYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSF 490
           +Y KW+++ +  +GLSPIDHI++GQ+EN L CQRCG  SY+YSTFYVLSLAIPK S  +F
Sbjct: 120 EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTF 179

Query: 491 TSKSRKIKLEDCINLFTGDEELSGDNAWDCPNC---RITDSKSKKEEITS------QKKK 541
            S+S+++KLEDCIN+FT DE LSG+NAWDC NC    + + + +K++ T       + +K
Sbjct: 180 -SRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRK 238

Query: 542 STIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLS 601
           S +F                            +K   KKL TIKS++FI LPP LVIHLS
Sbjct: 239 SRLFLLPNINGRSSRSISPFRKSASPRPPH--EKLKHKKLVTIKSMNFISLPPTLVIHLS 296

Query: 602 RFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHE 661
           RFYYDL+KKN T++TYPLILNI+L N +  +Y+LYG VNH+GNLI+GHYT++VNKEK+HE
Sbjct: 297 RFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHE 356

Query: 662 IGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
           +  ++Q W  FDD+ +++   +  N + G  ++SS +VYVLFY
Sbjct: 357 LKKDKQKWYYFDDEVVKEE-NNHGNIDEGVIKVSSSQVYVLFY 398

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  422 bits (1085), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/432 (50%), Positives = 289/432 (66%), Gaps = 13/432 (3%)

Query: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYP 341
           +P IE S++    LSITGL+N  NTCYINS++QCLF T  FRDLFL+ KY  +  + +Y 
Sbjct: 540 IPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYF-SKRYS 598

Query: 342 KEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
              QLS+   +LFKKMY+NGG +++P  FLK C  LRPDL IP +QQDTQEFLL +L+++
Sbjct: 599 NPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQL 658

Query: 402 HEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460
           H+ELS  N V   YP+L+ +D  +L V+  +Y+KW+E N+  +G+SPID I++GQ+EN L
Sbjct: 659 HDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGL 718

Query: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDC 520
            CQRCG+SSY+YS FYVLSLAIP  S+ SF  K +K++LEDCINLFT DE+L+ +NAWDC
Sbjct: 719 LCQRCGHSSYNYSMFYVLSLAIPA-SMSSFGQK-KKMRLEDCINLFTSDEKLTNENAWDC 776

Query: 521 PNCRIT--------DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKN 572
           P C           D K +K   TS                                +  
Sbjct: 777 PKCGSAVSGNGPDGDKKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKPSSQSPA 836

Query: 573 AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIR 632
           ++K  SKKL+TIK+L+F+ LP +L IHLSRF YDLT KN+ VITYPL L+I+LKN +V+ 
Sbjct: 837 SEKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVN 896

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKT 692
           Y+LY   NH GNLI+GHYTS+VNK+ SH++G  RQ W  FDD+ + +   +  N +AG T
Sbjct: 897 YRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDE-VAKRDLNHGNIDAGIT 955

Query: 693 EMSSDEVYVLFY 704
            +SS +VYVLFY
Sbjct: 956 SVSSSDVYVLFY 967

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (62%), Gaps = 9/150 (6%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V++VY  DI  +Y +LRL+ L  LL+HA +LF  Y R LE  Q  E LTAF++G
Sbjct: 11  NELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELLTAFVVG 70

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVI--VDRYLAE 123
           C+Y+YLIIP S+QF +R+  Y+ YA L+  YQDE  M  VL +V   + VI  V R   E
Sbjct: 71  CFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMV---TGVIESVSRDELE 127

Query: 124 SNGICRTIKRKRAYSLPLRPLPVHMASLSI 153
           S      I RKRAYS+P + L   M +L++
Sbjct: 128 S----AKIMRKRAYSVPHKKLSDKMQALTL 153

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score =  421 bits (1082), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/438 (49%), Positives = 293/438 (66%), Gaps = 25/438 (5%)

Query: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYP 341
           +P IE S +    LSITGL+N   TCY+NS++QCLF T  FRDLFL+ KY  +  + KY 
Sbjct: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-SRKYT 598

Query: 342 KEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
              QLS+   VLFKKMY+NGG +++P  FLK C  LRPD  IP DQQDTQEFLL +L+++
Sbjct: 599 NPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQL 658

Query: 402 HEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460
           H+ELS  N V   YP L+ +D   L V+  +Y+ W+E+++  +G+SPID+I++GQ+EN L
Sbjct: 659 HDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGL 718

Query: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDC 520
            CQRCG+SS++YS FYVLSLAIP  S  S  S+ +K++LEDCINLFT DE+L+ +NAWDC
Sbjct: 719 FCQRCGHSSFNYSVFYVLSLAIP--SSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDC 776

Query: 521 PNCRITDSKSKKEEITSQKK------------KSTIFGFXXXXXXXXXXXXXXXXXXXXX 568
           P C  + S +  EE   +K+            +S  F                       
Sbjct: 777 PKCGTSASGTGPEEEKKKKRFLLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQSSQQ-- 834

Query: 569 XTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNG 628
             +N +K  SKKLTTIK+L+FI LP +L IHLSRF+YDLTKKN+ VITYPLIL+I+LKN 
Sbjct: 835 --QNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNE 892

Query: 629 KVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN--N 686
           ++++Y+LY   NH GNLI+GHYTS+VNK+  H++   +Q W  FDD+ +   +KD N  +
Sbjct: 893 QIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV---KKDINHGD 949

Query: 687 FEAGKTEMSSDEVYVLFY 704
            +AG T +SS +VYVLFY
Sbjct: 950 IDAGITSISSSDVYVLFY 967

 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (60%), Gaps = 5/150 (3%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V+ VY  DI  ++ +LRL+ L  LL+HA +LF  Y   L  NQ  + LTAF+ G
Sbjct: 11  NELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAG 70

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           C+Y+YLIIP S+QFQ+R+  Y+ YA LK  YQDE  M  VL +V    T +++    +  
Sbjct: 71  CFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMV----TEVIESMSKDEV 126

Query: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHN 155
              R I RKRAYS+P    PV + +LS  N
Sbjct: 127 ETAR-IMRKRAYSVPYGKSPVTIQALSKAN 155

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  422 bits (1084), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/462 (47%), Positives = 297/462 (64%), Gaps = 20/462 (4%)

Query: 258  KVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLF 317
            ++  P+  +  ++      P  +++P IE S +    LSITGL+N  NTCYINS++QCLF
Sbjct: 550  ELRTPQRNDWTVQTQHLHVP--FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLF 607

Query: 318  GTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKL 377
            G + FRDLFL  KY  +LN  +      +S+   +LF+KMYLNGG +++PN FLK C  L
Sbjct: 608  GCSQFRDLFLGGKYHRYLNPKR--SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHML 665

Query: 378  RPDLNIPDDQQDTQEFLLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWY 436
            RPD +IP DQQDTQEFLL +L  +H+ELS    V   YP+L+ +D   L V+  +Y+KW+
Sbjct: 666  RPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWF 725

Query: 437  ERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRK 496
            +  +  +GLSPID I++GQ+EN LKCQRCG +SY+YSTFYVLSLAIP +      S+S+K
Sbjct: 726  DEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKK 785

Query: 497  -IKLEDCINLFTGDEELSGDNAWDCPNCRI----TDSKSKKEEITSQKKKSTIFGFXXXX 551
             I+LEDCINL+T DE L+G+NAWDCP C      +D     +E   +KKK          
Sbjct: 786  IIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDH 845

Query: 552  XXXXXXXXXXXXXXXXXXTKNAKKRN---------SKKLTTIKSLDFIVLPPILVIHLSR 602
                                  K  +         SKK+TTIK+L+FI +P ILVIHLSR
Sbjct: 846  KSRSKFFKLSSSRSGKRSLSPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSR 905

Query: 603  FYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEI 662
            F+YDLTKKN T+I YPLIL+++LKN ++ RY+LYG +NH GNL++GHYTS+VNK  SHEI
Sbjct: 906  FFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEI 965

Query: 663  GLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
               +Q W  FDD+ +++   +  +F+ G T +SS +VYVLFY
Sbjct: 966  RKGQQKWYYFDDEVVKKEF-NHGDFDRGITSISSGDVYVLFY 1006

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 80/134 (59%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           D++L+ V++VY  D+K +Y++L+L+ L  LL+ A  LF  Y   L + +  + L  ++IG
Sbjct: 11  DELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCLCEYVIG 70

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
            +Y++LIIP S+QF  RN  YS Y+ LK  YQDE  M  VL +V  +   ++++ +    
Sbjct: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEILA 130

Query: 126 GICRTIKRKRAYSL 139
                  RKRA+S+
Sbjct: 131 KQHLDPSRKRAFSV 144

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  419 bits (1078), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/447 (49%), Positives = 307/447 (68%), Gaps = 24/447 (5%)

Query: 276  APKAYNLPV--IEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL 333
            A K+Y  PV  IE + +    LSITGL+N  NTCYI+S++QCLF TT  RDLF+T KY  
Sbjct: 601  ALKSYATPVPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYES 660

Query: 334  FLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEF 393
            ++N +K   ++ LSRS  +LF+KMYLNGG +++P  FLK C +LRPDL IPDDQQDTQEF
Sbjct: 661  YIN-HKVTDKINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEF 719

Query: 394  LLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIY 452
            L++VL R+H+ELS E+ V+  Y +L+ YDA  + V   +Y+KW+E + ++ G+SPID I+
Sbjct: 720  LMLVLDRLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIF 779

Query: 453  RGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEEL 512
            +GQ+EN + CQRCG SS++YS+FYVLSLAIPK+S+ SF S++ ++KLEDCIN+FT DE L
Sbjct: 780  QGQIENSINCQRCGYSSFNYSSFYVLSLAIPKISVMSF-SRTNRVKLEDCINMFTRDEVL 838

Query: 513  SGDNAWDCPNC--------RITDSKSKKEEITS------QKKKSTIFGFXXXXXXXXXXX 558
            SG+NAWDC  C        + + +   KE  +       Q +KS +F             
Sbjct: 839  SGENAWDCSRCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKSRLF---LLPKKYNPTS 895

Query: 559  XXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYP 618
                        K+++K  SKK+ TIKSL+FI +P ILVIHLSRF+YD++KKN TV+ YP
Sbjct: 896  RSLSPFGRHSSHKSSEKWKSKKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYP 955

Query: 619  LILNIILKNGKVIRYKLYGTVNHSGNLI-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            LILNI+LKN +V +Y+LY  VNH GN + +GHYT++VNK ++H++G N Q W  FDD+ +
Sbjct: 956  LILNIVLKNEEVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVV 1015

Query: 678  QQHRKDRNNFEAGKTEMSSDEVYVLFY 704
             +H  +  N + G  ++SS  VYVLFY
Sbjct: 1016 -KHELNHGNIDEGVNKVSSSHVYVLFY 1041

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/135 (43%), Positives = 82/135 (60%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V   Y  +IK  + QLRL  L  +L+H A+L   YL  L   +  E L+A+I+G
Sbjct: 13  NELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECLSAYIVG 72

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           C+YLYLIIP S QFQ RN  +  Y +LK  YQ++  M  VL +V++E   I+D  + E  
Sbjct: 73  CFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDESILELE 132

Query: 126 GICRTIKRKRAYSLP 140
           GI + IKR RAYS P
Sbjct: 133 GIEKVIKRDRAYSSP 147

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  420 bits (1080), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 293/452 (64%), Gaps = 27/452 (5%)

Query: 278  KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
            + +++P IE +++     S+TGL+N  NTCYIN ++Q LF T   ++LF++ KYR +   
Sbjct: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687

Query: 338  NKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIV 397
                KE  +S +   LF KMY+NGG  ++P+ FLK+C  LRPDL IPDDQQDTQEFLL +
Sbjct: 688  PNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFI 747

Query: 398  LARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQL 456
            L R+H+ELSN+ NV+  YP+L+ YD + + V+  KY+KW+++ V+ +GLSP+D +++GQ+
Sbjct: 748  LNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQM 807

Query: 457  ENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDN 516
            EN L+CQRCG  S +YSTFYVLSLA+PK S  +F  KS ++KLEDCIN+FT DE L+G+N
Sbjct: 808  ENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFY-KSGRVKLEDCINMFTSDEVLTGEN 866

Query: 517  AWDCPNC-------RITDSKSKKEEITS---QKKKSTIFGFXXXXXXXXXXX-------- 558
            AWDCP C       R T   S +  + +     KKS  FG                    
Sbjct: 867  AWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLL 926

Query: 559  ------XXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNS 612
                              +   K  SKKL TIK+++FI LP +L+IHLSRFYYDLTKKN 
Sbjct: 927  EKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKND 986

Query: 613  TVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTF 672
             V++YPL+LNI+LKN +++RYKLY  VNH+GNLI+GHYTS+VNK+  H +G   Q W  F
Sbjct: 987  AVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYF 1046

Query: 673  DDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
            DD+ ++   K   N + G T++SS  VYVLFY
Sbjct: 1047 DDEVVKA-EKTHGNVDKGITKVSSKNVYVLFY 1077

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 96/173 (55%), Gaps = 26/173 (15%)

Query: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66
           Q+L  ++++Y  +I+  + QL+L+ L  LL+ A  +   Y+  ++++   +A+  FI GC
Sbjct: 11  QLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTS-KAVRVFITGC 69

Query: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDR--YLAES 124
           +Y+YL++P+S+QFQTR+  YS Y +L++ Y+ +  M  V+ +V++E   I ++     ++
Sbjct: 70  FYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQCDNFQDN 129

Query: 125 NGI--------------------CRTIKRKRAYSLPLRPLPVHMASLSIHNKF 157
            G+                     R I R+ AYS+     P  M++LS+H++ 
Sbjct: 130 EGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSI---SSPSGMSTLSLHDEL 179

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  416 bits (1069), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 218/479 (45%), Positives = 304/479 (63%), Gaps = 55/479 (11%)

Query: 278  KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
            + Y++P IE S++    LSITGL+N  NTCYINS+IQCLF   +FR LF++ KY+ +L  
Sbjct: 582  RVYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQ 641

Query: 338  NKYPK--EVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLL 395
            ++  +    +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDDQQDTQEFL+
Sbjct: 642  SRGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLM 701

Query: 396  IVLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRG 454
            I+L R+H+ELSN+ +V   YP+L+ YDA+ L+V+  +Y+ W+++NVI +G+SPID I++G
Sbjct: 702  ILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQG 761

Query: 455  QLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFT---SKSRKIKLEDCINLFTGDEE 511
            Q+EN L+C+RCG ++++YSTFYVLSLAIP+ S+          +++KLEDCIN+FT DE 
Sbjct: 762  QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEV 821

Query: 512  LSGDNAWDCPNC-------------------RITDSKSKKEEI-----TSQKKKSTIFG- 546
            LSG+NAWDCP C                    I  S+ KK         S+++    FG 
Sbjct: 822  LSGENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGD 881

Query: 547  ------------FXXXXXXXXXXXXXXXXXXXXXXTKNAKKRN---------SKKLTTIK 585
                        F                      T  A   N         +KKLTT+K
Sbjct: 882  SSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVK 941

Query: 586  SLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNL 645
            +++F+ LP ILVIHLSRFYYDLTKKN+TVITYPLILNIILKN   ++Y+L+G VNH+G L
Sbjct: 942  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTL 1001

Query: 646  INGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
            I+GHYTS+VNK+  H + + R  W  FDD+ +   + D+ +      ++SS + YVLFY
Sbjct: 1002 ISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV---KADKKHGSDKSLKISSSDAYVLFY 1057

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 121/209 (57%), Gaps = 11/209 (5%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  VR +Y  DIK +Y QL+L+ L  LL+H  +LF +YL  +   +  +ALTAF+IG
Sbjct: 14  NELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDALTAFVIG 73

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           CYY++LIIPQSLQFQTRN  YS Y+ LK  Y++E  M  V+ +V+ E  V++D  +    
Sbjct: 74  CYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVV 133

Query: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNKFD-GSLHEIPNELTKPTNDNSKEDIVRES 184
           GI   I +KRA+S+P   L   +ASLS+      G LH+           +S E+   +S
Sbjct: 134 GIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKT----------SSTEEDADQS 183

Query: 185 NQIASSNKLEAGSEVAYYTSKEALSKPSY 213
           + + ++  LE   ++      E +  P++
Sbjct: 184 SPVWTAPNLEPNDQLKLALLPEVIPTPAF 212

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  410 bits (1054), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/439 (48%), Positives = 294/439 (66%), Gaps = 27/439 (6%)

Query: 280  YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK 339
            +++P IE+S +    LSITGL+N  NTCYINS++QCLF T+ FR+LFL+ KY  +L   K
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---K 1143

Query: 340  YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399
             P+   +SRS Y+LF+KMY+NGG +++P+ FLKMC  L+PDL IP  QQDTQEFLL +L 
Sbjct: 1144 SPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLD 1203

Query: 400  RIHEELSN-ENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLEN 458
            ++H+ELS+ E+V   Y  L+ +D   L V+ ++Y KW+++N+  +GLSPID +++GQ+EN
Sbjct: 1204 KLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263

Query: 459  ILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAW 518
             L CQRCG SSY+YSTFYVLSLA+P     +F  K++K++LEDCIN FT DE LS  NAW
Sbjct: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAF-GKTKKLRLEDCINFFTCDEVLSDQNAW 1322

Query: 519  DCPNC------RITDSKSKKEEITS-------QKKKSTIFGFXXXXXXXXXXXXXXXXXX 565
            DCP C         D K K++  TS          +S +F F                  
Sbjct: 1323 DCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFS---- 1378

Query: 566  XXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIIL 625
                +K + K ++ K  T+KSL+FI +P ILVIHLSRF YDLTKKN+ V++YPLILNI+L
Sbjct: 1379 ----SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVL 1434

Query: 626  KNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN 685
            KN +V +++LY  VNH G LI+GHYTS+VNKE +HEI   +Q W  FDD+ I +   +  
Sbjct: 1435 KNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDE-IVKFDTNHG 1493

Query: 686  NFEAGKTEMSSDEVYVLFY 704
            +++ G   +SS  VYVLFY
Sbjct: 1494 DYDNGIASVSSSNVYVLFY 1512

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 78/137 (56%), Gaps = 5/137 (3%)

Query: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66
           ++   V +VY  +++  Y +LRL+ L  LL+H A+L   Y   L   Q    +TA+++G 
Sbjct: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGA 71

Query: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLA---- 122
           +YLYLIIPQS++F TRN  YS Y  LK  Y+ +  M  V+ +V  +   ++  YL+    
Sbjct: 72  FYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEGD 131

Query: 123 ESNGICRTIKRKRAYSL 139
           E  G  R   RKRAYS+
Sbjct: 132 EKYG-ARFTGRKRAYSM 147

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  402 bits (1034), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/464 (47%), Positives = 299/464 (64%), Gaps = 24/464 (5%)

Query: 260  EKPKEEEGKIEAIESSAPKA-YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFG 318
            E PK  E     + + + +A +++P IE + +    LSITGL+N  NTCYINS++QCLF 
Sbjct: 707  EDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFS 766

Query: 319  TTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLR 378
            TT FR+LFL+ KY  +L ++       +SRS Y+LFKKMY+NGG +++P+ FLKMC  L+
Sbjct: 767  TTEFRNLFLSNKYSRYLKSSNMD---NMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLK 823

Query: 379  PDLNIPDDQQDTQEFLLIVLARIHEELSN-ENVVKYYPDLVSYDANALQVNPSKYEKWYE 437
            PDL IP  QQDTQEFLL +L R+ +ELS    VV  YP L+ ++++ L+VN  +Y  W++
Sbjct: 824  PDLRIPHGQQDTQEFLLFLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFD 883

Query: 438  RNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKI 497
            +N   +GLSPID I++GQ+E+ L CQRC  SSYSYSTFYVLSLA+P     +F  K++K+
Sbjct: 884  QNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAF-GKAKKL 942

Query: 498  KLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXX 557
            +LEDCIN FT DE L+G N WDCP C +  S  ++      K+K+  F            
Sbjct: 943  RLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSN 1002

Query: 558  XXXXXX-----------------XXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHL 600
                                          K  +KR +KKL TIKSL+FI LP IL+IHL
Sbjct: 1003 RDHLPRLFKIGSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHL 1062

Query: 601  SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH 660
            SRF YDLTKKN+TV+TYPLILNI+LKN +V +Y+LY T+NH G LI+GHYTS+VNK+  H
Sbjct: 1063 SRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQH 1122

Query: 661  EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
            EI   +Q W  FDD+ ++    +  N++ G T +SS +VY+LFY
Sbjct: 1123 EIREGKQKWYYFDDEIVKLD-PNHGNYDRGITSVSSSDVYLLFY 1165

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 13/192 (6%)

Query: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66
           ++   V++ YE  +++ Y +LR + L  LL+ AA+LF  Y   +   Q  E L A++IG 
Sbjct: 12  ELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIGA 71

Query: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESNG 126
           +YLYLIIPQS++F TRN  YS Y  L+  Y+ E  M  V+++V ++   ++ R   E   
Sbjct: 72  FYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDGE 131

Query: 127 ICRT-IKRKRAYSLPLRPLPVHMAS---LSIHNKFDGSLHEIPNELTKPTNDNSKEDIVR 182
              T + RKRAYS+P + +     S   L++  K  G  H I   +          ++  
Sbjct: 132 RGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP---------EVAV 182

Query: 183 ESNQIASSNKLE 194
           +++ + S+ KLE
Sbjct: 183 QADTLWSAPKLE 194

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
            {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156W UBP7 Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1044

 Score =  393 bits (1010), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 290/464 (62%), Gaps = 39/464 (8%)

Query: 278  KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
            + +++P IE SN+    LSITGL+N   TCYINS++QCLF T +FRDLF    Y  F N 
Sbjct: 579  RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP 638

Query: 338  NKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIV 397
             +     +LS+S  VL +KMY+NGG +++P  FLK+C  LRPD NIPDDQQD QEFL++ 
Sbjct: 639  -ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLT 697

Query: 398  LARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQL 456
            + R+H+ELSN+  V+  +P+L+ YDA   +V   +Y++W+E ++I    SPID I++GQL
Sbjct: 698  IDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQL 757

Query: 457  ENILKCQRCGNSSYSYSTFYVLSLAIPK-LSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515
            EN L C++CG SSYSYSTFY+LSLAIPK  S +  +SK   + LEDCIN+FT DE +S +
Sbjct: 758  ENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRE 817

Query: 516  NAWDCPNCRIT----------------------------DSKSKKEEITSQKKKSTIFGF 547
            NAWDCP C +T                             +K K EE +S K K+    F
Sbjct: 818  NAWDCPKCGVTVQKEKSESNQRHNKQSSSSGSTASPEPRKAKKKDEEGSSLKSKTKFLLF 877

Query: 548  XXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLT-------TIKSLDFIVLPPILVIHL 600
                                  + +    NS   +       +I++ +F+ LPP+LVIHL
Sbjct: 878  PRKRKSSSSKSLSPFNLLNSSSSSSNTNNNSSSNSGSKKNSFSIRATNFVTLPPVLVIHL 937

Query: 601  SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH 660
            SRFYYDLTKKN TVITYPLILNI+LKN + ++Y+LY  VNH+GNLI+GHYTS+VNK + H
Sbjct: 938  SRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDH 997

Query: 661  EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
            ++  NRQ W  FDD+ + +H     N   G  ++SS +VYVLFY
Sbjct: 998  DLENNRQQWYYFDDEVV-KHETSHGNLSQGVNKVSSKDVYVLFY 1040

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 4/147 (2%)

Query: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66
           ++L LV  +YE DIK  Y+ L+L++L  L+DH  +L+  +  +++   + +ALTA+IIGC
Sbjct: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYIIGC 74

Query: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESNG 126
           Y+LYLIIPQS QFQ RN  +  +  LK  Y+++  M  VL +V+DE   ++DR   +   
Sbjct: 75  YFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDFRK--- 131

Query: 127 ICRTIKRKRAYSLPLRPLPVHMASLSI 153
             + ++RKRA+S P   L   ++ L++
Sbjct: 132 -LKDVERKRAFSSPDNGLDSEISRLTL 157

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  362 bits (930), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/447 (46%), Positives = 279/447 (62%), Gaps = 32/447 (7%)

Query: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK-YRLFLN 336
           K + +P+I+ ++++   LS+ GL+N  NTCYINS++QCLFGT + RDLF+++  Y+ F+ 
Sbjct: 218 KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI- 276

Query: 337 TNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLI 396
             K   E ++S     L   MY NGG ++IP  FL+    LRPDLNIP DQQDTQEFL+I
Sbjct: 277 --KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVI 334

Query: 397 VLARIHEELSNENVVKYYPDLVSYDANALQVNPSK-YEKWYERNVITDGLSPIDHIYRGQ 455
           +L  +H+EL       Y  DL+S +  +  +N  K Y  W + N+  +G SPID I++GQ
Sbjct: 335 LLDILHDELV------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQ 388

Query: 456 LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515
           +EN L+CQRCGN+SY+YS FY+LSLAIPK++     SK+R +KLEDCIN FT DE L+G+
Sbjct: 389 IENCLQCQRCGNTSYNYSMFYMLSLAIPKIA--KENSKNR-VKLEDCINFFTSDEILTGE 445

Query: 516 NAWDCPNCRIT--------DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXX 567
           NAW+CP C  T        DS +  E     K  + +  F                    
Sbjct: 446 NAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNHHRHHHHH 505

Query: 568 XXTKN----AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI 623
              K+      K  ++KL T+K L+FI LPPILVIHLSRFYY+ TKKN+ VITYPLILNI
Sbjct: 506 HHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI 565

Query: 624 ILKNG-KVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRK 682
           I+KN   V++YKLYG +NH G L  GHYTS+VNK+ +H + LN Q W  FDD+ I++   
Sbjct: 566 IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625

Query: 683 D-----RNNFEAGKTEMSSDEVYVLFY 704
           +     + +F   K E  S +VYVLFY
Sbjct: 626 NNTINKKESFNIEKDEFDSSKVYVLFY 652

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 89/136 (65%), Gaps = 4/136 (2%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVY-LRDLEINQEMEALTAFII 64
           D + +LV  +++ DIK +Y++LRL+ L  LLDH  +L +++ +     +++ +A  AF+ 
Sbjct: 28  DDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVN 87

Query: 65  GCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAES 124
           G +YL+LIIP  +QFQT+N L++ Y  LK DY+ +  M  +L  V+++S  I+++ L+  
Sbjct: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLS-- 145

Query: 125 NGICRTIKRKRAYSLP 140
            GI R I +KRAY+ P
Sbjct: 146 -GINRRILKKRAYTEP 160

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  355 bits (910), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/435 (46%), Positives = 275/435 (63%), Gaps = 31/435 (7%)

Query: 280 YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK 339
           Y LP +  S++L  +LSI+GL+N  NTCYINS++QCLF TT FR+LFL+ +Y+ ++ T  
Sbjct: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487

Query: 340 YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399
            P    LS S ++LF+KMYLNGG A+IP  FLK C  LRPDL IPD QQDTQEFL+++L 
Sbjct: 488 DP---HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLD 544

Query: 400 RIHEEL-SNEN-VVKYYPDLVSYDANALQV-NPSKYEKWYERNVITDGLSPIDHIYRGQL 456
           ++H EL SN++ +V  +PDL+ YD +++ V N ++Y+KW+  ++  +GLS I  I++GQL
Sbjct: 545 QLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQL 604

Query: 457 ENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIK----LEDCINLFTGDEEL 512
           EN L+CQRC  +S +YS F  LSL+IP        +K RK +    LEDCI+LF  +E L
Sbjct: 605 ENSLECQRCNYTSTNYSNFCTLSLSIP--------NKRRKFRKLVDLEDCISLFIENEML 656

Query: 513 SGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKN 572
           +G+NAW+CP C      S      + K+KS  F F                      + +
Sbjct: 657 TGENAWNCPKC------SSSSNNNTSKRKSRGF-FKFSKHKNRSHNDLTFSEYNHNSSSD 709

Query: 573 AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD-LTKKNSTVITYPLILNIILKNGKVI 631
             K + KKL T KS  FI LP +L+IHLSRF    L  KN+T I YP IL I LKN +  
Sbjct: 710 DVKFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKC 769

Query: 632 RYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
           R+KLYG VNH GNL NGHYTS++NKE SH++   RQ W  FDD+ ++Q     N F+  K
Sbjct: 770 RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQ---FNYFDLDK 826

Query: 692 --TEMSSDEVYVLFY 704
               +SS +VYVLFY
Sbjct: 827 NVNRISSSDVYVLFY 841

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60
           ++ N D++  LV  +Y   IK  Y QL       LL++   LF  +L+        ++L 
Sbjct: 9   LVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLD 63

Query: 61  AFIIGCYYLYLIIPQS-LQFQTRNNLY-SSYAKLKNDYQDEHVMGYVLKVVRDESTVIVD 118
           +FIIG +Y+ L+IP S    ++ NN Y + Y  LK  Y+ +  +  +L ++R ES  I+ 
Sbjct: 64  SFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123

Query: 119 RY 120
            +
Sbjct: 124 SF 125

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  337 bits (863), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/443 (42%), Positives = 269/443 (60%), Gaps = 23/443 (5%)

Query: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF-LN 336
           K Y LP+I ++     +LS+ G++N  NTCY+NS++QCLFG+T FRDLFLT K+ +F   
Sbjct: 193 KQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAE 252

Query: 337 TNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLI 396
           TN   + + ++  + +LFKKMY NGG AIIP  F++ CK+LRPD  IP  QQDTQEFL+ 
Sbjct: 253 TN--SESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMF 310

Query: 397 VLARIHEELSNENVVKYYPDLVSYDANALQVNPSK-YEKWYERNVITDGLSPIDHIYRGQ 455
           VL R+  EL+N +       L++  +N   +  +K Y +WY   +  + LSPID ++RG 
Sbjct: 311 VLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGD 370

Query: 456 LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515
           +E+ L C+ C  S+ ++S+FY+LSL IPK    S   KS+ I+LEDCINLFT  E L+G+
Sbjct: 371 VESKLICKHCNESASTFSSFYILSLNIPK-EKSSLFFKSKTIRLEDCINLFTRKEILTGE 429

Query: 516 NAWDCPNCR-------ITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXX 568
           N+W CP+C        I + K+ +++ T+  K S    F                     
Sbjct: 430 NSWACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQL 489

Query: 569 XTKN----AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNII 624
              N     + R  KK  TI S+ F+ LPPILVIHLSRF YD++KKN++ I+YP+ L + 
Sbjct: 490 KYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVE 549

Query: 625 LKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
             +   + Y+LYGT+NH G+   GHYT++VNKEK+H   L  Q WV FDDD +     +R
Sbjct: 550 TLDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLV----FNR 605

Query: 685 NNFEAGKTEMSS---DEVYVLFY 704
            +F   KTE++S   ++ YVLFY
Sbjct: 606 TDFFKSKTEINSITNNDAYVLFY 628

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 12/120 (10%)

Query: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60
           ++ N + + +LV +V+E  IK+ Y  L L  +  LL  AA     YL   E   + + L 
Sbjct: 6   VICNTEILKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAK----YLDKTETLGQEKLLE 61

Query: 61  A----FIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDY----QDEHVMGYVLKVVRDE 112
           +    +  GC+Y+YL++P + QFQ  +  Y +Y +LKN+Y    + +    Y+L  VR++
Sbjct: 62  SSYMNYAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLTFQYLLDRVREK 121

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  302 bits (774), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 147/273 (53%), Positives = 201/273 (73%), Gaps = 10/273 (3%)

Query: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
           + Y++P IE + ++   LSITGL+N  NTCYINS+IQCLF T  FR+LF++ KY+ FL  
Sbjct: 671 ETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK- 729

Query: 338 NKYPK------EVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQ 391
              PK      +  +SR+ Y+LFKKMYLNGG +++P  FLK C  LRPD  IPDDQQDT 
Sbjct: 730 EVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTT 789

Query: 392 EFLLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDH 450
           EFL+++L R+H+ELSN++ VV  YPDL+ YD   L V   +Y+KW++++VI +GLSPID 
Sbjct: 790 EFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDD 849

Query: 451 IYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510
           I++GQ+EN L CQRCG+SS++YSTFYVLSLAIPK +  +F S+S+++ LE+C+N++T DE
Sbjct: 850 IFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTF-SRSKRVSLEECLNMYTSDE 908

Query: 511 ELSGDNAWDCPN-CRITDSKSKKEEITSQKKKS 542
            LSG+NAWDCPN C+IT       E T + K +
Sbjct: 909 VLSGENAWDCPNCCKITKDYKGMVEKTKRNKAA 941

 Score =  157 bits (398), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 102/131 (77%), Gaps = 1/131 (0%)

Query: 574  KKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRY 633
            K+  SKKL TIK+L+FI +P  L+IHLSRFYYDLTKKNST++TYPLILNI+LK+ +V++Y
Sbjct: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088

Query: 634  KLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTE 693
            KLYG VNH+GNLI+GHYTS+V+K+  H +  N   W  FDD+ +++  +   + + G  +
Sbjct: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR-HGDVKHGVMK 1147

Query: 694  MSSDEVYVLFY 704
            +SS +VYVLFY
Sbjct: 1148 ISSSDVYVLFY 1158

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           D++   V KVY  DI     QLRL+ L  LL+H   L+ +YL  L  +Q M+AL +FI G
Sbjct: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFING 79

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           C+Y+YL++PQS+QF TRN  ++ Y+ ++  Y+ +  M  VL +V++E  V+++    +S 
Sbjct: 80  CFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQW-DSA 138

Query: 126 GICRTIKRKRAYSLP 140
            +   I R RAYS+P
Sbjct: 139 SLNERIPRNRAYSVP 153

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  302 bits (774), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 198/268 (73%), Gaps = 5/268 (1%)

Query: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
           + +++P++E S +    LSITGL+N  NTCYINS++QCLF TT FR++FL+ KY  +++ 
Sbjct: 733 RHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMD- 791

Query: 338 NKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIV 397
           +  P   +LS+S  +LFKKMY+NGG +++P  FLK C  LRPDL IPDDQQDTQEFL+++
Sbjct: 792 HDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLI 851

Query: 398 LARIHEELSNENVVKY-YPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQL 456
           L R+H+ELSN++ VK  YPDLV YD + ++V P +Y KWY  +V ++GLSPIDH+++GQ 
Sbjct: 852 LDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQT 911

Query: 457 ENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDN 516
           E+ L CQRCG SS++YSTFY+LSLAIPK S  +F  K +++ LEDCI +FT DE LS +N
Sbjct: 912 EDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAF-GKIKRVNLEDCIKMFTNDEILSDEN 970

Query: 517 AWDCPNCRITDSKSKKEEITSQKKKSTI 544
           AWDCP C    +  K+E I   ++K  I
Sbjct: 971 AWDCPRC--GSAAPKQEPIHRHREKKHI 996

 Score =  164 bits (416), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (77%), Gaps = 1/127 (0%)

Query: 578  SKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYG 637
            S K+ TIKS++F+  P ILVIHLSRFYYDLTKKN+TVITYPL LNI LKNG+V RYKLYG
Sbjct: 1083 SGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYKLYG 1142

Query: 638  TVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSD 697
             VNH+G L++GHYTS+VNK+  HE+G  +Q W  FDD+ +++  K+  + E G T +SS 
Sbjct: 1143 LVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKE-EKNHGDIEGGVTSISSS 1201

Query: 698  EVYVLFY 704
             VYVLFY
Sbjct: 1202 HVYVLFY 1208

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 100/164 (60%), Gaps = 8/164 (4%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           D++L  V+++Y  + K  Y QL+L+ L  LLDH++ LF  Y + L  +   +AL+AFI+G
Sbjct: 16  DELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDALSAFIVG 75

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVD-RYLAE- 123
            +Y+Y IIPQS QF T+N  Y  Y +LKN Y+DE  M  VL +V+ E T I+D  Y ++ 
Sbjct: 76  SFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDSNYKSQN 135

Query: 124 --SNGI---CRTIKRKRAYSLPLRPLPVH-MASLSIHNKFDGSL 161
             SN +    + I+R+RA+S+P    P   M   S+ ++ D S+
Sbjct: 136 ESSNNLFVDSKFIRRERAFSVPNASNPFSLMNDTSLDSQLDNSM 179

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  296 bits (757), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 196/256 (76%), Gaps = 7/256 (2%)

Query: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
           +AYN+P IE S+++   LSITGL+N  NTCYINS+IQCLF   +FR LF++  Y+ +L  
Sbjct: 581 RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640

Query: 338 NKYPKEV---QLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFL 394
            K  +     +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDDQQDTQEFL
Sbjct: 641 PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700

Query: 395 LIVLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453
           +I+L R+H+ELSN+ +V   YP+L+ Y+A+AL+V+ ++Y+ W+++NVI +G+SPID I++
Sbjct: 701 MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760

Query: 454 GQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFT---SKSRKIKLEDCINLFTGDE 510
           GQ+EN L+C+RCG ++++YSTFYVLSLAIP+ S+       S  +++KLEDCIN+FT DE
Sbjct: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820

Query: 511 ELSGDNAWDCPNCRIT 526
            LSG+NAWDCP C  T
Sbjct: 821 VLSGENAWDCPRCGPT 836

 Score =  157 bits (396), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 75/130 (57%), Positives = 101/130 (77%), Gaps = 9/130 (6%)

Query: 578  SKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYG 637
            +KKLTT+K+++F+ LP ILVIHLSRFYYDLTKKNSTVITYPLILNIILKN + ++Y+L+G
Sbjct: 935  NKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFG 994

Query: 638  TVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ---QHRKDRNNFEAGKTEM 694
             VNH+G L++GHYTS+VNK+  H + + R  W  FDD+ ++   +H  D+N       ++
Sbjct: 995  VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN------LKI 1048

Query: 695  SSDEVYVLFY 704
            SS +VYVLFY
Sbjct: 1049 SSSDVYVLFY 1058

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 106/172 (61%), Gaps = 6/172 (3%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V+ +Y  DIK +Y QL+L+ L  LL+H  +L+ +YL  +  N+  +ALTAFIIG
Sbjct: 14  NELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDALTAFIIG 73

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           CYY++LIIPQSLQFQTRN  YS Y  LK  Y++E  M  V+ +V+ E  V++D  +  + 
Sbjct: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHAV 133

Query: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNK------FDGSLHEIPNELTKP 171
           GI   I +KRA+S+P   L   +ASLS+ N       F  S  E   E + P
Sbjct: 134 GIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDAEQSSP 185

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  295 bits (754), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 197/260 (75%), Gaps = 7/260 (2%)

Query: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN- 336
           +AYN+P IE S ++   LSITGL+N  NTCYINS+IQCLF    FR LF++ KY+ +L  
Sbjct: 589 RAYNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQP 648

Query: 337 --TNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFL 394
             +N      +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDDQQDTQEFL
Sbjct: 649 IRSNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 708

Query: 395 LIVLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453
           +I+L R+H+ELS++ +V   YP+L+ Y+A+AL+V+ ++Y+ W+++NVI +G+SPID I++
Sbjct: 709 MILLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 768

Query: 454 GQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFT---SKSRKIKLEDCINLFTGDE 510
           GQ+EN L+C+RCG ++++YSTFYVLSLAIP+ S+       S  +++KLEDCIN+FT DE
Sbjct: 769 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDE 828

Query: 511 ELSGDNAWDCPNCRITDSKS 530
            LSG+NAWDCP C  T S S
Sbjct: 829 VLSGENAWDCPRCGPTASVS 848

 Score =  158 bits (400), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 101/135 (74%), Gaps = 3/135 (2%)

Query: 570  TKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGK 629
            + N+    +KKLTT+K+++F+ LP ILVIHLSRFYYDLTKKN+TV+TYPLILNIILKN  
Sbjct: 935  SNNSSDYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNND 994

Query: 630  VIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEA 689
             ++YKL+G VNH+G LI+GHYTS+VNK+  H + + R  W  FDD+ +   + DR +   
Sbjct: 995  TMKYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVV---KADRKHGSD 1051

Query: 690  GKTEMSSDEVYVLFY 704
               ++SS +VYVLFY
Sbjct: 1052 KNLKISSSDVYVLFY 1066

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 118/208 (56%), Gaps = 9/208 (4%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           +++L  V+ +Y  DIK +Y QL+L+ L  LL+H  +LF +YL  +  ++  +ALTAFIIG
Sbjct: 23  NELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDALTAFIIG 82

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           CYY++LIIPQSLQFQTRN  YS Y  LK  Y++E  M  V+ +V+ E  V++D  +    
Sbjct: 83  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHGA 142

Query: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDIVRESN 185
           GI   I +KRA+S+P   L   +ASLS+        H +    T        ED   +S+
Sbjct: 143 GIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQD-HGLKGTFT--------EDDAEQSS 193

Query: 186 QIASSNKLEAGSEVAYYTSKEALSKPSY 213
            + ++  LE   ++      E +  P++
Sbjct: 194 PVWTAPNLEPNDQLKLALLPEVIPTPAF 221

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  288 bits (737), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 195/261 (74%), Gaps = 7/261 (2%)

Query: 270 EAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTK 329
           + ++   PK Y++P IE + ++   LSITGL+N  NTCYINS+IQCLF    FR LF++ 
Sbjct: 570 QLLQPLPPKDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISS 629

Query: 330 KYRLFLN---TNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDD 386
            Y+ +L    +N+     +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDD
Sbjct: 630 NYKNYLEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD 689

Query: 387 QQDTQEFLLIVLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGL 445
           QQDTQEFL+I+L R+H+ELSN+ +V   YP+L+ Y+A+ L+V+ ++Y+ W+++NVI +G+
Sbjct: 690 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI 749

Query: 446 SPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFT---SKSRKIKLEDC 502
           SPID I++GQ+EN L+C+RCG ++++YSTFYVLSLAIP  S+       S  +++KLEDC
Sbjct: 750 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDC 809

Query: 503 INLFTGDEELSGDNAWDCPNC 523
           IN+FT DE LSG+NAWDCP C
Sbjct: 810 INMFTSDEVLSGENAWDCPRC 830

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 102/138 (73%), Gaps = 9/138 (6%)

Query: 570  TKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGK 629
            + N     +KK+TT+K+++F+ LP ILVIHLSRFYYDLTKKN+TVITYPLILNIILKN  
Sbjct: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNND 983

Query: 630  VIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI---QQHRKDRNN 686
             ++Y+L+G VNH+G LI+GHYTS+VNK+  H + + R  W  FDD+ +   ++H  D+N 
Sbjct: 984  TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN- 1042

Query: 687  FEAGKTEMSSDEVYVLFY 704
                  ++SS +VYVLFY
Sbjct: 1043 -----LKISSSDVYVLFY 1055

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 115/194 (59%), Gaps = 9/194 (4%)

Query: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65
           D++L  V+ +Y  DIK +Y QL+L+ L  LL+H  +LF +YL  +   +  +ALTAF+IG
Sbjct: 14  DELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDALTAFVIG 73

Query: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125
           CYY++LIIPQSLQFQTRN  YS Y  LK  Y++E  M  V+ +V+ E  V++D  +    
Sbjct: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHVV 133

Query: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDIVRESN 185
           GI   I +KRA+S+P   L   +ASLS+ +      H I   LT        ED + +S+
Sbjct: 134 GIEHRINKKRAFSVPANDLSGQVASLSL-DTAGPQQHNIKVPLT--------EDDMDQSS 184

Query: 186 QIASSNKLEAGSEV 199
            + ++  LE   ++
Sbjct: 185 PVWTAPNLEPNDQL 198

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  138 bits (348), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 187/442 (42%), Gaps = 121/442 (27%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL+N  N+CY+N IIQCL  T     +FL   Y   +N N K   +  L++    L   M
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHTM 579

Query: 358 YLNGG--------RAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNEN 409
           Y  G         + I P +F   C  +   L   + QQD+QEF   +L  +HE+L   N
Sbjct: 580 YREGSFKRPLEKNKPIQPIQFKMACGSIN-SLFKDNTQQDSQEFCQFLLDGLHEDL---N 635

Query: 410 VVKYYPDL--VSYDANA----LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQ 463
                P L  +S DA      L +  +   +W ER + TD  S I  +++GQ  + LKC+
Sbjct: 636 QCGANPPLKELSEDAEKMREKLSMRIASSIEW-ERFLTTD-FSVIVDLFQGQYASQLKCK 693

Query: 464 RCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNC 523
            CG +S +Y TF VLS+ +P +S            + DC N FT  E+L  D  W CP C
Sbjct: 694 VCGCTSTTYQTFSVLSVPVPHVS---------SCHILDCFNEFTKVEKLGTDELWSCPTC 744

Query: 524 RITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTT 583
           +                                                 K+ ++KKLT 
Sbjct: 745 K------------------------------------------------KKQPSTKKLTI 756

Query: 584 IKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI-------------------I 624
            +      LP  L+IHL RF  ++  KN+  + YP +L++                   +
Sbjct: 757 TR------LPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGVTDEL 809

Query: 625 LKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRK 682
              G+V   RYKL    +H G+L  GHYT+ VNK      G+NR  W  FDD     +R 
Sbjct: 810 PTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNK------GINRG-WHYFDDT---SYRP 859

Query: 683 DRNNFEAGKTEMSSDEVYVLFY 704
            +N     +TE  +   YVLFY
Sbjct: 860 IKN-----ETECITPNAYVLFY 876

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 132/447 (29%), Positives = 191/447 (42%), Gaps = 118/447 (26%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFK 355
           I GL+N  N+CY+N IIQC+ GT     +FL   Y   +N +++   +  L+++   L  
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 356 KMYLNGGRAII------------PNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHE 403
            MY++   + I            P +F   C  +   L     QQD+QEF   +L  +HE
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSIN-SLFRDSQQQDSQEFCQFLLDGLHE 722

Query: 404 ELSNENVVKYYPDL--VSYDANALQVNPS---KYEKWYERNVITDGLSPIDHIYRGQLEN 458
           +L   N     P L  +S +A  L+ N S        +ER + TD  S I  +++GQ  +
Sbjct: 723 DL---NQCGGNPPLKELSLEAERLRENLSLRIASSIEWERYLTTD-FSVIVDLFQGQYAS 778

Query: 459 ILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAW 518
            L+C+ C ++S +Y +F VLS+ +PK     F  ++RKI L DC N FT  E L  D  W
Sbjct: 779 RLECKVCHHTSTTYQSFSVLSVPLPK----KFDPQTRKIDLIDCFNEFTKIENLEVDEQW 834

Query: 519 DCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNS 578
            CP C+             +K+ ST                                   
Sbjct: 835 SCPTCK-------------KKQPST----------------------------------- 846

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNII----------LKNG 628
           KKLT  +      LP  L+IHL RF  ++  KN++ I YP  L++           L  G
Sbjct: 847 KKLTITR------LPRNLIIHLKRF-DNMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPG 899

Query: 629 -----------KVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
                      K   Y+LYG   H G+L  GHYT+ V+K     IG     W  FDD   
Sbjct: 900 VSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDK----GIG---NGWYYFDDTTY 952

Query: 678 QQHRKDRNNFEAGKTEMSSDEVYVLFY 704
           +  + D+        E  S   YVLFY
Sbjct: 953 RPLKNDK--------EPISSSAYVLFY 971

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 134/469 (28%), Positives = 187/469 (39%), Gaps = 127/469 (27%)

Query: 277  PKAYNLPVIEDSNDLLSELSI---TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL 333
            P    + + + SN    +L +    GL+N  N+CY+N IIQCL        +FL   Y  
Sbjct: 711  PNNTTMTISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEK 770

Query: 334  FLNTN-KYPKEVQLSRSIYVLFKKMYLNGGRAI-----------IPNRFLKMCKKLRPDL 381
             +N N K   +  L++S   L   MY NG  +I            P  F   C  +   L
Sbjct: 771  HININSKLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSIN-SL 829

Query: 382  NIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANA------LQVNPSKYEKW 435
                +QQD QEF   +L  +HE+L   N     P L      A      L +  +   +W
Sbjct: 830  FKGSNQQDCQEFCQFLLDGLHEDL---NQCGANPPLKELSTEAERMREKLSLRIASSIEW 886

Query: 436  YERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSR 495
             ER + TD  S I  +Y+GQ  + LKCQ CG +S +Y TF VLS+ +P         K++
Sbjct: 887  -ERFLTTD-FSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVP---------KNK 935

Query: 496  KIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXX 555
             I L DC N FT  E L  D  W C  C+                               
Sbjct: 936  SIHLLDCFNEFTKTEFLGKDELWSCTECK------------------------------- 964

Query: 556  XXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVI 615
                              KK+ S K  TI       LP  L+IHL RF  ++  KN+  +
Sbjct: 965  ------------------KKQPSTKTLTITR-----LPKNLIIHLKRF-DNMLHKNNVFV 1000

Query: 616  TYPLILNI-------------------ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVV 654
             YPLIL++                   +   G++   +Y+L G   H G+L  GHYT+ V
Sbjct: 1001 KYPLILDLTNYWANDFDGKLPPGVTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYV 1060

Query: 655  NKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLF 703
            NK      GL +  W  FDD   +  +          +EM +   YVLF
Sbjct: 1061 NK------GL-KNGWYYFDDTVYRSIKYS--------SEMITQNAYVLF 1094

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 130/470 (27%), Positives = 198/470 (42%), Gaps = 128/470 (27%)

Query: 269 IEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT 328
           I+A ++S+ + Y+L                GL+N  N+CY+N IIQC+ GT     +FL 
Sbjct: 546 IDASQTSSSRNYDLDFA------------VGLENLGNSCYMNCIIQCILGTHELTQIFLD 593

Query: 329 KKYRLFLNTN-----KYPKEVQLSRSIYVLFKKMYLNGGR-AIIPNRFLKMCKKLRPDLN 382
             Y   +N N     K       +R +++++KK   +  + +I P +F   C  +   L 
Sbjct: 594 DSYAKHININSKLGSKGILAKYFARLVHMMYKKQVDSSKKDSISPIKFKLACGSVN-SLF 652

Query: 383 IPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANA------LQVNPSKYEKWY 436
               QQD QEF   +L  +HE+L   N     P L      A      L +  +   +W 
Sbjct: 653 KTASQQDCQEFCQFLLDGLHEDL---NQCGSNPPLKELSQEAETRRERLSLRIASSIEW- 708

Query: 437 ERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRK 496
           ER + TD  S I  +++GQ  + LKC+ C ++S +Y  F VLS+ IPK       +   K
Sbjct: 709 ERFLTTD-FSVIVDLFQGQYASRLKCKTCNHTSTTYQPFTVLSIPIPK------KNSQNK 761

Query: 497 IKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXX 556
           I +EDC   FT  E L  D  W CP+C                                 
Sbjct: 762 ITIEDCFKEFTKCENLEIDEQWLCPHCE-------------------------------- 789

Query: 557 XXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT 616
                            ++ ++K+LT  +      LP  L+IHL RF  +L  KN+  + 
Sbjct: 790 ----------------KRQPSTKQLTITR------LPRNLIIHLKRF-DNLLNKNNDFVK 826

Query: 617 YPLILNI--------------------ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVV 654
           YP +L++                    +   G++   +Y+LYG   H G L  GHYTS V
Sbjct: 827 YPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYV 886

Query: 655 NKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
            K      GL+R  W+ FDD    ++R  +N     +T+  +   YVLFY
Sbjct: 887 KK------GLSRG-WLYFDD---TKYRPAKN-----QTDAINSNAYVLFY 921

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 122/441 (27%), Positives = 181/441 (41%), Gaps = 120/441 (27%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL+N  N+CYIN IIQCL GT    ++FL   Y   +N N K   +  L++    L  +M
Sbjct: 516 GLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQM 575

Query: 358 YLNGG-------RAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           + +         +A+ P  F   C  +   L     QQD+QEF   +L  +HE+L   N 
Sbjct: 576 HQSAAFKKSDKNKAVRPYEFKMACGSIN-SLFRESGQQDSQEFCQFLLDGLHEDL---NQ 631

Query: 411 VKYYPDLVSYDANA------LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQR 464
               P L      A      L +  +   +W ER +  D  S I  +++GQ  + L+C+ 
Sbjct: 632 CGGNPPLKELSEEAEKMRERLSMRIASSIEW-ERYLTRD-FSVIVDLFQGQYASQLRCKV 689

Query: 465 CGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           C ++S +Y  F +L+  +P          ++   L DC   FT  E+L  D  W CP C+
Sbjct: 690 CNHTSTTYQPFSILAAPVPH---------AKSCYLLDCFKEFTKLEQLEKDEEWLCPYCK 740

Query: 525 ITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTI 584
                                                            K+ ++KKLT  
Sbjct: 741 ------------------------------------------------KKQPSTKKLTIT 752

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI-------------------IL 625
           +      LP  L+IHL RF  +L  KN+ ++ YP  L++                   + 
Sbjct: 753 R------LPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDELP 805

Query: 626 KNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKD 683
             G+V   +YKLY   +HSG+L  GHYT+ V+K      GLN+  W  FDD   +  R  
Sbjct: 806 SRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDK------GLNKG-WYYFDDTGYRPMRT- 857

Query: 684 RNNFEAGKTEMSSDEVYVLFY 704
                   TE  +   YVLFY
Sbjct: 858 -------PTECITSNAYVLFY 871

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 123/440 (27%), Positives = 181/440 (41%), Gaps = 112/440 (25%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFK 355
           + GL+N  N+CY+N IIQCL G      +FL   +  ++N N K   +  L+R    L  
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 356 KMYLN------GGR--AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSN 407
            MY N      GG+   + P +F   C  +         QQD QEF   +L  +HE+L+ 
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDLNQ 737

Query: 408 ENVVKYYPDLVSYDAN---ALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQR 464
               K   +L     N    L +  +   +W ER + TD  S I  +++GQ  + L+C+ 
Sbjct: 738 CGGNKRLAELTEEAENLREKLSLRIASSIEW-ERFLTTD-FSVIGDLFQGQYASRLQCKT 795

Query: 465 CGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           CG +S +Y  F VLS+ +P   +        K  + DC + FT  E L  D  W CP C+
Sbjct: 796 CGKTSTTYQPFSVLSIPVPSKHI-------SKCSIIDCFDEFTKVENLEVDEQWSCPRCK 848

Query: 525 ITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTI 584
                                                           +K+ ++KKLT  
Sbjct: 849 ------------------------------------------------SKQPSTKKLTIT 860

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILK-----NGKV--------- 630
           +      LP  L+IHL RF   L K N+ ++ YP  L++        +GK+         
Sbjct: 861 R------LPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLPLNVSELPT 913

Query: 631 ------IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
                   YKLYG   H G+L  GHYT+ V+K      G+ +  W  FDD      R  +
Sbjct: 914 RGQKPPFNYKLYGVACHFGSLYGGHYTAYVDK------GI-KNGWYYFDDTSC---RPIK 963

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
           N+ E       +   YVLFY
Sbjct: 964 NSMEP-----ITSSAYVLFY 978

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 123/440 (27%), Positives = 190/440 (43%), Gaps = 116/440 (26%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-----KYPKEVQLSRSIYVL 353
           GL+N  N+CY+N IIQC+ GT     +FL   Y   +N N     K       +R ++++
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 354 FKKMYLNGGR-AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVK 412
           +K+      + +I P +F   C  +   L     QQD QEF   +L  +HE+L   N   
Sbjct: 623 YKEQVDASKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDL---NQCG 678

Query: 413 YYPDL--VSYDANA----LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCG 466
             P L  +S +A A    L +  +   +W ER + TD  S I  +++GQ  + LKC+ CG
Sbjct: 679 SNPPLKELSQEAEARREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLKCKICG 736

Query: 467 NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRIT 526
           ++S +Y  F VLS+ IP+           +I +EDC   FT  E L  D  W CP+C+  
Sbjct: 737 HTSTTYQPFTVLSIPIPR------KVPQNEITIEDCFKEFTKCENLEVDEQWLCPHCK-- 788

Query: 527 DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKS 586
                                                          ++ ++K+LT  + 
Sbjct: 789 ----------------------------------------------KRQPSTKQLTVTR- 801

Query: 587 LDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI--------------------ILK 626
                LP  L+IHL RF  +L  KN+  + YP +L++                    +  
Sbjct: 802 -----LPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPV 855

Query: 627 NGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
            G++   +Y+LYG   H G L  GHYT+ V K      GL R+ W+ FDD   +  +   
Sbjct: 856 RGQIPPFKYELYGVACHFGTLYGGHYTAYVKK------GL-RKGWLYFDDTKFKPVK--- 905

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
                 KT++++   YVLFY
Sbjct: 906 -----NKTDVTNSNAYVLFY 920

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  128 bits (322), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 127/467 (27%), Positives = 191/467 (40%), Gaps = 112/467 (23%)

Query: 270 EAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTK 329
           E + S   + +N  V+ ++          GL+N  N+CY+N I+QC+ GT     +FL  
Sbjct: 555 EVLSSPTGRKFNHSVLPNTKKDYDLNFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNN 614

Query: 330 KYRLFLNTN-----KYPKEVQLSRSIYVLFKKMYLNGGRAII--PNRFLKMCKKLRPDLN 382
            Y   +N N     K       +R  +++ +  Y    +A I  P +F +M       + 
Sbjct: 615 SYEKHININSKLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQF-RMAIASINSMF 673

Query: 383 IPDDQQDTQEFLLIVLARIHEEL---SNENVVKYYPDLVSYDANALQVNPSKYEKWYERN 439
              +QQD QEF   +L  +HE+L    N   +K   +        L +  +   +W ER 
Sbjct: 674 RNTNQQDCQEFCQFLLDGLHEDLNQCGNNPPLKELSEEAEKKRELLSLRIASSIEW-ER- 731

Query: 440 VITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKL 499
            +T   S I  +++GQ  + LKC  C N+S +Y  F VLS+ +P       T     + L
Sbjct: 732 FLTTNFSVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLP-------TGTKSSVNL 784

Query: 500 EDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXX 559
            DC N FT  E+L  D  W+CP C+             +K+ ST                
Sbjct: 785 MDCFNEFTKCEKLEHDEYWNCPTCK-------------KKQPST---------------- 815

Query: 560 XXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPL 619
                              K+LT  +      LP  L+IHL RF   +  KN+ +I YP 
Sbjct: 816 -------------------KQLTITR------LPRNLIIHLKRFDNRMN-KNTKLIDYPF 849

Query: 620 ILNI--------------------ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKE 657
            L++                    +   G++   +Y LY   NH G+L  GHYTS VNK 
Sbjct: 850 NLDLTSFWANDKDDRLPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNK- 908

Query: 658 KSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
                GL+R  W  FDD   Q +R          +E+ +   YVLFY
Sbjct: 909 -----GLSRG-WYYFDD---QNYR-----LVKKTSEVVNSNAYVLFY 941

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 126/446 (28%), Positives = 182/446 (40%), Gaps = 130/446 (29%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFKKM 357
           GL+N  N+CY+N IIQCL  +  F  +FL   Y   +N  +K   +  L+R+   L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 358 YLNGGR--------AIIPNRFLKMCKKL----RPDLNIPDDQQDTQEFLLIVLARIHEEL 405
           Y  G           + P +F   C  +    R DL     QQD+QEF   +L  +HE+L
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDL-----QQDSQEFCQFLLDGLHEDL 723

Query: 406 SNENVVKYYPDLVSYDANA------LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI 459
              N     P L     NA      L +  +   +W ER + TD    +D  ++GQ  + 
Sbjct: 724 ---NQCGANPPLKELSPNAEKMREKLSLRIASSIEW-ERYLTTDFSVIVDQ-FQGQYASQ 778

Query: 460 LKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWD 519
           L+C+ CG +S +Y  F VLS+ +P         + +   + DC N FT  E L  D  W 
Sbjct: 779 LRCKVCGGTSTTYQAFSVLSVPVP---------RGKSCNIIDCFNEFTKVENLETDELWA 829

Query: 520 CPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSK 579
           CP+C+             +K+ ST                                   K
Sbjct: 830 CPHCK-------------KKQPST-----------------------------------K 841

Query: 580 KLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI---------------- 623
           KLT  +      LP  L+IHL RF  ++  KN+  + YP +L++                
Sbjct: 842 KLTITR------LPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGV 894

Query: 624 ---ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ 678
              +   G++    YKL     H G+L  GHYTS V+K K    G     W  FDD  I 
Sbjct: 895 TEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKGK---FG-----WRYFDDTKI- 945

Query: 679 QHRKDRNNFEAGKTEMSSDEVYVLFY 704
             R  +N++E       +   YVLFY
Sbjct: 946 --RPLKNSYEC-----ITSNAYVLFY 964

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  125 bits (314), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 121/426 (28%), Positives = 188/426 (44%), Gaps = 87/426 (20%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN--TNKYPKEVQLSRSIYVLF 354
           I GL+N  N CY+N I+QCL GT     +FL   Y  F+N  ++K  K + L+++   L 
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGL-LAKNFATLV 503

Query: 355 KKMYLNGGRAIIPNR--------FLKMCKKLRPDLNIPDD--QQDTQEFLLIVLARIHEE 404
           + M+ N     + +R        F K+C  +    +I  D  QQD QEF   +L  +HE+
Sbjct: 504 RNMHRNSAFMPVNSRTTPVQTIQFKKICGHIN---SIYSDSMQQDCQEFCQFLLDGLHED 560

Query: 405 LSNENVVKYYPDLVSYDAN---ALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILK 461
           L+     ++   L   +      + +  +   +W ER ++TD  S I  +++GQ  + L+
Sbjct: 561 LNQNGGKEHLKQLTEEEEQKREKMTIRKASALEW-ERFLLTD-FSAIIDLFQGQYASRLQ 618

Query: 462 CQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCP 521
           CQ C  +S +Y TF VLS+ +P+++            + DC   FT  E+L  D  W CP
Sbjct: 619 CQACDRTSTTYQTFSVLSVPVPRIT---------TCNILDCFREFTKCEKLGIDELWSCP 669

Query: 522 NCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKL 581
            C      +K+ +IT   KK  I                           N K+ +++  
Sbjct: 670 RCLKKQPSTKQLKITRLPKKLII---------------------------NLKRFDNQ-- 700

Query: 582 TTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILN-IILKNGKV--IRYKLYGT 638
              K+  F+  P         ++ DLT   +    +  I+N  I   G++   RY+LYG 
Sbjct: 701 -MNKNNVFVQYP---------YFLDLTPYWARDFNHEAIVNEDIPTRGQIPPFRYRLYGV 750

Query: 639 VNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDE 698
             HSG+L  GHYTS V K         ++ W  FDD     +R  R N      E  +  
Sbjct: 751 ACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSI---YRPIRFN-----DEFITPN 795

Query: 699 VYVLFY 704
            YVLFY
Sbjct: 796 AYVLFY 801

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  125 bits (314), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 120/425 (28%), Positives = 185/425 (43%), Gaps = 85/425 (20%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN--TNKYPKEVQLSRSIYVLF 354
           I GL+N  N CY+N I+QCL GT     +FL   Y  F+N  +++  K + L+++  +L 
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGL-LAKNFAILV 503

Query: 355 KKMYLNGGRAIIPN---------RFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL 405
             M+ +G     PN         +F K+C  + P +     QQD QEF   +L  +HE+L
Sbjct: 504 NNMHRHGA-FTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHEDL 561

Query: 406 SNENVVKYYPDLVSYDANA---LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKC 462
           +     K+   L   +      + +  +   +W ER ++TD  S I  +++GQ  + L+C
Sbjct: 562 NQNGSKKHLKQLSDEEERMREKMSIRKASALEW-ERFLLTD-FSAIIDLFQGQYASRLQC 619

Query: 463 QRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPN 522
           Q C ++S +Y TF VLS+ +P++         +   + DC   FT  E L  D  W CP 
Sbjct: 620 QVCEHTSTTYQTFSVLSVPVPRV---------KTCNILDCFREFTKCERLGVDEQWSCPK 670

Query: 523 CRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLT 582
           C      +K+ +IT   KK  I                           N K+ +++   
Sbjct: 671 CLKKQPSTKQLKITRLPKKLII---------------------------NLKRFDNQ--- 700

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILN-IILKNGKV--IRYKLYGTV 639
             K+  F+  P         +  DLT   +    +  I+N  I   G+V   RY+LYG  
Sbjct: 701 MNKNNVFVQYP---------YSLDLTPYWARDFNHEAIVNEDIPTRGQVPPFRYRLYGVA 751

Query: 640 NHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEV 699
            HSG+L  GHYTS V K         ++ W  FDD   +             TE  +   
Sbjct: 752 CHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSLYRP--------ITFSTEFITPSA 796

Query: 700 YVLFY 704
           YVLFY
Sbjct: 797 YVLFY 801

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  124 bits (311), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 118/441 (26%), Positives = 174/441 (39%), Gaps = 117/441 (26%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL N  N+CY+N IIQCL G      +FLT  YR  +N N +   +  L+     L +KM
Sbjct: 433 GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKM 492

Query: 358 YLNG-----------GRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELS 406
           Y  G             A+ P +F   C  +   L     QQD QEF   +L  +HE+L+
Sbjct: 493 YQQGKLQAYNNTNMESTAVHPTQFKLACGSIN-SLFKGKQQQDCQEFCQFLLDGLHEDLN 551

Query: 407 NENVVKYYPDLVSYDANALQVNPSKYEKW--YERNVITDGLSPIDHIYRGQLENILKCQR 464
                    +L        +  P +      +ER + TD  S I  +++GQ  + L+C+ 
Sbjct: 552 QCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTD-FSVIVDLFQGQYASQLRCKI 610

Query: 465 CGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           C ++S +Y  F VLS+ +P         ++R   + DC   FT  E L  D  W CP C+
Sbjct: 611 CAHTSTTYQAFSVLSVPVP---------RARSCTIYDCFKEFTKLETLEKDELWYCPYCK 661

Query: 525 ITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTI 584
                        Q++ ST                                         
Sbjct: 662 -------------QRQPST----------------------------------------- 667

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIIL-----KNGKV--------- 630
           K +    LP  L+IHL RF  ++  KN+  + YP  L++        NG++         
Sbjct: 668 KQIIITRLPNNLIIHLKRF-DNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSLP 726

Query: 631 -------IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKD 683
                    Y+L+   +HSG L  GHYTS V+K         R  W +FDD   ++ R+ 
Sbjct: 727 LRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWRKIRR- 777

Query: 684 RNNFEAGKTEMSSDEVYVLFY 704
                  K E  +   YVLFY
Sbjct: 778 -------KDEYITPNAYVLFY 791

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  124 bits (311), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 116/425 (27%), Positives = 177/425 (41%), Gaps = 85/425 (20%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL N  N+CY++ IIQCL GT     +FL   Y+  +N N +   +  L+R    L  +M
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQM 546

Query: 358 YLNG----------GRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL-- 405
           Y  G            A++P +F   C  +   L     QQD QEF   +L  +HE+L  
Sbjct: 547 YQQGKDIRKTSGTEKTAVLPAQFKIACGSINA-LFRDRSQQDCQEFCQFLLDGLHEDLNQ 605

Query: 406 -SNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQR 464
             N   +K   +        + +  +   +W ER + TD  S I  +++GQ  + L+C+ 
Sbjct: 606 CGNNPPLKELSEKAEKMREMMPMRIASSIEW-ERYLTTD-FSVIVDLFQGQYASQLRCKV 663

Query: 465 CGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           CG +S +Y  F VLS+ +P          SR+  + DC   FT  E L  D  W CP+C+
Sbjct: 664 CGRTSTTYQPFSVLSVPVP---------SSRQCTIIDCFTEFTKVETLDLDEQWSCPDCK 714

Query: 525 ITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTI 584
                +KK  IT   +   I                                + K+   +
Sbjct: 715 KRQPSTKKITITRLPRNLII--------------------------------HLKRFDNM 742

Query: 585 KSLDFIVLPPILVIHLSRFY---YDLTKKNSTVITYPLILNIILKNGKV--IRYKLYGTV 639
            + + + +    V++L+ F+   YD    N+  +  P         G+V    Y+LYG  
Sbjct: 743 LNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELP-------SRGQVPPFNYQLYGVA 795

Query: 640 NHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEV 699
            H+G L  GHYT+ VNK  +  +G     W  +DD   +Q R           E  S   
Sbjct: 796 CHTGTLYGGHYTAYVNKGAT--LG-----WCYYDDTNWRQIR--------SSNEYISQNA 840

Query: 700 YVLFY 704
           YVLFY
Sbjct: 841 YVLFY 845

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 121/431 (28%), Positives = 182/431 (42%), Gaps = 89/431 (20%)

Query: 297  ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-----KYPKEVQLSRSIY 351
            I GLQN  N+CY+N IIQCL GT     +FL   +  ++N N     K      LS+ I+
Sbjct: 746  IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 352  VLFKKMYL----------NGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
            +++    L          +G   I P +F   C  +  +L     QQD QEF   +L  +
Sbjct: 806  LMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSIN-NLFKNCSQQDCQEFCQFLLDAL 864

Query: 402  HEELSNENVVKYYPDLVSYDANA------LQVNPSKYEKWYERNVITDGLSPIDHIYRGQ 455
            HE+L   N     P L      A      L +  +   +W ER + TD  S I  +++GQ
Sbjct: 865  HEDL---NQCGSNPPLKELSTKAESMREKLSLRIASSIEW-ERYLTTD-FSVIVDLFQGQ 919

Query: 456  LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515
              + L+C+ C ++S +Y  F VLS+ IP         K + + L DC   FT  E L  D
Sbjct: 920  YASRLQCKTCIHTSTTYQPFSVLSVPIP---------KKKNLNLLDCFKDFTKIENLEVD 970

Query: 516  NAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKK 575
              W CPNC+     +KK  IT   +   I                           + K+
Sbjct: 971  EQWFCPNCKSKQPSTKKLTITRLPRNLII---------------------------HLKR 1003

Query: 576  RNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKV--IRY 633
             ++        +D+       ++ L++F+ D           P + + + K G++   +Y
Sbjct: 1004 FDNNLNKNNNLIDY-----PFILDLTQFWADDFDGELP----PGVTDELPKRGQIPPFKY 1054

Query: 634  KLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTE 693
            +LYG   H G+L  GHYT+ VNK      G+ R  W  FDD   +  + +R        E
Sbjct: 1055 RLYGAALHFGSLYGGHYTAFVNK------GI-RNGWYYFDDTNYRPIKNER--------E 1099

Query: 694  MSSDEVYVLFY 704
              S   YVLFY
Sbjct: 1100 PISSNAYVLFY 1110

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  124 bits (311), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 124/440 (28%), Positives = 189/440 (42%), Gaps = 116/440 (26%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL+N  N+CY+N IIQC+ GT     +FL   Y   +N N K   +  L++    L   M
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 358 Y---LNGGR--AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVK 412
           Y   ++G +  +I P +F   C  +   L     QQD QEF   +L  +HE+L   N   
Sbjct: 623 YKEQVDGSKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDL---NQCG 678

Query: 413 YYPDL--VSYDANA----LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCG 466
             P L  +S +A A    L +  +   +W ER + TD  S I  +++GQ  + LKC+ C 
Sbjct: 679 SNPPLKELSQEAEARREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLKCKVCS 736

Query: 467 NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRIT 526
           ++S +Y  F VLS+ IPK       +    I +EDC   FT  E L  D  W CP+C   
Sbjct: 737 HTSTTYQPFTVLSIPIPK------KNSRNNITIEDCFREFTKCENLEVDEQWLCPHCE-- 788

Query: 527 DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKS 586
                                                          ++ ++K+LT  + 
Sbjct: 789 ----------------------------------------------KRQPSTKQLTITR- 801

Query: 587 LDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI--------------------ILK 626
                LP  L++HL RF  +L  KN+  + YP +L++                    +  
Sbjct: 802 -----LPRNLIVHLKRF-DNLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDDELPI 855

Query: 627 NGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
            G++   +Y+LYG   H G L  GHYT+ V K      GL ++ W+ FDD    +++  +
Sbjct: 856 RGQIPPFKYELYGVACHFGTLYGGHYTAYVKK------GL-KKGWLYFDD---TKYKPVK 905

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
           N     K +  +   YVLFY
Sbjct: 906 N-----KADAINSNAYVLFY 920

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 121/449 (26%), Positives = 176/449 (39%), Gaps = 128/449 (28%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL N  N+CY+N IIQCL GT     +FL   Y+  +N N K   +  L++    L   M
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHNM 583

Query: 358 YLNGG----------------RAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
           Y                     A+ P  F   C  +   L     QQD QEF   +L  +
Sbjct: 584 YRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTIN-SLFRDCSQQDCQEFCQFLLDGL 642

Query: 402 HEELSNENVVKYYPDLVSYDANA------LQVNPSKYEKWYERNVITDGLSPIDHIYRGQ 455
           HE+L   N     P L      A      L +  +   +W ER + TD  S I  +++GQ
Sbjct: 643 HEDL---NQCGGNPRLKELSEEAEKIREKLSMRIASSIEW-ERYLTTD-FSVIVDLFQGQ 697

Query: 456 LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515
             + LKCQ CG +S +Y  F VLS+ +P L         +   + DC   FT  E L  D
Sbjct: 698 YASQLKCQVCGRTSTTYQPFSVLSVPLPSL---------KSCNILDCFQEFTKVETLEKD 748

Query: 516 NAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKK 575
             W CP+C+                                                 ++
Sbjct: 749 EQWSCPDCK------------------------------------------------KRQ 760

Query: 576 RNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI------------ 623
            ++KK+T  +      LP  L+IHL RF  ++  KN+  ++YP  L++            
Sbjct: 761 PSTKKITITR------LPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRL 813

Query: 624 ------ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDD 675
                 +   G+V    YKLY   +H+G L  GHYT+ V+K        +++ W  FDD 
Sbjct: 814 PPGVTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKG-------SQRGWCYFDDT 866

Query: 676 YIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
             ++ R D         E  +   YVLFY
Sbjct: 867 NWRRSRSD--------NECITSNAYVLFY 887

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 122/440 (27%), Positives = 192/440 (43%), Gaps = 116/440 (26%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-----KYPKEVQLSRSIYVL 353
           GL+N  N+CY+N IIQC+ GT     +FL   Y   +N N     K       +R ++++
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 625

Query: 354 FKKMYLNGGR-AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVK 412
           +K+   +  + +I P +F   C  +   L     QQD QEF   +L  +HE+L   N   
Sbjct: 626 YKEQVDSSKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDL---NQCG 681

Query: 413 YYPDL--VSYDANA----LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCG 466
             P L  +S +A A    L +  +   +W ER + TD  S I  +++GQ  + L+C+ C 
Sbjct: 682 SNPPLKELSQEAEARREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLRCKVCN 739

Query: 467 NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRIT 526
           ++S +Y  F VLS+ IPK       +   KI +EDC   FT  E L  +  W CP+C+  
Sbjct: 740 HTSTTYQPFTVLSIPIPK------KNSQNKITIEDCFKEFTKCENLEVEEQWLCPHCK-- 791

Query: 527 DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKS 586
                      Q++ ST                                   K+LT  + 
Sbjct: 792 -----------QRQPST-----------------------------------KQLTVTR- 804

Query: 587 LDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI--------------------ILK 626
                LP  L++HL RF  +   KN+  + YP +L++                    +  
Sbjct: 805 -----LPRNLIVHLKRF-DNFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDDELPI 858

Query: 627 NGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
            G++   +Y+LYG   H G L  GHYT+ V K      GL ++ W+ FDD    +++  +
Sbjct: 859 RGQIPPFKYELYGVACHFGTLYGGHYTAYVKK------GL-KKGWLYFDD---TKYKPVK 908

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
           N     +T+  +   YVLFY
Sbjct: 909 N-----QTDAINSNAYVLFY 923

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 132/451 (29%), Positives = 189/451 (41%), Gaps = 116/451 (25%)

Query: 288 SNDLLSELS-ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQ 345
           +ND + +L  I GLQN  N+CY+N IIQCL GT     +FL   Y   +N N K   +  
Sbjct: 548 TNDKMLDLDFIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGV 607

Query: 346 LSRSIYVLFKKMYLNGGRAIIPNRFL-----KMCKKLRPDLNIPDDQQDTQEFLLIVLAR 400
           L++    L   M+ N     + N ++     KM       L     QQD QEF   +L  
Sbjct: 608 LAKYFARLIHLMH-NHANPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDG 666

Query: 401 IHEELSNENVVKYYPDLVSYDANA------LQVNPSKYEKWYERNVITDGLSPIDHIYRG 454
           +HE+L   N     P L    + A      L +  +   +W ER + TD  S I  +++G
Sbjct: 667 LHEDL---NQCGSNPPLKELSSAAEKNREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQG 721

Query: 455 QLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSG 514
           Q  + L+C+ C ++S +Y  F VLS+ IP++       K  K+ + DC   FT  E L  
Sbjct: 722 QYASRLQCEVCKHTSTTYQPFSVLSVPIPRV------PKGVKVNILDCFKDFTKLELLDT 775

Query: 515 DNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAK 574
           D  W CP C+             +K++ST                               
Sbjct: 776 DEQWLCPTCK-------------KKQRST------------------------------- 791

Query: 575 KRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI----------- 623
               KKLT  +      LP  L+IHL RF      KN+  I YP IL++           
Sbjct: 792 ----KKLTITR------LPRNLIIHLKRFDN-NLNKNNNFIDYPFILDLTQFWVDDFDGK 840

Query: 624 --------ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFD 673
                   + K G++   +YKLYG  +H G+L  GHYT+ V+K   H        W  FD
Sbjct: 841 LPPGVRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFD 893

Query: 674 DDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
           D     +R  +N     K E  +   Y+LFY
Sbjct: 894 D---TNYRSIKN-----KNEPITSSAYLLFY 916

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  119 bits (298), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 121/446 (27%), Positives = 177/446 (39%), Gaps = 125/446 (28%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-----KYPKEVQLSRSIYVL 353
           GL N  N+CY+N IIQCL GT     +FL   Y+  +N N     K       S+ I+ +
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNM 116

Query: 354 FKKMYLNGGR---------AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEE 404
            ++     GR         A+ P  F   C  +   L     QQD QEF   +L  +HE+
Sbjct: 117 QQQAISASGRKSTSGNERNAVQPLHFKVACGSIN-SLFKTTSQQDCQEFCQFLLDGLHED 175

Query: 405 LSNENVVKYYPDL--VSYDANALQ----VNPSKYEKWYERNVITDGLSPIDHIYRGQLEN 458
           L   N     P L  +S +A A++    +  +   +W ER + TD  S I  +++GQ  +
Sbjct: 176 L---NQCGGNPALKELSEEAEAIREKLCMRIASSIEW-ERYLTTD-FSVIVDLFQGQYAS 230

Query: 459 ILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAW 518
            L C+ CG +S +Y  F VLS+ +P+           +  L DC   FT  E L  D  W
Sbjct: 231 QLMCKVCGRTSTTYQPFSVLSVPVPR---------GARCNLLDCFEEFTKIETLEKDEQW 281

Query: 519 DCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNS 578
            CP C++                                                K+ ++
Sbjct: 282 SCPRCKV------------------------------------------------KQPST 293

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNII----------LKNG 628
           KK+T  +      LP  L+IHL RF  +L  KN+  ++YP  L++           L  G
Sbjct: 294 KKITITR------LPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKG 346

Query: 629 KV----------IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ 678
                         Y LY    H G L  GHYT+ VNKE       ++  W  FDD   +
Sbjct: 347 VAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWR 399

Query: 679 QHRKDRNNFEAGKTEMSSDEVYVLFY 704
           + + +         E  +   YVLFY
Sbjct: 400 KAKSE--------DECITTSAYVLFY 417

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/450 (28%), Positives = 180/450 (40%), Gaps = 117/450 (26%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLS 347
           N ++      GL+N  N+CYIN IIQC+F TT    +FL   Y   +N  +K   +  LS
Sbjct: 516 NQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGVLS 575

Query: 348 RSIYVLFKKMYLNGGR--------AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399
            +   L K MY             A+   +F   C  +   L     QQD  EF   +L 
Sbjct: 576 HNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVN-SLFKDASQQDCLEFCQFLLD 634

Query: 400 RIHEEL----SNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQ 455
            +HE+L    +N  + +  P+      N L +  +   +W ER + TD  S I  +++GQ
Sbjct: 635 GLHEDLNQCGANPPLKELSPEAEKMREN-LSLRVASSIEW-ERYLTTD-FSIIVDLFQGQ 691

Query: 456 LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515
             + L+C+ C  +S +Y  F VLS+ +P           +   L DC   FT  E L  D
Sbjct: 692 YASQLRCKVCNRTSTTYQAFSVLSVPVP---------SGKSCGLLDCFIEFTKTENLEVD 742

Query: 516 NAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKK 575
             W CP+C+             +K+ ST                                
Sbjct: 743 EQWFCPSCK-------------KKQPST-------------------------------- 757

Query: 576 RNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI------------ 623
              KKLT  +      LP  L+IHL RF  ++  KN+  + YP IL++            
Sbjct: 758 ---KKLTITR------LPRNLIIHLKRF-DNMMNKNNIFVRYPQILDLTPFWANDSDGKL 807

Query: 624 -------ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDD 674
                  I   G+V    Y+LYG   H G L  GHYTS V  +K  E G     W+ FDD
Sbjct: 808 PPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYV--DKGPEKG-----WIYFDD 860

Query: 675 DYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
              +  R         + E  S   YVLFY
Sbjct: 861 TVYRPVR--------FQNEFISPSAYVLFY 882

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 120/425 (28%), Positives = 182/425 (42%), Gaps = 85/425 (20%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFK 355
           I GL+N  N CY+N I+QCL GT     +FL   Y  F+N  N    +  L+++   L  
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVH 522

Query: 356 KMYLNGGRAIIPNR--------FLKMCKKLRPDLNIPDD--QQDTQEFLLIVLARIHEEL 405
            M+ +G      +R        F K+C  +    +I  D  QQD QEF   +L  +HE+L
Sbjct: 523 NMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN---SIYSDSMQQDCQEFCQFLLDGLHEDL 579

Query: 406 SNENVVKYYPDLVSYDA---NALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKC 462
           +     K+   L   +     ++ +  +   +W ER ++TD  S I  +++GQ  + L+C
Sbjct: 580 NQNGGKKHLKQLSEQEERMRESMSIRKASALEW-ERFLLTD-FSAIIDLFQGQYASRLQC 637

Query: 463 QRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPN 522
           Q C ++S +Y TF VLS+ +P++         R   + DC   FT  E+L  D  W C  
Sbjct: 638 QACEHTSTTYQTFSVLSVPVPRI---------RTCNILDCFREFTKCEKLGVDEQWSCSK 688

Query: 523 CRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLT 582
           C      +K+ +IT   KK  I                           N K+ +++   
Sbjct: 689 CLKKQPSTKQLKITRLPKKLII---------------------------NLKRFDNQ--- 718

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILN-IILKNGKV--IRYKLYGTV 639
             K+  F+  P  L         DLT   +    +  I+N  I   G++   RY+LYG  
Sbjct: 719 MNKNNVFVQYPCFL---------DLTPYWARDFNHESIVNEDIPTRGQIPPFRYRLYGVA 769

Query: 640 NHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEV 699
            HSG+L  GHYTS V K         ++ W  FDD      R +         E  +   
Sbjct: 770 CHSGSLYGGHYTSYVYKGP-------QKGWYFFDDSVYCPIRFN--------DEFITPNA 814

Query: 700 YVLFY 704
           YVLFY
Sbjct: 815 YVLFY 819

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score =  119 bits (298), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 122/439 (27%), Positives = 188/439 (42%), Gaps = 85/439 (19%)

Query: 283 PVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYP 341
           P I++S  +     I GL+N  N CY+N I+QCL GT     +FL   Y  F+N  N   
Sbjct: 414 PPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFDNMRG 473

Query: 342 KEVQLSRSIYVLFKKMYLNGGRAIIPNR--------FLKMCKKLRPDLNIPDD--QQDTQ 391
            +  L+++   L   M+ +G    + +R        F K C  +    +I  D  QQD Q
Sbjct: 474 SKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHIN---SIYSDSMQQDCQ 530

Query: 392 EFLLIVLARIHEELSNENVVKYYPDLVSYDANA---LQVNPSKYEKWYERNVITDGLSPI 448
           EF   +L  +HE+L+     K+   L   +      + +  +   +W ER ++TD  + I
Sbjct: 531 EFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTRENMSIRKASALEW-ERFLLTDFSAVI 589

Query: 449 DHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTG 508
           D +++GQ  + L+CQ C ++S +Y TF VLS+ +P++             + DC   FT 
Sbjct: 590 D-LFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRI---------MTCNVLDCFREFTK 639

Query: 509 DEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXX 568
            E+L     W C  C      +K+ +IT   KK  I                        
Sbjct: 640 CEKLGIGEQWSCSRCLKKQPSTKQLKITRLPKKLII------------------------ 675

Query: 569 XTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILN-IILKN 627
              N K+ +++     K+  F+  P  L         DLT   +    +  I++  I   
Sbjct: 676 ---NLKRFDNQ---MHKNNVFVQYPCFL---------DLTPYWARDFNHEAIIDEDIPTR 720

Query: 628 GKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN 685
           G++   RY+LYG   HSG+L  GHYTS V K         ++ W  FDD     +R  R 
Sbjct: 721 GQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWYFFDDTI---YRLIRF 770

Query: 686 NFEAGKTEMSSDEVYVLFY 704
           N      E  +   YVLFY
Sbjct: 771 N-----NEFITPNAYVLFY 784

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 120/444 (27%), Positives = 173/444 (38%), Gaps = 123/444 (27%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL N  N+CY+N IIQCL GT     +FL   Y+  +N N K   +  L++    L   M
Sbjct: 496 GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTM 555

Query: 358 YLNGGRA-----------IIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELS 406
                 A           + P  F   C  +   L     QQD QEF   +L  +HE+L 
Sbjct: 556 QQQAASASTKQNSGDKTAVQPLHFKVACGSIN-SLFRSSSQQDCQEFCQFLLDGLHEDL- 613

Query: 407 NENVVKYYPDL--VSYDANALQ----VNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460
             N     P L  +S +A  ++    +  +   +W ER + TD  S I  +++GQ  + L
Sbjct: 614 --NQCGGNPALKELSEEAEGIREKLCMRIASSIEW-ERYLTTD-FSVIVDLFQGQYASQL 669

Query: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDC 520
            C+ CG +S +Y  F VLS+ +P  S         K  + DC   FT  E L  D  W C
Sbjct: 670 TCKVCGRTSTTYQPFSVLSVPVPSGS---------KCDIIDCFKEFTKVETLEKDEQWSC 720

Query: 521 PNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKK 580
           P C+                                                 K+ ++KK
Sbjct: 721 PRCK------------------------------------------------CKQPSTKK 732

Query: 581 LTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI----------------- 623
           +T  +      LP  LVIHL RF  +L  KN+  ++YP  L++                 
Sbjct: 733 ITITR------LPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVA 785

Query: 624 -ILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQH 680
            +   G+V    Y LY    H G L  GHYTS V+K        ++  W  FDD   ++ 
Sbjct: 786 ELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRKA 838

Query: 681 RKDRNNFEAGKTEMSSDEVYVLFY 704
           +         + E  +   YVLFY
Sbjct: 839 K--------SQGECITLSAYVLFY 854

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 118/468 (25%), Positives = 191/468 (40%), Gaps = 114/468 (24%)

Query: 274 SSAPKAYNLPVIEDSNDLLSELSI---TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK 330
           +S PK   LP   +   ++ +L +   TGL+N  N+CY+N +IQCL  T     L+LT  
Sbjct: 431 NSGPKLPLLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNA 490

Query: 331 YRLFLNT-NKYPKEVQLSRSIYVLFKKMYLNGG---------RAIIPNRFLKMCKKLRPD 380
           +   +N  NK   +  LS++   L + MY               + P  F   C  +   
Sbjct: 491 FLTQINVENKLGSKGFLSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-S 549

Query: 381 LNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDAN---ALQVNPSKYEKWYE 437
           +     +QD QEF   +L  +HE+L+  +      +L + +A    +L +  +   +W  
Sbjct: 550 IYAESTEQDCQEFCEFLLDGLHEDLNQCSGNPRPKELSANEAELRESLSMRIASEIEW-- 607

Query: 438 RNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKI 497
            + +T   SPI ++++GQ  + L+C  C ++S +Y  F +LS+ +P +      S  +  
Sbjct: 608 ESFLTTNFSPIINLFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPSMVF----SNGQTC 663

Query: 498 KLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXX 557
            + DC   FT  E L  D  W CP       K ++++I++                    
Sbjct: 664 NILDCFKEFTKCERLDNDEKWFCP-------KCRRKQIST-------------------- 696

Query: 558 XXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITY 617
                                      K L    LP  L+IH  RF  +   KN+  + Y
Sbjct: 697 ---------------------------KQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQY 728

Query: 618 PLILNIIL-----KNGKV----------------IRYKLYGTVNHSGNLINGHYTSVVNK 656
           P  L++        +GK+                 +YKL     HSGNL +GHYT+ V+K
Sbjct: 729 PYQLDLTSLWVNDYDGKLPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDK 788

Query: 657 EKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
                 GL R  W  FDD     +R  +       TE  + + Y+LFY
Sbjct: 789 ------GLYRG-WFRFDD---ASYRPVK-----FGTEFLTPDAYLLFY 821

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  113 bits (283), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 112/404 (27%), Positives = 165/404 (40%), Gaps = 76/404 (18%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-KYPKEVQLSRSIYVLFKKM 357
           GL N  N+CY++ IIQCL GT     +FL   Y+  +N N +   +  L+R    L  +M
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQM 548

Query: 358 YLNG----------GRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSN 407
           Y  G            A+IP +F   C  +       + QQD QEF   +L  +HE+L+ 
Sbjct: 549 YQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDLNQ 607

Query: 408 ENVVKYYPDLVSYDANALQVNPSKYEKW--YERNVITDGLSPIDHIYRGQLENILKCQRC 465
                   +L        ++ P +      +ER + TD  S I  +++GQ  + L+C+ C
Sbjct: 608 CGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTD-FSVIVDLFQGQYASQLQCKVC 666

Query: 466 GNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRI 525
             +S +Y  F VLS+ +P          +R   L DC   FT  E L  +  W CP+C+ 
Sbjct: 667 QRTSTTYQPFSVLSVPVP---------STRTCTLTDCFTEFTKIETLEQEEQWSCPSCKK 717

Query: 526 TDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIK 585
               +KK  IT   +   I                              KR    L   K
Sbjct: 718 RQPSTKKITITRLPRNLIIH----------------------------LKRFDNMLN--K 747

Query: 586 SLDFIVLPPILVIHLSRFY---YDLTKKNSTVITYPLILNIILKNGKV--IRYKLYGTVN 640
           +  F+  P +L   L+ F+   YD    N+ V         +   G+V    Y+LYG   
Sbjct: 748 NNVFVSYPSVL--DLTAFWANDYDKKVTNNNV--------ELPSRGQVPPFNYQLYGIAC 797

Query: 641 HSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
           H G L  GHYT+ VN  K   +G     W  +DD   +Q R  R
Sbjct: 798 HDGTLRAGHYTAYVN--KGAVLG-----WCYYDDTNWRQIRSAR 834

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  112 bits (279), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 124/271 (45%), Gaps = 24/271 (8%)

Query: 277 PKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN 336
           P   + P +  +N    + ++ GL+N  N+CYIN I+QCL GT    ++FL K Y   +N
Sbjct: 443 PSRESSPALGSANKYDLDFAV-GLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHIN 501

Query: 337 TN-KYPKEVQLSRSIYVLFKKMYLNG-------GRAIIPNRFLKMCKKLRPDLNIPDDQQ 388
            N +   +  L++    L   MY N        G+ + P  F   C  +   L     QQ
Sbjct: 502 MNSRLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTIN-SLFRESGQQ 560

Query: 389 DTQEFLLIVLARIHEEL---SNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGL 445
           D QEF   +L  +HE+L        +K   D        L +  +   +W ER + TD  
Sbjct: 561 DCQEFCQFLLDGLHEDLNQCGGNPPLKELSDEAEKMREKLSLRIASSIEW-ERFLTTD-F 618

Query: 446 SPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINL 505
           S I  +++GQ  + L+CQ CG +S +Y  F VLS+ +P          ++   + DC   
Sbjct: 619 SVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVP---------HAKSCNIIDCFKE 669

Query: 506 FTGDEELSGDNAWDCPNCRITDSKSKKEEIT 536
           FT  E+L  D  W CP C+     +KK  IT
Sbjct: 670 FTKVEKLETDEQWSCPRCKKKQPSTKKLTIT 700

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 65/150 (43%), Gaps = 37/150 (24%)

Query: 576 RNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILK-----NGKV 630
           R  KK  + K L    LP  L+IHL RF  ++  KN+  + YP  L++        +G++
Sbjct: 686 RCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRL 744

Query: 631 ----------------IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDD 674
                             YKLYG  +H G+L  GHYTS V+K         ++ W  FDD
Sbjct: 745 PPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKGP-------KRGWCYFDD 797

Query: 675 DYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
                 R  RN      TE  +   YVLFY
Sbjct: 798 TSF---RPVRN-----ATECITPNAYVLFY 819

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%)

Query: 12  VRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGCYYLYL 71
           V+ +Y+ DIK    QLRL  L  LL+H A+L   +   L   +  +AL+A+I+GCYYLYL
Sbjct: 23  VQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYYLYL 82

Query: 72  IIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESNGICRTI 131
           IIPQS QFQT+N  YS Y   K  YQ+E  M  V  +VR+E   I+D+   E     R I
Sbjct: 83  IIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPEPTKRVI 142

Query: 132 KRKRAYSL 139
            R RA+S+
Sbjct: 143 PRGRAFSV 150

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 162/418 (38%), Gaps = 103/418 (24%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQL-----SRSIY 351
           I G+QN  N CY+N IIQCL     F + FL   Y   +N N       L     ++ I 
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVVKNWAKIIQ 402

Query: 352 VLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVV 411
             F+    N   A+    F +    L P+      Q D  EF L +L  IHE+ SN    
Sbjct: 403 AFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHED-SNWGRP 460

Query: 412 KYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSP-IDHIYRGQLENILKCQRCGNSSY 470
           +      + DA A+QV+  + E W   N+   G S  I   ++GQ+++ L CQ C   S 
Sbjct: 461 Q------NSDA-AMQVDDYR-EAW---NLYRKGNSSYIVDTFKGQIKSQLTCQVCQTQSN 509

Query: 471 SYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKS 530
           +Y  F +L+L IP +S+           + DC+        L+GD+ W C  C+      
Sbjct: 510 NYEPFSILNLPIPLVSM---------CHIYDCMKELFKVHVLTGDDRWYCSTCKT----- 555

Query: 531 KKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFI 590
                                                       K +S   TTI +    
Sbjct: 556 --------------------------------------------KTHSTLGTTITN---- 567

Query: 591 VLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKV----IRYKLYGTVNHSGNLI 646
            +P +L+IH +RF  +L  K    + YP +L++   NG +    + YKL     H+G L 
Sbjct: 568 -VPEVLIIHFNRF-DNLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLF 625

Query: 647 NGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
           +GHYT+   K   +        W  FDD   +              E  S   Y+LFY
Sbjct: 626 SGHYTAYCFKNSENG-------WYHFDDTQCK---------PVSNGECISQSAYLLFY 667

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 107/424 (25%), Positives = 173/424 (40%), Gaps = 77/424 (18%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT-NKYPKEVQLSRSIYVLFK 355
           I GL+N  N+CY+N IIQCL        + L   +   +N  +K   +  + +    L +
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 356 KMY---LNGGRAII--PNR---FLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSN 407
            M+   +  GR++   P +   F   C  +   +     QQD QEF   +L  +HE+L+ 
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVS-SIYSGSQQQDCQEFCEFLLDGLHEDLNQ 546

Query: 408 ENVVKYYPDLVSYDA---NALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQR 464
                   +L   +      L +  +    W   N + +  S I  ++ GQ  + L+C  
Sbjct: 547 CGGNPPARELTDQEERLREGLCMRVASSMAW--ENFLHNNFSLIIDLFAGQYGSQLRCCV 604

Query: 465 CGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           C  +S +Y  F +LS+ +P       +S+  +  + DC   FT  E L  D  W CP C+
Sbjct: 605 CQYTSTTYQPFTLLSVPVP------LSSRVSRCSIIDCFQEFTKCERLDKDEEWFCPQCK 658

Query: 525 ITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTI 584
                +K+ +IT +  K+ I  F                        N   +N+  +   
Sbjct: 659 RKQPSTKQLKIT-RLPKNLIIHFKRF--------------------DNMMNKNNIFIQYP 697

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLIL--NIILKNGKV--IRYKLYGTVN 640
             LD   L P  V   + F  +L          PL +  +++ K G+V   +Y+L     
Sbjct: 698 YELD---LTPFWV---NDFNGEL----------PLGMTNSLLTKGGQVGPFKYQLNAVAC 741

Query: 641 HSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVY 700
           H G L +GHYT+ VN  K  ++G     W  FDD     HR          TE  + + Y
Sbjct: 742 HMGTLGSGHYTAYVN--KGPDVG-----WYYFDDS---SHR-----IVKIATEYMNPDAY 786

Query: 701 VLFY 704
           +LFY
Sbjct: 787 LLFY 790

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 104/223 (46%), Gaps = 11/223 (4%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK---YPKEV- 344
           NDL+  L ITGL N  NTCY+NS +QC+    +FR+ FL   Y   LNT+    Y   V 
Sbjct: 312 NDLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVA 371

Query: 345 -QLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHE 403
              S  I  LF    +    A  PN F           +    QQD+QEFL  +L  +HE
Sbjct: 372 EAFSELIRCLFGDKLVQFS-AYAPNHFKATIGHFNSMFS-GYLQQDSQEFLAFLLDSLHE 429

Query: 404 ELSNENVVKYY--PDLVS-YDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460
           +L+  +   Y   P L S  D N  ++     +  ++ +++ +  S I  ++ G  ++ L
Sbjct: 430 DLNRIDKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-SVITDLFVGLYKSTL 488

Query: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCI 503
           +C  C N S ++  +  L+L +P  S++    K   +    CI
Sbjct: 489 ECPECQNISITFDPYNDLTLPLPVKSMWHSHIKIFPLNAPPCI 531

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 24/32 (75%)

Query: 493 KSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           K+++I L DC+NLF+  E LS +++W CP C+
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTCK 923

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 94/211 (44%), Gaps = 15/211 (7%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-----TNKYPKE 343
           N LLS     GL N  NTCY+NS +QCL     F+D FL   Y   +N      +K    
Sbjct: 337 NQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIA 396

Query: 344 VQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHE 403
              +  +  LF K + +   +  P  F      L   +     QQD+QEFL  +L  +HE
Sbjct: 397 WAFASMVQALFGKRH-SAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHE 454

Query: 404 ELSNENVVKYY---PDLVSYDANA--LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLEN 458
           +L N  + K Y   P+L S D  A    +     + W +  +  D +  I  ++ G  ++
Sbjct: 455 DL-NRIIEKPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKLRNDSV--ITDLFVGLYKS 511

Query: 459 ILKCQRCGNSSYSYSTFYVLSLAIPKLSLYS 489
            L C  C  +S ++  +  L+L +P  S +S
Sbjct: 512 TLICPVCKKTSVTFDPYNDLTLPLPVNSTWS 542

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 491  TSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
             S  +KI L DC+ LF+  E L   ++W CPNC+     +K+ E+
Sbjct: 956  ASGEKKITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQATKQIEL 1000

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 98/214 (45%), Gaps = 28/214 (13%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQ--L 346
           N L     ITGL N  NTCY+NS +QCL      RD FL   +   +N N  P   Q  +
Sbjct: 284 NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNN-PLGYQGYV 342

Query: 347 SRSIYVLFKKMY----LNGGRAIIPNRFLKMCKKLRPDLNIPDD---QQDTQEFLLIVLA 399
           +R+   L + ++    L+ G  + P       K      N       QQD+QEF+  +L 
Sbjct: 343 ARAFSGLVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFSGYMQQDSQEFITFLLD 402

Query: 400 RIHEELSNENVVKYY-------PDLVSYDANALQ-VNPSKYEKWYERN--VITDGLSPID 449
            +HE+L N  V K Y       P+  S D N ++ +    ++   +RN  VITD      
Sbjct: 403 GLHEDL-NRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRNDSVITD------ 455

Query: 450 HIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIP 483
            ++ G  E+ L+C  C N S ++  +  L+L +P
Sbjct: 456 -LFVGLYESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 493 KSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           + +KI L DC+ LF+  E L  +++W CP+C+
Sbjct: 876 EEKKITLHDCLKLFSKREVLGMNDSWYCPSCK 907

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 96/212 (45%), Gaps = 24/212 (11%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFKK 356
           TGL N  NTCY+NS +QCL      RD FL   Y   +N  N       ++R+   L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 357 MYLN-----GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVV 411
           ++ N        A  P    K        +     QQD+QEFL  +L  +HE+L N  + 
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDL-NRIIK 482

Query: 412 KYY-------PDLVSYDANAL-QVNPSKYEKWYERN--VITDGLSPIDHIYRGQLENILK 461
           K Y       PD    D N + ++    +E   +RN  VITD       ++ G  ++ L 
Sbjct: 483 KAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRNCSVITD-------LFVGLYKSTLY 535

Query: 462 CQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSK 493
           C  C N S ++  +  ++L +P  +++S T K
Sbjct: 536 CPECKNVSITFDPYNDVTLPLPVDTVWSKTVK 567

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 443 DGLSPIDHIYRGQLENILKCQ---RCGNSSYSYSTFY-------VLSLAIPKLSLYSFTS 492
           +GLS I H     +++IL C+      N ++S    +       + ++ +    L    +
Sbjct: 901 NGLSSISHEILS-IDDILVCEWEESGSNEAFSNDKIFNWENPAPLPNIELENAKLERSNA 959

Query: 493 KSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           K R I L+DC+ LF+  E L  +++W CP C+
Sbjct: 960 KERIITLDDCLQLFSKPEILGLNDSWYCPTCK 991

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 97/208 (46%), Gaps = 9/208 (4%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT-NKYPKEVQLS 347
           N L     I GL N  N+CY+NS +QCL      RD FL   +   +NT N    + Q++
Sbjct: 289 NKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIA 348

Query: 348 RSIYVLFKKMYLNGGRAI--IPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL 405
           ++   L K ++ +   A+     R  K        +     QQD+QE L  +L  +HE+L
Sbjct: 349 QAFAALVKSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDL 408

Query: 406 SNENVVKYY---PDLVSY-DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILK 461
            N  + K +   P+L S  D N + V  +     +E++ + +    +D ++ G  ++ L 
Sbjct: 409 -NRIMKKPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNESVIVD-LFVGLYKSTLT 466

Query: 462 CQRCGNSSYSYSTFYVLSLAIPKLSLYS 489
           C  C   S ++  F  L+L +P  S +S
Sbjct: 467 CPACDRVSVTFDPFSDLTLPLPVESFWS 494

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 497 IKLEDCINLFTGDEELSGDNAWDCPNCR 524
           I L DC+ LF+  E L   ++W CPNC+
Sbjct: 872 ISLTDCLELFSKSEVLGAADSWYCPNCK 899

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 100/207 (48%), Gaps = 9/207 (4%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT-NKYPKEVQLS 347
           N+L S     GL N  NTCY+NS +QC+    +FRD FL   ++  +N  N    +  ++
Sbjct: 321 NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMA 380

Query: 348 RSIYVLFKKMY---LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEE 404
           R+   L + ++   +    A  P+ F          +     QQD+QEFL  +L  +HE+
Sbjct: 381 RAFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHED 439

Query: 405 LSNENVVKYY--PDL-VSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILK 461
           L+  +   Y   P L ++ + N   V     +  ++ +++ +  S I  ++    ++ LK
Sbjct: 440 LNRIDKKPYVEKPSLPLTANLNDFDVVKRLADDTWKAHLLRND-SVITDLFVAMYKSTLK 498

Query: 462 CQRCGNSSYSYSTFYVLSLAIPKLSLY 488
           C  C N+S ++  +  L+L +P  S++
Sbjct: 499 CPECQNTSVTFDPYNDLTLPLPVASIW 525

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 493 KSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
           + R I L+DC+ LF+  E LS +++W CP+C+     +K+ E+
Sbjct: 935 EERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQATKQIEL 977

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 97/230 (42%), Gaps = 44/230 (19%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQ--LSRSIYVLFKK 356
           GL N  NTCY+NS +QCL      RD F+   +   +N N  P   Q  ++RS + L + 
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNN-PLGFQGHMARSFHGLIQS 380

Query: 357 MYLNGGRAIIP--------------NRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIH 402
           ++   G +I P                F  M    +        QQD+QEFL  +L  +H
Sbjct: 381 LF---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ--------QQDSQEFLAFLLDSLH 429

Query: 403 EELSNENVVKYY---------PDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453
           E+L N  V K Y          D+  +D      N    E W    +  D +  I  I+ 
Sbjct: 430 EDL-NRIVEKPYVEKPSLKPGDDINDFDTIKKLAN----ETWKSHLMRNDSI--ITDIFV 482

Query: 454 GQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCI 503
           G  ++ L+C  C N S ++  +  L+L +P  S ++   +    KL  C+
Sbjct: 483 GMYKSTLECPECSNVSITFDPYNDLTLPLPINSSWNAQVRIFPSKLPPCM 532

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 495 RKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
           ++  L+DC+NLF+  E L   ++W CPNC+     +KK E+
Sbjct: 891 QETTLKDCLNLFSKKEVLGMSDSWYCPNCKEHRQATKKIEL 931

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 103/228 (45%), Gaps = 19/228 (8%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLS 347
           N+ ++   I GL N  NTCY+NS +QCL      RD F    Y   +N  N       ++
Sbjct: 280 NNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVA 339

Query: 348 RSIYVLFKKMY-----LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIH 402
            +   L + +Y         ++  PNRF KM       +     QQD+QEFL  +L  +H
Sbjct: 340 TAFGNLIQNLYSYHWNQQQYQSYSPNRF-KMTLGQANSMFAGYMQQDSQEFLAFLLDSLH 398

Query: 403 EELSNENVVKYY--PDLVS----YDANAL-QVNPSKYEKWYERNVITDGLSPIDHIYRGQ 455
           E+L+  +   Y   P L +     D NA+ Q+    ++    RN      S I+ ++ G 
Sbjct: 399 EDLNRIHDKPYIEKPTLETSEELADENAVKQLAKKTWDAHLARND-----SVINDLFVGM 453

Query: 456 LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCI 503
            ++ LKC  C N S ++  +  L+L +P  ++++   K    K   CI
Sbjct: 454 YKSTLKCPTCKNISITFDPYNDLTLPLPISTVWNKKVKIFPQKSPPCI 501

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 56/130 (43%), Gaps = 28/130 (21%)

Query: 585 KSLDFIVLPPILVIHLSRF--YYDLTKKNSTVITYPL--------ILNIILKNGKVIRYK 634
           K L+    P IL+IHL RF      + K   V+ +P+        +++ ++++G +  Y 
Sbjct: 879 KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YD 936

Query: 635 LYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEM 694
           L+   NH G L  GHYTS V          NR  W  FDD  +     D     AG    
Sbjct: 937 LFAVDNHYGGLGGGHYTSYVKNNID-----NR--WYYFDDSRVSS--TDPKKSVAGS--- 984

Query: 695 SSDEVYVLFY 704
                Y+LFY
Sbjct: 985 ----AYLLFY 990

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 497 IKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
           I L+ C+ LF+  E L  +++W CP C+     +K+ E+
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKCKEHRQATKQLEL 883

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 93/209 (44%), Gaps = 21/209 (10%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK---YPKEVQ 345
           N L     ITGL N  NTCY+NS +QCL      RD FL   +   +N++    Y   + 
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIA 352

Query: 346 LSRSIYV--LFKKMYLNG-GRAIIPNRF---LKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399
            + S+ V  LF   Y +   +A  PN F   +  C  +         QQD+QEFL  +L 
Sbjct: 353 KAFSLLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLD 408

Query: 400 RIHEELSNENVVKYYPDLVSYDANALQVNPSKYEK-----WYERNVITDGLSPIDHIYRG 454
            +HE+L N    K Y +  S   N+   +    +K     W    +  D +  +  ++  
Sbjct: 409 GLHEDL-NRVHDKPYIEKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRNDSI--VTDLFVA 465

Query: 455 QLENILKCQRCGNSSYSYSTFYVLSLAIP 483
             E+ L+C  C N S ++  +  L+L +P
Sbjct: 466 LYESTLECPECRNVSITFDPYNDLTLPLP 494

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 495 RKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITS 537
           R I L DC+ LF+  E LS +++W CP C+     +K+ ++ S
Sbjct: 868 RAISLHDCLKLFSKKEVLSMNDSWYCPTCKDHRQATKQIQLWS 910

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 51/127 (40%), Gaps = 25/127 (19%)

Query: 585  KSLDFIVLPPILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNGKVIRYKLYG 637
            K +     P +L+IHL RF      + K    + +P     +  +++ ++ +   Y L  
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 638  TVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSD 697
              NH G L  GHYT+ V              W  FDD  + + + + +   AG       
Sbjct: 964  VDNHFGGLGGGHYTAYVKTNDK---------WFYFDDSRVTETKPESS--IAGS------ 1006

Query: 698  EVYVLFY 704
              Y+LFY
Sbjct: 1007 -AYLLFY 1012

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 102/214 (47%), Gaps = 11/214 (5%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT-NKYPKEVQLS 347
           N LL     TGL N  N+CY+NS +QCL      +D FL   Y   +NT N    +  ++
Sbjct: 325 NKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVA 384

Query: 348 RSIYVLFKKMY---LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEE 404
           ++   L K ++    +   A  P  F  +  + +  +     QQD+QEFL  +L  +HE+
Sbjct: 385 QAFAALIKSLFDERSSSAFAFSPREFKSIIGQ-QNSMFAGFLQQDSQEFLAFLLDGLHED 443

Query: 405 LSN--ENVVKYYPDLV-SYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILK 461
           L+   E      P+L    D N  +V      K ++++ + +  S I  ++ G  ++ L 
Sbjct: 444 LNRIIEKPFVEKPELSPDEDVNNREVIHRLASKTWDKHKLRND-SVILDLFVGLYKSTLT 502

Query: 462 CQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSR 495
           C  C  +S ++  +  L+L +P  S++  TSK R
Sbjct: 503 CPVCDKTSVTFDPYSDLTLPLPVESIW--TSKVR 534

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 495 RKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           R+I L DC+ LF+  E LS  ++W CP CR
Sbjct: 901 RRISLFDCLKLFSKPEVLSAADSWYCPTCR 930

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 96/213 (45%), Gaps = 26/213 (12%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFKK 356
           TGL N  NTCY+NS +QCL      RD FL   Y   +N  N       ++R+   L +K
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSDLIQK 420

Query: 357 MYLNG------GRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           ++ N         A  P  F           +    QQD+QEFL  +L  +HE+L N  +
Sbjct: 421 LFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDL-NRII 478

Query: 411 VKYY-------PDLVSYDANAL-QVNPSKYEKWYERN--VITDGLSPIDHIYRGQLENIL 460
            K Y       PD    D N + ++    +E   +RN  VITD       ++ G  ++ L
Sbjct: 479 KKAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNRSVITD-------LFVGMYKSTL 531

Query: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSK 493
            C  C + S ++  +  ++L +P  +++S T K
Sbjct: 532 YCPECKDVSTTFDPYNDVTLPLPVDTVWSKTVK 564

 Score = 38.5 bits (88), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 482 IPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           + K+ L    +K R I L DC+ LF+  E L  +++W CP C+
Sbjct: 946 LEKVKLERCNAKERTITLNDCLQLFSKPEILGLNDSWYCPTCK 988

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 94/212 (44%), Gaps = 14/212 (6%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK---YPKEVQ 345
           ND        GL N  NTCY+NS +QCL      RD FL   Y   LNT+    Y   V 
Sbjct: 314 NDFHHAKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVA 373

Query: 346 LSRSIYV--LFKKMYLNGG--RAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
            + S  V  LF       G   +  PN F           +    QQD+QEFL  +L  +
Sbjct: 374 KAFSSLVQNLFGDTITKQGTNSSFGPNHFKSTVGHFNSMFS-GYLQQDSQEFLAFLLDSL 432

Query: 402 HEELSNENVVKYYPDLVSY----DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLE 457
           HE+L N  + K   +  S     D N   V  S  ++ ++ +++ +  S I  ++ G  +
Sbjct: 433 HEDL-NRIINKPSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRND-SVITDLFVGMYK 490

Query: 458 NILKCQRCGNSSYSYSTFYVLSLAIPKLSLYS 489
           + L+C  C N S ++  +  L+L +P  S +S
Sbjct: 491 STLECPECTNVSITFDPYSDLTLPLPVDSTWS 522

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 495 RKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKK 532
           ++I L DC+NLF+  E L  +++W CP+C+     SK+
Sbjct: 870 KEITLNDCLNLFSKREVLGLNDSWYCPHCKEHRQASKR 907

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 95/221 (42%), Gaps = 24/221 (10%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLS 347
           N L      TGL N  NTCY+NS +QCL      RD FL   Y   +N  N       ++
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVA 414

Query: 348 RSIYVLFKKMYLN-----GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIH 402
           R+   L +K++ N        A  P    K        +     QQD+QEFL  +L  +H
Sbjct: 415 RAFSDLVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLH 474

Query: 403 EELSNENVVKYYPDLVSY----DANALQV----NPSKYEKWYERN--VITDGLSPIDHIY 452
           E+L N  + K Y +  S     D N   V        +E   +RN  VITD       ++
Sbjct: 475 EDL-NRIIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNCSVITD-------LF 526

Query: 453 RGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSK 493
            G  ++ L C  C N S ++  +  ++L +P  +++  T K
Sbjct: 527 VGMYKSTLYCPECQNVSITFDPYNDVTLPLPVDTVWDKTIK 567

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 492 SKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           +K R I L+DC+ LF+  E L   ++W CP C+
Sbjct: 957 AKERTITLDDCLQLFSKPEILGLTDSWYCPTCK 989

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 89/194 (45%), Gaps = 13/194 (6%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFKKM 357
           GL N  NTCY+NS +QCL      RD FL K +   +N  N    +  ++RS  +L + +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNL 402

Query: 358 Y---LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL---SNENVV 411
           +   L    +  P  F           +    QQD+QEF+  +L  +HE+L   +N+ VV
Sbjct: 403 FKDELLPSLSYSPTTFKSTVGHFNSMFS-GYLQQDSQEFIAFLLDGLHEDLNRITNKPVV 461

Query: 412 KYYPDLVSYD--ANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSS 469
           +  P L   D  +N   +     + W    +  D +  I  I+ G  ++ L C  C N S
Sbjct: 462 E-KPSLKPEDDVSNQEVIKKLADDTWNSHLLRNDSI--ITDIFVGLYKSTLHCPECDNLS 518

Query: 470 YSYSTFYVLSLAIP 483
            ++  +  L+L +P
Sbjct: 519 VTFDPYNDLTLPLP 532

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 495 RKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           +KI L+DC+NLF   E L  +++W CP C+
Sbjct: 907 KKITLDDCLNLFAKKEVLGMNDSWYCPTCK 936

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 99/222 (44%), Gaps = 26/222 (11%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLS 347
           N L      TGL N  NTCY+NS +QCL      RD FL   Y   +N  N       ++
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVA 414

Query: 348 RSIYVLFKKMYLN------GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
           R+   L +K++ N         A  P+ F           +    QQD+QEFL  +L  +
Sbjct: 415 RAFSDLIQKIFQNRLSVMQRNGAFPPSMFKSTVGHFNSMFS-GYMQQDSQEFLAFLLDSL 473

Query: 402 HEELSNENVVKYYPDLVSY-------DANAL-QVNPSKYEKWYERN--VITDGLSPIDHI 451
           HE+L N  + K Y +  S        D N + ++    +E   +RN  VITD       +
Sbjct: 474 HEDL-NRIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWEMHLKRNCSVITD-------L 525

Query: 452 YRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSK 493
           + G  ++ L C  C N S ++  +  ++L +P  ++++ T K
Sbjct: 526 FVGMYKSTLYCPECKNVSITFDPYNDVTLPLPVDTVWNKTVK 567

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 492 SKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           +K R I L+DC+ LF+  E L   ++W CP C+
Sbjct: 953 AKERTITLDDCLQLFSKPEILGLSDSWYCPTCK 985

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 53/122 (43%), Gaps = 28/122 (22%)

Query: 593  PPILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKN---GKVIRYKLYGTVNHS 642
            P IL+IHL RF      + K    + +P     L  N++ K+   G +  Y LY   NH 
Sbjct: 1000 PDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSI--YDLYAVDNHY 1057

Query: 643  GNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVL 702
            G L  GHYT+ V    +++       W  FDD  + +   +  N  AG         Y+L
Sbjct: 1058 GGLGGGHYTAYVKNFANNK-------WYYFDDSRVTETVPE--NSIAGS-------AYLL 1101

Query: 703  FY 704
            FY
Sbjct: 1102 FY 1103

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 155/420 (36%), Gaps = 109/420 (25%)

Query: 284 VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE 343
           V+++    LS L   GL N   TCY N+ +Q +        +   + Y   +   KY   
Sbjct: 250 VVKNWGPHLSALRPKGLLNHGVTCYTNAAVQAIV------HIPAIQHYLFDILRGKYEST 303

Query: 344 VQLSRSIYVLF---KKMYL--------NGGRAIIPNRFLKMCKKLRPDLNI---PDDQQD 389
           +      YVL    KKM+L        NG   I P + +        D+N       Q+D
Sbjct: 304 ISRDSVSYVLAETSKKMWLPQDRSKKKNGPHHINPKKLIARLD----DINCMMSEWQQED 359

Query: 390 TQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPID 449
           + E+ + +++R+ E+                       +  K  K  E ++I D      
Sbjct: 360 SHEYFMSLMSRLQED-----------------------SVPKGHKMTE-SIIYD------ 389

Query: 450 HIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGD 509
            I+ G L+ ++ C+ CG+ S +   FY LSL +      S +  S+           + D
Sbjct: 390 -IFGGLLKQVVTCKSCGSVSKTEQPFYDLSLHLKGKKKQSLSQDSQ-----------SDD 437

Query: 510 EELSGDNAWD--CPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXX 567
           +  S D   D   P+ R +  KS             I  F                    
Sbjct: 438 QNKSSDAKSDDSAPSRRYSIEKS-------------IRDFFNPELIRVDKEQKGYVCEKC 484

Query: 568 XXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITYPLILNIIL 625
             T NA KR+S           I  P  L+ HL +F ++ T   K    ++YP+ L++  
Sbjct: 485 HQTTNAVKRSS----------IIRAPETLLTHLKKFRFNGTASSKMKQAVSYPMFLDLTE 534

Query: 626 ------KNGKV-IRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
                 K+  V ++Y+L   V H G +L +GHY     +            W T+DD+YI
Sbjct: 535 YCESNEKDHVVPVKYQLTTVVVHEGRSLSSGHYIVHCKQPDG--------TWATYDDEYI 586

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 84/210 (40%), Gaps = 25/210 (11%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN-----KYPKE 343
           N L +   I GL N  NTCY+NS +QCL       + FL K Y   +N N     K    
Sbjct: 330 NKLNAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVA 389

Query: 344 VQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHE 403
                 +Y LF   Y  G       R  K        L     QQD+QEFL  +L  +HE
Sbjct: 390 HAFGHLLYSLFAPSY--GQSTFYAPRNFKNTIGHYNSLFAGYGQQDSQEFLAFLLDGLHE 447

Query: 404 ELSNENVVKYYPDLVSYDANA----------LQVNPSKYEKWYERNVITDGLSPIDHIYR 453
           +L N  + K Y +   +  +           L  N   Y K    +VI D       ++ 
Sbjct: 448 DL-NRVIEKPYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIMD-------LFV 499

Query: 454 GQLENILKCQRCGNSSYSYSTFYVLSLAIP 483
           G  ++ L C  C + S ++  +  L+L +P
Sbjct: 500 GLYKSTLVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 491 TSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
           T KS  I L+ C+ LF+  E L   ++W CPNC+     SK+ E+
Sbjct: 897 TEKS-SITLDSCLRLFSQPEILGSADSWYCPNCKQHTQASKQIEL 940

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (45%), Gaps = 25/210 (11%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN-TNKYPKEVQLSRSIYVLFKKM 357
           GL N  NTCY+NS +QCL      RD F    Y+  +N  N    +  ++ +   L + +
Sbjct: 399 GLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQNL 458

Query: 358 YLNG---GRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYY 414
           Y N      +  P++F K+       +     QQD+QEFL  +L  +HE+L   N +K  
Sbjct: 459 YKNQFIPSASYAPSQF-KLTIGHYNQMFSGYFQQDSQEFLAFLLDGLHEDL---NRIKDK 514

Query: 415 P-----------DLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQ 463
           P           D+  Y+  A ++     E   +RN      S I  ++ G  ++ LKC 
Sbjct: 515 PYVEKPSLADGSDVNDYNIIA-RLAADTLEAHLKRND-----SIIIDLFVGLYKSTLKCP 568

Query: 464 RCGNSSYSYSTFYVLSLAIPKLSLYSFTSK 493
            C + S ++  +  L+L IP  S+++F  K
Sbjct: 569 VCNHVSITFDPYCDLTLPIPVESVWNFKVK 598

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 493  KSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTI 544
            + + I LED +NLF   E L  +++W CP C+     SK+ ++ S     TI
Sbjct: 958  EEKNITLEDSLNLFERAEVLGINDSWYCPKCKHHRQASKQIQLWSTPDILTI 1009

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 88/222 (39%), Gaps = 27/222 (12%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN---KYPKEV- 344
           N L       GL N  +TC+INS++QCL   T  RD FL   +   LNT     Y   V 
Sbjct: 342 NRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVA 401

Query: 345 -QLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHE 403
              +  +  LF             N F       RP L  P  QQD+ E +  +L  +HE
Sbjct: 402 GAFAEVVQALFGDKIAQFPTYAASN-FRATIGYFRPALG-PYVQQDSHEVVAFLLGALHE 459

Query: 404 ELSNENVVKYYPDL----------VSYDANALQVNPSKYEK-----WYERNVITDGLSPI 448
           +L   N     P +           S  A+A   N  + E+     W    +  D  S I
Sbjct: 460 DL---NRAPEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQND--SVI 514

Query: 449 DHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSF 490
             ++ G L++ L C  C  SS ++     L++ +   + +SF
Sbjct: 515 TDLFAGMLKSTLTCLTCRRSSVTFDPCTELAVPLAVDAHWSF 556

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 76/229 (33%), Gaps = 87/229 (37%)

Query: 493  KSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXX 552
            + ++  LEDC++LFT  E L+  ++W CP C+                            
Sbjct: 929  QKQETTLEDCLDLFTAPEVLNTADSWYCPACK---------------------------- 960

Query: 553  XXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRF--YYDLTKK 610
                                 K R + +   + S   I+L     +HL RF  +Y  T K
Sbjct: 961  ---------------------KLRQATRQIELWSTPEILL-----VHLKRFESHYSSTGK 994

Query: 611  NSTVITYPLI---------------LNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVN 655
             +  + +PL                       G+   Y L    NH G L +GHYT+ V 
Sbjct: 995  LNNTVHFPLTGLDMSPHLPCRDGDGDGDGDDGGRENVYDLIAVDNHFGGLGSGHYTAYVK 1054

Query: 656  KEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
                 +       W  FDD  ++         E     ++S   Y+LFY
Sbjct: 1055 NPVDDK-------WYLFDDSEVR---------EVDAESVASSFGYLLFY 1087

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 103/437 (23%), Positives = 168/437 (38%), Gaps = 105/437 (24%)

Query: 284 VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRD-LF--LTKKYRLFLNTNKY 340
           +I++   + + L   GL N   TCY N+ +Q +      +  LF  L  KY+     N  
Sbjct: 428 IIKNWGPVFANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYK-----NID 482

Query: 341 PKEVQLSRSIYVLFKKMYLN---GGRAII----PNRFLKMCKKLRPDLNIPDDQQDTQEF 393
           P  V  S ++    ++M+L+   G + +I    PN  ++    +   +N P +Q+D+ E+
Sbjct: 483 PNSV--SYTLAETTRRMWLSNKKGNKKVIAYYNPNELIERLDDINWSMN-PYNQEDSHEY 539

Query: 394 LLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453
            + +++++ E                   N++ +          RN+     S I  I+ 
Sbjct: 540 FMSLMSKLQE-------------------NSVPIG---------RNMTE---SIIYDIFG 568

Query: 454 GQLENILKCQRCGNSSYSYSTFYVLSLAI-------PKLSLYSFTSKSRKIKLEDCINLF 506
           G LE  + C+ CG  S +   FY LSL +        K    S           D  N  
Sbjct: 569 GLLEQTVTCKSCGGVSKTEQEFYDLSLDLNGKRNNPAKDVQQSQEQVQSDHHHSDDGN-- 626

Query: 507 TGDEELSGDNAW-------DCPNCRITDSKSKKEEITSQKK------KSTIFGFXXXXXX 553
             D E   DN           PN  I  S+S +E I  Q K      +  I  F      
Sbjct: 627 --DAEEDSDNGIAENGKNVQQPNAIIPRSQSPQEIIPKQTKARKYTIEKAIRDFFNPELL 684

Query: 554 XXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD--LTKKN 611
                           T NA KR++           +  P  LV+HL +F ++   + K 
Sbjct: 685 KVDKNDKGYVCEKCNKTTNAIKRST----------ILRAPETLVVHLKKFRFNGSTSSKM 734

Query: 612 STVITYPLILNII---LKNGKVI--RYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLN 665
              ++YP+ L+I      + KV+  +Y+L   V H G +L +GHY           I   
Sbjct: 735 KQAVSYPMYLDITEYCESSKKVLPAKYQLLSVVVHEGRSLSSGHY-----------IAHC 783

Query: 666 RQ---VWVTFDDDYIQQ 679
           RQ    W T+DD+ I +
Sbjct: 784 RQPDGTWATYDDELINK 800

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 91/212 (42%), Gaps = 17/212 (8%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT-NKYPKEVQLS 347
           N +       GL N  NTCY+NS +QCL     F+D FL   Y   +N  N    +  ++
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPLGHKGHIA 399

Query: 348 RSIYVLFKKMYLNGGR-----AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIH 402
            +   L + ++  G R     +  P  F      L   +     QQD+QEFL  +L  +H
Sbjct: 400 WAFGTLIQSLF--GKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLH 456

Query: 403 EELSNENVVKYY---PDLVSYD--ANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLE 457
           E+L N  V K Y   P+L   D       +     + W +  +  D +  I  ++ G  +
Sbjct: 457 EDL-NRIVDKPYVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV--ILDLFVGLYK 513

Query: 458 NILKCQRCGNSSYSYSTFYVLSLAIPKLSLYS 489
           + L C  C   S ++  +  L+L +P  S +S
Sbjct: 514 STLICPTCKKVSTTFDPYNDLTLPLPVDSTWS 545

 Score = 38.1 bits (87), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 493 KSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
           + +KI L DC+ LF+  E L   ++W CP+C+     +K+ E+
Sbjct: 933 EEKKITLHDCLTLFSTPEVLGATDSWYCPSCKEHRQATKQIEL 975

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 89/422 (21%), Positives = 159/422 (37%), Gaps = 98/422 (23%)

Query: 292 LSELSITGLQNPCNTCYINSIIQCLFGTTLFR----DLFLTKKYRLFLNTNKYPKEVQLS 347
           LS L   GL N   TCY N+ +Q +      +    D+   K       T+      + S
Sbjct: 327 LSSLKPRGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYSDTISPTSVSTVLAETS 386

Query: 348 RSIY----VLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNI---PDDQQDTQEFLLIVLAR 400
           R ++    +L KK+    G  I PN+ +  C+    D+N       Q+D+ E+ + +++R
Sbjct: 387 RRMWFPNEILKKKI----GTYIDPNKLI--CR--LDDINCMMSEWQQEDSHEYFMSLMSR 438

Query: 401 IHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460
           + E+                       +  K  K  E ++I D       I+ G L+  +
Sbjct: 439 LQED-----------------------SVPKGHKMTE-SIIYD-------IFGGLLKQAV 467

Query: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDC 520
            C+ CG+ S +   FY LSL +              + +    N   G       +  + 
Sbjct: 468 TCKSCGSISKTEQPFYDLSLHLK-------GKNKSDLNINSEANTSNGGNTTQDSSTTEN 520

Query: 521 PNCRITDSKSKKEEITSQKKK----------STIFGFXXXXXXXXXXXXXXXXXXXXXXT 570
            +  + + K+  +++++Q K+           +I  F                      T
Sbjct: 521 GSLEVGNGKAATQQVSAQAKQLAVNRKFSIEKSIKDFFNPELIRVDNEQKGYVCEKCHKT 580

Query: 571 KNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITYPLILNIIL--- 625
            NA KRNS           +  P  L++HL +F ++ T   K    ++YP+ L++     
Sbjct: 581 TNAAKRNS----------ILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTKYCD 630

Query: 626 -----KNGKV--IRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
                K   V  ++Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 631 KEATPKGQDVLPVKYQLISVVVHEGRSLSSGHYIAHCKQPDGS--------WSTYDDEYI 682

Query: 678 QQ 679
            +
Sbjct: 683 NK 684

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 103/258 (39%), Gaps = 73/258 (28%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSR 348
           N L+      GL N  NTCY+NS +QCL     F + FL          N Y KE+ L  
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFL---------LNGYQKEINLDN 455

Query: 349 SIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDD---------------------- 386
            I          G +  + N F K+  KL  +  I ++                      
Sbjct: 456 PI----------GYQGNVANAFGKLIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGY 505

Query: 387 ---------QQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANA--------LQVNP 429
                    QQD+QEFL  +L  +HE+L N  + K + +  S   N+         ++  
Sbjct: 506 CNSMFSGYLQQDSQEFLAFILDGLHEDL-NRILKKPFVEKPSLPENSNYKDYKVIKKLAD 564

Query: 430 SKYEKWYERN--VITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSL 487
             +E   +RN  ++TD       ++ G  ++ L+C  C N S ++  +  L+L +P  ++
Sbjct: 565 DTWEAHLKRNDSIVTD-------LFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVETI 617

Query: 488 YS-----FTSKSRKIKLE 500
           ++     F S S    LE
Sbjct: 618 WNKVIKIFPSNSPPCSLE 635

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 493  KSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEI 535
            K + I L+DC+ LF+  E L   ++W CP C+     +K+ E+
Sbjct: 1066 KEKTILLDDCLRLFSKPEILGLQDSWYCPTCKDHRQATKQIEL 1108

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 88/395 (22%), Positives = 157/395 (39%), Gaps = 87/395 (22%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLF---K 355
           GL N   TCY N+ +Q +      +       Y   +   KY   +  S    VL    K
Sbjct: 352 GLLNHGVTCYQNAAVQAMLHIPALQ------HYLFDIAQGKYKDVISPSSVSQVLAETSK 405

Query: 356 KMY-LNGGRA----IIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           +M+ L  G++    I P + +   + +   +++ + Q+D+ E+ + +++R+ E       
Sbjct: 406 RMWSLENGKSKASYINPKKLIGRLEDINCMMSVWN-QEDSHEYFMSLISRLQE------- 457

Query: 411 VKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSY 470
                D V          P  ++       +T+ L  I  I+ G L+  +KC+ CG+ S 
Sbjct: 458 -----DSV----------PRGHK-------MTESL--IYDIFGGLLQQRVKCKSCGSVSI 493

Query: 471 SYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKS 530
           +    Y LSL +    L    +K     ++D I   TGD + S       P+     ++ 
Sbjct: 494 TEQPIYDLSLHLKGKKL----AKGDDSTVDDSI---TGDVKNSA-----APSGSTDGAEL 541

Query: 531 KKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFI 590
            K   + +K   +I  F                      T NA KRN            +
Sbjct: 542 PKRRYSIEK---SIRDFFNPELIKKVDNKEGYVCEKCKATTNAIKRNM----------IL 588

Query: 591 VLPPILVIHLSRFYYDLT--KKNSTVITYPLILNII---LKNGKV--IRYKLYGTVNHSG 643
             P  L++HL +F ++ T   K    ++YPL +++    ++  K   ++Y+L   V H G
Sbjct: 589 RAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLPVKYQLISVVVHEG 648

Query: 644 -NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            +L +GHY +   +            W T+DD+YI
Sbjct: 649 RSLSSGHYIAHCKQPDG--------TWATYDDEYI 675

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 156/407 (38%), Gaps = 109/407 (26%)

Query: 293 SELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN---TNKYPKEVQLSRS 349
           S+L   GL N   TCY N+ +Q L      +          +LN     KY   +  +  
Sbjct: 380 SKLKPKGLLNHGVTCYTNAAVQALLHIPAMQH---------YLNDILAGKYSSTISSNSV 430

Query: 350 IYVLF---KKMYLNGGRA-----IIPNRFLKMCKKLRPDLNI---PDDQQDTQEFLLIVL 398
            +VL    ++M+ N G+      I P + +        D+N       Q+D+ E+ + ++
Sbjct: 431 SHVLAETSRRMWHNDGKKSGNSYINPKKLIARLD----DINCMMSEWQQEDSHEYFMSIM 486

Query: 399 ARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLEN 458
           +R+ E+    +V K +                          +T+ +  I  I+ G L+ 
Sbjct: 487 SRLQED----SVPKGHK-------------------------MTESI--IYDIFGGSLKQ 515

Query: 459 ILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAW 518
            + C+ CG  S +   FY LSL +          K +K   E+ +N     +E S   + 
Sbjct: 516 TVTCKSCGEVSTTEQPFYDLSLHL----------KGKKTD-ENTVN-----QEKSSSQS- 558

Query: 519 DCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNS 578
                + +DS++ +  I     + +I  F                      T NA KRNS
Sbjct: 559 ---ETKDSDSQTSRYSI-----EKSIRDFFNPELIKVDKEKKGYVCEKCHKTTNALKRNS 610

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILNII-----LKNGKVI 631
                      +  P  L++HL +F ++ T   K    ++YP+ L++       K    +
Sbjct: 611 ----------ILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPV 660

Query: 632 RYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           +Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 661 KYELLSVVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDEYI 699

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 92/439 (20%), Positives = 161/439 (36%), Gaps = 126/439 (28%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFK 355
            + GL N  +TCY++SI+QCL    LF DL +   +  +      P +  +S +I  +  
Sbjct: 135 GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQD-PMKC-MSCAIDNIIS 192

Query: 356 KMYLNGGRAIIPNRFLK--MCKKLRPDLNIPD-DQQDTQEFLLIVLARIHEELSNENVVK 412
           + Y  G +   PN  L   +    R + N+    QQD  EFL  +L ++H +     +  
Sbjct: 193 ETY--GNKKTTPNEGLVDILNCSWRVNKNLAGYTQQDAHEFLQFILNQMHNDYKLNEI-- 248

Query: 413 YYPDLVSYDANALQVNPSKYEKWYERNVITDGL---SPIDH-IYRGQLENILKCQRC-GN 467
                  +D N  ++N + ++     N   + L   + + H I++G L++I+ C  C   
Sbjct: 249 -------HDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPHTIFQGFLKSIISCSECKAQ 301

Query: 468 SSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITD 527
           S  +   +  LSL +             K  L +C+  F   E L  D  ++C  C    
Sbjct: 302 SQTTIDPYMDLSLDVKG-----------KSTLYECLESFHRTERLH-DFTYNCKKC---- 345

Query: 528 SKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSL 587
                                                       N  +  +++L+ +K  
Sbjct: 346 --------------------------------------------NKSQDANRQLSILK-- 359

Query: 588 DFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI-------------------IL 625
               L PI+VI L RF + +T  +  +   + +PL LN+                     
Sbjct: 360 ----LAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNEKTN 415

Query: 626 KNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN 685
           K+   + Y+L G V H G +  GHY +               VW  F+D  +        
Sbjct: 416 KSTPDMIYELTGIVTHRGTVNEGHYITYTKTADG--------VWYQFNDSVV-------- 459

Query: 686 NFEAGKTEMSSDEVYVLFY 704
             +    +M  ++ Y+L Y
Sbjct: 460 -MKVPLEQMLKEQAYLLIY 477

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 89/426 (20%), Positives = 154/426 (36%), Gaps = 130/426 (30%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFK 355
            + GL N  +TC+++SIIQ +     F +  L+ K+    +     K V  S ++  +  
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCV--SCALDEIAC 188

Query: 356 KMYLNG---GRAIIPNRFLKMCKKLRPDLN---IPDDQQDTQEFLLIVLARIHEELSNEN 409
             Y NG   G++   ++           +N   +   QQD  E+   +L ++H + +   
Sbjct: 189 DFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHTDHARVF 248

Query: 410 VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDH-IYRGQLENILKCQRCGNS 468
                PD                               I H I++G L+N L+C +CG S
Sbjct: 249 GSSKAPDC----------------------------QCITHRIFQGYLKNTLQCSQCGFS 280

Query: 469 SYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDS 528
             +      LSL I               KLEDC++ F  +E L+ D  ++C +C+    
Sbjct: 281 KTTIDPIMDLSLEI-----------KNNPKLEDCLDHFQREETLT-DFHYECQSCK---- 324

Query: 529 KSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLD 588
                     + +  +                                  K+LT  K+  
Sbjct: 325 ----------QNQGVV----------------------------------KQLTLHKA-- 338

Query: 589 FIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNIILKNGKV-------IRYKLYGT 638
               P +LVI L RF + L  +++ +   + +PL LN+     ++       I Y L   
Sbjct: 339 ----PNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNV 394

Query: 639 VNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDE 698
           V+H G +  GHYT+V   E           W  F+D  +             + ++   +
Sbjct: 395 VSHQGTVDQGHYTTVSKTEDGQ--------WFKFNDSVVT---------SVTEEQVLEQQ 437

Query: 699 VYVLFY 704
            Y+LFY
Sbjct: 438 AYLLFY 443

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 137/367 (37%), Gaps = 105/367 (28%)

Query: 348 RSIY-VLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELS 406
           R I+  + +  YL G   + P+ F+ + K+     N     QD  EF   +L  + E + 
Sbjct: 394 RDIFECITENTYLTG--VVSPSSFVDVLKRENVLFNT-TMHQDAHEFFNFLLNELSEYIE 450

Query: 407 NENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCG 466
            EN       + + D N+    PSK      +N I+D       +++G L N +KC  C 
Sbjct: 451 REN-----KKIAASDINS-DSEPSK-----SKNFISD-------LFQGTLTNQIKCLTCD 492

Query: 467 NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRIT 526
           N         + S   P L          +  +++ +  +   E L+G N + C  C   
Sbjct: 493 N---------ITSRDEPFLDFPIEVQGDEETDIQEILKSYHQREMLNGSNKFYCDEC--- 540

Query: 527 DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKS 586
                                                            + +++L  +K 
Sbjct: 541 ----------------------------------------------CGLQEAERLVGLKQ 554

Query: 587 LDFIVLPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILK-NGKVI-RYKLYGTV 639
           L     P  L +HL RF Y   K+N  +     I YPL LN+    N KV  +Y+L G V
Sbjct: 555 L-----PDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIV 608

Query: 640 NH-SGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSD 697
            H  G   +GHY S+   EK    G     W+ FDD+ ++  +++    F      M++ 
Sbjct: 609 VHMGGGPQHGHYVSLCKHEK---FG-----WLLFDDETVEAVKEETVLEFTGESPNMAT- 659

Query: 698 EVYVLFY 704
             YVLFY
Sbjct: 660 -AYVLFY 665

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRD--LFLTKKYR 332
           + G +N  NTCY NS++QCL+  +  R+  L   KK R
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSR 176

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 81/375 (21%), Positives = 141/375 (37%), Gaps = 78/375 (20%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
           TGL NP N C+INS IQ L          LT      L   K    + L   +  +  ++
Sbjct: 76  TGLVNPGNDCFINSSIQALVPLDK-----LTTYLSATLEDEKTASTLPLHNGLATMLLEL 130

Query: 358 --YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYP 415
               +  +++   RF++  + +     I   Q D  EF  ++L R++EE    N+   + 
Sbjct: 131 QQLRSDPKSVSSKRFIQQLETIFGG-KISRQQNDAHEFTQLILERLNEE----NLTLDHA 185

Query: 416 DLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSY-SYST 474
           DL                             P    ++G + N L C +CG +S+ +   
Sbjct: 186 DLTV---------------------------P----FKGIVGNHLVCLQCGRTSHVNEQP 214

Query: 475 FYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR----ITDSKS 530
           FY+  L +P+            +KL D +N     E++     + C  C+    +T+ + 
Sbjct: 215 FYIYELTLPQ---------QGSVKLSDLVN----GEQMETIENYSCMYCKTVAMLTNERE 261

Query: 531 KKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSL--- 587
           +K  ++    +  I  F                        N+  +     + IKS+   
Sbjct: 262 EKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHYI--NSYNKGYCNTSEIKSVIVR 319

Query: 588 --DFIVLPPILVIHLSRFYYDLT--KKNSTVITYP---LILNIILKNGK-----VIRYKL 635
              F   P I +IHLSR  ++     +N   + +    L+   ILK+ +      ++YKL
Sbjct: 320 KSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFETVKYKL 379

Query: 636 YGTVNHSGNLINGHY 650
              V H+G+   GHY
Sbjct: 380 KSIVKHTGSHYQGHY 394

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 60/122 (49%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILK-NGKVI-RYKLYGTVNH-SG 643
           LP  L +HL RF Y   K+N  +     I YPL LN+    N +V  +Y+L G V H  G
Sbjct: 558 LPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGG 616

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVL 702
              +GHY S+   EK    G     W+ FDD+ ++  +++    F      M++   YVL
Sbjct: 617 GPQHGHYVSLCKHEK---FG-----WLLFDDETVEAVKEETVLEFTGESPNMAT--AYVL 666

Query: 703 FY 704
           FY
Sbjct: 667 FY 668

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           + G +N  NTCY NS++QCL+  +  R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 170

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 60/122 (49%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILK-NGKVI-RYKLYGTVNH-SG 643
           LP  L +HL RF Y   K+N  +     I YPL LN+    N +V  +Y+L G V H  G
Sbjct: 555 LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGG 613

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVL 702
              +GHY S+   +K    G     W+ FDD+ ++  +++    F      M++   YVL
Sbjct: 614 GPQHGHYVSLCKHQK---FG-----WLLFDDETVEAVKEETVLEFTGESANMAT--AYVL 663

Query: 703 FY 704
           FY
Sbjct: 664 FY 665

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           + G +N  NTCY NS++QCL+  +  R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 144/384 (37%), Gaps = 83/384 (21%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL--FLNTN--------KYPKEVQLS 347
           TGL N  N C+INS +Q L G+  F   +L    R   FLN N          P    ++
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRFNH-YLNSVLRCLKFLNENPKQEGNRYALPLHQVMA 127

Query: 348 RSIYVLFKKMYLN----GGRAIIPNRFL---KMCKKLRPDLNIPDDQQDTQEFLLIVLAR 400
             IY L    +LN      + I+    +   KM ++          Q D QEF  ++L  
Sbjct: 128 EFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRR----------QNDAQEFTQLLLEV 177

Query: 401 IHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460
           +H E         Y +L+                    N IT+ L    + + G+  + L
Sbjct: 178 LHNE---------YQELIRL-----------------MNFITNNLDIPTYPFEGKYCHEL 211

Query: 461 KCQRCG-NSSYSYSTFYVLSL---AIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDN 516
            C +CG NS      F +L+L   A P +SL    S S    +E           + G  
Sbjct: 212 TCLKCGRNSEVKMFDFDILTLNLPAQPSISLDELISGSNSDVIEGFSCTVCKVSAILGGT 271

Query: 517 AWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKR 576
               PN R +  KS KE     K  + +                         T+N K  
Sbjct: 272 GTHNPNTR-SLIKSLKEIFPELKINTEL--------DEPLNSFVDSYSHDGVITRNIKS- 321

Query: 577 NSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITY--PLIL--NIILKNGKV 630
                T +K   F+ +P IL+IHL+R  ++     +N+  I Y   L+L   +++    V
Sbjct: 322 -----TIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMDGVSV 376

Query: 631 IR----YKLYGTVNHSGNLINGHY 650
           +R    Y L   + HSG+   GHY
Sbjct: 377 MRNNIQYTLSSAIKHSGSHSMGHY 400

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 60/122 (49%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILK-NGKVI-RYKLYGTVNH-SG 643
           LP  L +HL RF Y   K+N  +     I YPL LN+    N +V  +Y+L G V H  G
Sbjct: 557 LPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGG 615

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVL 702
              +GHY S+      HEI      W+ FDD+ ++  +++    F      M++   YVL
Sbjct: 616 GPQHGHYVSLC----KHEIF----GWLLFDDETVEAVKEEAVLEFTGESPNMAT--AYVL 665

Query: 703 FY 704
           FY
Sbjct: 666 FY 667

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           + G +N  NTCY NS++QCL+  +  R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 25/129 (19%)

Query: 584 IKSLDFIVLPPILVIHLSRFYYDLTKKN---STVITYPLILNI-----ILKNGKVIRYKL 635
           IK L    LPP+LV+ L RF +    +N   +  I +P  LN+       +N   I Y+L
Sbjct: 323 IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 636 YGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMS 695
            G ++H G +  GHY +         + L+   W  F+D  +             + E+ 
Sbjct: 383 NGVISHIGTVNEGHYIAT--------LKLDSNNWFKFNDSMVT---------SISEEEVL 425

Query: 696 SDEVYVLFY 704
            D+ Y+LFY
Sbjct: 426 KDQAYLLFY 434

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 97/236 (41%), Gaps = 38/236 (16%)

Query: 451 IYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510
           I+ G LE ++ C+ CG+ S +   FY LSL +             K K  + ++    D+
Sbjct: 418 IFGGVLEQVVTCKSCGSISKTEQPFYDLSLHL-----------RAKKKQSNGVDSSQNDQ 466

Query: 511 ELSGDNAWDCPNCRITDSKSKKEEITSQK--KKSTIFGFXXXXXXXXXXXXXXXXXXXXX 568
             + D+       +    + +++E  S+K   + +I  F                     
Sbjct: 467 NSNNDSQQPLQQQQQQLQQQQQQEQNSRKFSIEKSISDFFSPELIKVDKEQKGYVCERCH 526

Query: 569 XTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITYPLILNII-- 624
            T NA K NS           +  P  L++HL +F ++ T   K    ++YP+ L++   
Sbjct: 527 MTTNAIKHNS----------ILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTDY 576

Query: 625 LKNGK--VIRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
              GK   ++Y+L   V H G +L +GHY     + + H        W T+DD+YI
Sbjct: 577 CVEGKELPLKYQLITVVVHEGRSLSSGHYIVHCKQPEGH--------WATYDDEYI 624

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 16/102 (15%)

Query: 584 IKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI--ILKNGK---VIRYKL 635
           IK L    L P LV+ L RF +  + +N  +   + +PL L++      G+    I Y+L
Sbjct: 339 IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 636 YGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            G V+HSG +  GHYT+V+         LN   W  F+D  I
Sbjct: 399 SGVVSHSGTVNEGHYTAVLQ--------LNSGEWFKFNDSMI 432

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 6/102 (5%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           G+ N  NTCY+N+ +Q L+G    R+  L    +           VQL R I   F+K+ 
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRKLR 120

Query: 359 LNGGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
              G AI P   L++ +++ P  +  D       QQD +E  
Sbjct: 121 DKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELF 162

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 85/423 (20%), Positives = 162/423 (38%), Gaps = 89/423 (21%)

Query: 284 VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE 343
           +I++   +LS L   GL N   TCY N+ +Q +      +       + +  N   Y  +
Sbjct: 289 IIKNWGPILSGLKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYL----FDILRNNKDYITD 344

Query: 344 VQLSRSI-YVLF---KKMYLNGGRA--------IIPNRFLKMCKKLRPDLNIPDDQQDTQ 391
           +    S+ Y+L    KKM+    +         I P + +   +++   ++    Q+D+ 
Sbjct: 345 IIKPNSVSYILSQTSKKMWWKDSKKTSKTSANYIDPKKLIAALEQINCMMS-EWQQEDSH 403

Query: 392 EFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHI 451
           E+ + +++R+ E+                       +  K +K  E ++I D       I
Sbjct: 404 EYFMSLMSRLQED-----------------------SVPKGKKMTE-SIIYD-------I 432

Query: 452 YRGQLENILKCQRCGNSSYSYSTFYVLSLAIP-KLSLYSFTSKSRKI---------KLED 501
           + G L+  + C+ CG  S +   FY LSL +  K + +   S              K+E+
Sbjct: 433 FGGLLKQEVTCKSCGEISKTEQPFYDLSLHLKGKHNRHQTNSTDSATTNYPAGNSNKIEE 492

Query: 502 CINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXX 561
                   + ++  N    P   I D+ + +  I     + +I  F              
Sbjct: 493 SSTKEGAADSVNNANNQLNPENGIQDASTSRFSI-----EKSIGDFFNPELIKMDKEKKG 547

Query: 562 XXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD--LTKKNSTVITYPL 619
                   T NA KRN+           +  P  L++HL +F ++   + K    ++YP+
Sbjct: 548 YVCEKCKKTTNAVKRNT----------ILRAPETLLVHLKKFRFNGQSSSKMKQAVSYPM 597

Query: 620 ILNII-----LKNGKVIRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFD 673
            L++       K+  ++ Y+L   V H G +L +GHY +   +            W T+D
Sbjct: 598 FLDLTSYCDKTKSKLLVMYQLISVVVHEGRSLSSGHYIAHCKQPDG--------TWATYD 649

Query: 674 DDY 676
           D+Y
Sbjct: 650 DEY 652

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 95/407 (23%), Positives = 142/407 (34%), Gaps = 127/407 (31%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTTLF-RDLFLTKKYR-LFLNTNKYPKEVQLSRSIYVL 353
            ++GL N  +TCY++ IIQCL     F +  F    Y+   +          L   ++ L
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDPVSCLSCALDSVVFEL 194

Query: 354 FKKMY------LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELS- 406
           + K         NGG   I N       K+  DL +   QQD  EF   ++ RIH E   
Sbjct: 195 YGKTQKKAVDDKNGGLIDILNCTW----KINEDL-VGYSQQDAHEFWQFLMNRIHSEYKL 249

Query: 407 NENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCG 466
           N N ++   D         Q+    Y K                +++G LE+ ++C  C 
Sbjct: 250 NNNTIEVPKD-------THQLCNCIYHK----------------VFQGFLESTIECANCR 286

Query: 467 NSSYSYSTFYV-LSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRI 525
             S + +  Y+ LSL +          K +K  L +C+N F   EEL  D  + C NC  
Sbjct: 287 KESKTTTEAYMDLSLDL----------KDKKT-LYECLNSFHMKEELK-DFTFHCSNC-- 332

Query: 526 TDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIK 585
                                                             + + K  TI 
Sbjct: 333 -----------------------------------------------GGPQGALKQLTIS 345

Query: 586 SLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLIL------------NIILKNGKV 630
            L     PP+L++ L RF + L  ++S +   I YP  L             I   +   
Sbjct: 346 KL-----PPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPDDSD 400

Query: 631 IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           I Y+L G + H+G +  GHY             L    WV F+D  I
Sbjct: 401 IIYELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMI 439

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 62/129 (48%), Gaps = 20/129 (15%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNGKVIRYKLYG 637
           +S+    LP  L +HL RF Y  T KNS +     + YPL L++     N    +Y+L G
Sbjct: 604 RSVGLKQLPHTLALHLKRFKYSET-KNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSG 662

Query: 638 TVNH-SGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQ-HRKDRNNFEAGKTEMS 695
            V H  G   +GHY S+    K+   G     W+ FDD+ ++    K   +F    + ++
Sbjct: 663 IVVHMGGGPQHGHYVSLC---KNDNFG-----WLLFDDETVESVSEKTVLDFVGDSSTLT 714

Query: 696 SDEVYVLFY 704
           +   YVLFY
Sbjct: 715 T--AYVLFY 721

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 281 NLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYR 332
           N+P  + SN +       G +N  NTCY NS++QCL+  T FR   L    R
Sbjct: 120 NMPYGDGSNKVF------GFENFGNTCYCNSVLQCLYNMTEFRIQMLQHPER 165

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 28/143 (19%)

Query: 572 NAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDL---TKKNSTVITYPLILNI--ILK 626
           + +K N+K+   I+ L    LPP+LV+ L RF + +   + K +  I +P  L++    +
Sbjct: 324 HCEKCNTKQ-NAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQ 382

Query: 627 NGKV-----IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHR 681
             KV     I Y+L G ++H G++  GHYTS+               W  F+D  +    
Sbjct: 383 TDKVGETPAIVYELIGLISHQGSVNQGHYTSICKIPGGQ--------WFKFNDSMVT--- 431

Query: 682 KDRNNFEAGKTEMSSDEVYVLFY 704
                    + ++  ++ Y+LFY
Sbjct: 432 ------AVAEIDVLKEQAYLLFY 448

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 63/148 (42%), Gaps = 30/148 (20%)

Query: 259 VEKPKEEEGKIE--AIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCL 316
           + KPK++   IE  A +    K  +LP+              G QN  NTCY+NS +Q L
Sbjct: 82  ISKPKKQSSFIEDLAPDQQMQKLNDLPI--------------GFQNMGNTCYMNSTLQAL 127

Query: 317 FGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY--LNGG--RAIIPNRFLK 372
           F   + +D+ L  K       N    E +L   I +  KK +  L+G   +A++P   L 
Sbjct: 128 FRVDVLKDMILNYKTE----GNNISPEDELHHKIVIELKKCFETLDGKKFKAVMPVVLLS 183

Query: 373 MCKKLRPDLNIPDD------QQDTQEFL 394
           + +K  P     D       QQD +E  
Sbjct: 184 VLRKCYPQFAERDSQSGFYKQQDAEELF 211

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 9/73 (12%)

Query: 633 YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
           Y L G + H G N  +GHY S +  E   +       W  F+DD + ++ KD+    AG 
Sbjct: 436 YDLIGIITHQGANSESGHYQSFIRDENDED------KWYKFNDDKVSEYEKDKIEQLAGG 489

Query: 692 TEMSSDEVYVLFY 704
            E  SD   +L Y
Sbjct: 490 GE--SDSALILIY 500

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 48/95 (50%), Gaps = 17/95 (17%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYGTVNH-SG 643
           LP IL +HL RF Y    +N+ +     ITYPL L +  K    +  +Y+L G V H  G
Sbjct: 548 LPRILALHLKRFKYS-EAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGG 606

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ 678
              +GHY SV    K+   G     W+ FDD+ ++
Sbjct: 607 GPQHGHYVSVC---KTDNFG-----WLFFDDETVE 633

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 7/52 (13%)

Query: 277 PK-AYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           PK A  +P  + SN       I G +N  NTCY NSI+QCLF  T FR+  L
Sbjct: 98  PKVAVGMPFGDGSN------KIFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 29/143 (20%)

Query: 573 AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI------ 623
            KK  S K   I+ L    LPP+L++ L RF + +   +  +   I++PL LN+      
Sbjct: 339 CKKCKSTK-NPIRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKP 397

Query: 624 --ILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHR 681
              L     + YKL   ++H G +  GHYT++          +N  +W  F+D  +    
Sbjct: 398 VDCLHPVPNMMYKLSAIISHHGTVHQGHYTTICR--------INGDIWAKFNDSMVT--- 446

Query: 682 KDRNNFEAGKTEMSSDEVYVLFY 704
                    + +M  ++ Y+L+Y
Sbjct: 447 ------VISEEDMLKEQAYLLYY 463

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
           (REAL)
          Length = 763

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 93/427 (21%), Positives = 163/427 (38%), Gaps = 93/427 (21%)

Query: 284 VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE 343
           +I++  +  + L   GL N   TCY N+ +Q +      +       Y   +   KY   
Sbjct: 319 IIKNWGNQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQ------HYLFDILLGKYDSS 372

Query: 344 VQLSRSIYVLF---KKMYL----NGGRAII-----PNRFLKMCKKLRPDLNI---PDDQQ 388
           +  S   Y L    KKM+L    N  ++I      PN  +        D+N       Q+
Sbjct: 373 ISKSSVSYTLAETSKKMWLPVSKNPRKSISASYINPNHLISRLD----DINCMMSEWQQE 428

Query: 389 DTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPI 448
           D+ E+ + +++R+ E+    +V K +  + S                    +I D     
Sbjct: 429 DSHEYFMSLMSRLQED----SVPKGHKLIES--------------------IIYD----- 459

Query: 449 DHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAI---------PKLS-LYSFTSKSRKIK 498
             I+ G L+ I+ C+ CG+ S +   FY LSL +         P  S  Y+ ++ S    
Sbjct: 460 --IFGGLLKQIVTCKSCGSISKTEQPFYDLSLHLKGKKKLDSNPDSSGEYNNSASSTNST 517

Query: 499 LEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXX 558
                         S +  +D P+  I++  S     + +K   +I  F           
Sbjct: 518 TTKSSTTQLLSSSKSANLNYDTPDVSISNLSSLNRRFSIEK---SIRDFFNPELIKVDKE 574

Query: 559 XXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVIT 616
                      T NA K NS           +  P  L++HL +F ++ T   K    ++
Sbjct: 575 QKGYVCEKCHKTTNAVKHNS----------ILRAPETLLVHLKKFRFNGTSSSKMKQAVS 624

Query: 617 YPLILNII--LKNGKV-IRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTF 672
           YP+ L++    +N  + ++Y+L   V H G +L +GHY +   +            W T+
Sbjct: 625 YPMFLDLTEYCENKDLPVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGS--------WATY 676

Query: 673 DDDYIQQ 679
           DD+YI +
Sbjct: 677 DDEYINK 683

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 17/108 (15%)

Query: 579 KKLT-TIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITYPLILNIILKNGKVI---- 631
           KK+T  +KS   I  P  LV+HL +F ++ T   K    ++YP+ L++     + I    
Sbjct: 577 KKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLP 636

Query: 632 -RYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            RY+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 637 VRYQLISVVVHEGRSLSSGHYIAHCKQPDG--------SWATYDDEYI 676

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 60/139 (43%), Gaps = 27/139 (19%)

Query: 576 RNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKN---STVITYPLILNI-------IL 625
           R +  L  IK      LPP+LV+ L RF + +   N   +  + YPL LN+         
Sbjct: 339 RCNTSLDPIKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTN 398

Query: 626 KNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN 685
           +    I Y+L G ++H G++  GHY  V+         +N   W  F+D  I   ++D  
Sbjct: 399 QETPDIIYELTGILSHIGSINEGHYVVVLK--------INDGRWFKFNDSMISVIKED-- 448

Query: 686 NFEAGKTEMSSDEVYVLFY 704
                  E    + Y+LFY
Sbjct: 449 -------EALKQQAYLLFY 460

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 96/430 (22%), Positives = 166/430 (38%), Gaps = 101/430 (23%)

Query: 273 ESSAPKAYNLP--VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRD-LF--L 327
           E+ A +  NLP  +I++     +     GL N   TCY N+ +Q +      +  LF  L
Sbjct: 379 ETIADQGSNLPSRIIKNWGPEFANRKPKGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDIL 438

Query: 328 TKKYRLFLNTNKYPKEV-----QLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLN 382
             KY+  ++    PK V     + S  ++ L  K   N G  I P + +   + +   ++
Sbjct: 439 RGKYKETIS----PKSVSVMLAETSLRMWALQDKKKKNLGY-INPKKLIASLETINCMMS 493

Query: 383 IPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVIT 442
               Q+D+ E+ + +++R+ E+                      V P         + +T
Sbjct: 494 -EWQQEDSHEYFMSLMSRLQED---------------------SVPPG--------HKMT 523

Query: 443 DGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDC 502
           + +  I  I+ G L+ I+ C+ CG  S +   FY LSL +          K     + D 
Sbjct: 524 ESM--IYDIFGGLLKQIVTCKSCGGVSTTEQPFYDLSLHL--------KGKKNTTTVTDA 573

Query: 503 INLFTGDEEL---SGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXX 559
                G+E+    S DN  D          SK+  I     + +I  F            
Sbjct: 574 ----DGNEKTQHESKDNNDDASQL------SKRFSI-----EKSIKDFFNPELIRVDKEK 618

Query: 560 XXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITY 617
                     T NA KR+S           +  P  L++HL +F ++ T   K    ++Y
Sbjct: 619 KGYVCEKCHKTTNATKRSS----------ILRAPETLLVHLKKFRFNGTTSSKMKQAVSY 668

Query: 618 PLILNII----LKNGK---VIRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVW 669
           P+ L++       +G     ++Y+L   V H G +L +GHY +   +            W
Sbjct: 669 PMYLDMTEYCETPSGTKQLPVKYELLSVVVHEGRSLSSGHYIAHCRQPDGS--------W 720

Query: 670 VTFDDDYIQQ 679
            T+DD+YI +
Sbjct: 721 ATYDDEYINK 730

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 137/366 (37%), Gaps = 61/366 (16%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKK 356
           I GL N  NTC++NS++Q L  +      FL          N   K  +  R + ++  K
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELA-AFLDNVIENGSENNGDIKFTETLRELLLILNK 115

Query: 357 MYLNGGRAIIPNRFLK-MCKKLRPDLNIPDDQQDTQEFLLIVLARIH-----------EE 404
            Y         N+ LK M      ++ +  DQ+D QEF   +L+ +            EE
Sbjct: 116 KYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEKKEE 175

Query: 405 LSN-----------------ENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSP 447
            +N                  NV   Y      + N++  NP   +K Y    +   ++P
Sbjct: 176 RNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPD--QKLYSPFKL---ITP 230

Query: 448 IDHIYRGQLENILKCQRCG-NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLF 506
           +D I   ++     C  CG N    YS F  LSL +P  SL   T     +KL + +N +
Sbjct: 231 LDGITAERI----GCLTCGENGGIRYSVFSGLSLNLPSESLNQST-----LKLSELLNEW 281

Query: 507 TGDEELSGDNAWDCPNCRITDSKSK-----KEEITSQKKKSTIFGFXXXXXXXXXXXXXX 561
              E + G    +C  C +   +S      + +   +K K  I                 
Sbjct: 282 VKPEIIEG---VECNRCSLNAVRSHLQDQIQNDTIPEKLKIAINQRLNLLTEILSKPVIE 338

Query: 562 XXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNSTVITY 617
                   T+N  ++ SK    + S      PP L IH++R  +D    + +KN+  + +
Sbjct: 339 EDDYKKYHTENMVRKCSKSKQILISRP----PPFLSIHINRSVFDPRTYMIRKNNARVLF 394

Query: 618 PLILNI 623
              LN+
Sbjct: 395 KTRLNL 400

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 90/413 (21%), Positives = 152/413 (36%), Gaps = 115/413 (27%)

Query: 284 VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE 343
           ++++    LS+L   GL N   TCY N+ +Q +      +  +L    R    T   P+ 
Sbjct: 348 IVKNWGPQLSQLKPKGLLNHGVTCYTNAAVQAMLHIPSIQH-YLFDVLRGDHKTTISPQS 406

Query: 344 VQLSRSIYVLFKKMYL---NGGRAIIPNRFLKMCKKLRPDLNI---PDDQQDTQEFLLIV 397
           V  ++ +    K+M+    N    I P + +        D+N       Q+D+ E+ + +
Sbjct: 407 V--TQVLAETSKRMWSPEPNKNTYINPKKLIGRLD----DINCMMSEWQQEDSHEYFMSL 460

Query: 398 LARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLE 457
           ++R+ E+                       +  +  K  E ++I D       I+ G L 
Sbjct: 461 MSRLQED-----------------------SVPRGHKLTE-SIIYD-------IFGGLLH 489

Query: 458 NILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNA 517
             + C+ CG  S +   FY LSL +          K +K             +E   +N 
Sbjct: 490 QKVTCKSCGGVSKTEQPFYDLSLHL----------KGKK-----------KSDETVPENQ 528

Query: 518 WDCPNCRITDSKS-----KKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKN 572
            D P  R +  KS       E I   KK   +                         T N
Sbjct: 529 EDVPQRRYSIEKSISDFFNPELIKVDKKDGYVC-------------------EKCHKTTN 569

Query: 573 AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILNII-----L 625
           A KRNS           +  P  L+IHL +F ++ T   K    ++YP+ L++       
Sbjct: 570 AIKRNS----------ILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDMSEYCEDQ 619

Query: 626 KNGKVIRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           +    ++Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 620 QKTLPVKYQLISVVVHEGRSLSSGHYIAHCKQPDG--------SWATYDDEYI 664

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 17/107 (15%)

Query: 580 KLTTIKSLDFIV-LPPILVIHLSRFYYDLTKKNS--TVITYPLILNI--ILKNGKV---I 631
           K T     +FI+  P  L++HL +F ++ T  +     ++YP+ L++    +N K    +
Sbjct: 587 KTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDVTEFCENSKTTLPV 646

Query: 632 RYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           +Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 647 KYQLISVVVHEGRSLTSGHYIAHCKQPDG--------SWSTYDDEYI 685

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 56/125 (44%), Gaps = 14/125 (11%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD--LTKKNSTVITYPLILNI--ILKNGKVIRYKLYGTVN 640
           K++ F  LP  L +HL RF  D  +  K    I YPL L +     N     Y+L G V 
Sbjct: 531 KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 641 HSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEV 699
           H G +  +GHY S+   EK          W+ +DD+ I+   ++      G+   +    
Sbjct: 591 HVGASPTHGHYVSICKHEK--------YGWLMYDDETIESIPEEAVTSHVGEPN-NPITA 641

Query: 700 YVLFY 704
           YVLFY
Sbjct: 642 YVLFY 646

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 99/244 (40%), Gaps = 33/244 (13%)

Query: 451 IYRGQLENILKCQRCGNSSYSYSTFYVLSLAIP-KLSLYS----FTSKSRKIKLEDCINL 505
           I+ G L+ ++ C+ CG  S +   FY LSL +  K  L+S      + +  +   D  N 
Sbjct: 569 IFGGLLKQLVTCKSCGEVSKTEQPFYDLSLHLKGKRKLHSSEENVGTTTNALADTDSSNA 628

Query: 506 FTGDEELSGDNAWDCPNCRITDSKSKKEEITSQ-KKKSTIFGFXXXXXXXXXXXXXXXXX 564
               + L  ++           S + +E +T +   + +I  F                 
Sbjct: 629 KQTQDNLVANSISSKTTSDTNTSFASQEGLTRRFSIEKSIRDFFNPELIKVDKEKKGYVC 688

Query: 565 XXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILN 622
                T NA KR++           +  P  L+IHL +F ++ T   K    ++YP+ L+
Sbjct: 689 EKCNKTTNATKRST----------ILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLD 738

Query: 623 I--ILKNGK----VIRYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDD 675
           +    + GK     ++Y+L   V H G +L +GHY +   +            W T+DD+
Sbjct: 739 LTEFCEAGKDSILPVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDE 790

Query: 676 YIQQ 679
           YI +
Sbjct: 791 YINK 794

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (46%), Gaps = 23/135 (17%)

Query: 578 SKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNGKV 630
           +++L  +KSL     P  L +HL RF Y   +KN+ V     I YPLILN      +   
Sbjct: 555 AERLVGLKSL-----PKTLSLHLKRFKYS-EEKNANVKLFNKIHYPLILNASSTFDSSVS 608

Query: 631 IRYKLYGTVNHSGNLI-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEA 689
             Y+L G V H GN   +GHY S+ + E     G     W+ FDD+ ++   +       
Sbjct: 609 KSYRLQGVVVHMGNGPHHGHYVSLCHTEL---FG-----WLLFDDETVESVDESYVLDFV 660

Query: 690 GKTEMSSDEVYVLFY 704
           G  E S    YVLFY
Sbjct: 661 GSHE-SPTTAYVLFY 674

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323
           LP  + SN +       G +N  NTCY NS++QCL+    FR
Sbjct: 151 LPFGDGSNKVF------GYENFGNTCYCNSVLQCLYHLPEFR 186

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 35/140 (25%)

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI-------------ILK 626
            IK L    LP +LV+ L RF + L   N  +   I +P  LN+              + 
Sbjct: 345 AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 627 NGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
           NGKV  I Y+L G V+H G +  GHY +           ++   W  F+D  +       
Sbjct: 405 NGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS------ 450

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
                 + E+  ++ Y+LFY
Sbjct: 451 ---SISQEEVLKEQAYLLFY 467

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 33/138 (23%)

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI-----------ILKNG 628
            IK L    LP +LV+ L RF + L   N  +   I +P  LN+             +NG
Sbjct: 345 AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENG 404

Query: 629 KV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNN 686
           KV  I Y+L G V+H G +  GHY +           ++   W  F+D  +         
Sbjct: 405 KVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS-------- 448

Query: 687 FEAGKTEMSSDEVYVLFY 704
               + E+  ++ Y+LFY
Sbjct: 449 -SISQEEVLKEQAYLLFY 465

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 17/94 (18%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYGTVNH-SG 643
           LP  L++HL RF Y   ++NS +     I YPL+L +   +   I   Y L G V H  G
Sbjct: 520 LPETLILHLKRFKYS-EEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGG 578

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
              +GHY S+   EK          W+ FDD+ +
Sbjct: 579 GPQHGHYVSICKNEKYG--------WLLFDDEVV 604

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKY 340
           + G +N  NTCY NS++QCL+     RD  +  KY +  N  K+
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRDNVI--KYPMVPNEQKF 152

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 57/138 (41%), Gaps = 33/138 (23%)

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI-----------ILKNG 628
            IK L    LP +LV+ L RF + L   N  +   I +P  LN+              NG
Sbjct: 345 AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 629 KV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNN 686
           KV  I Y+L G V+H G +  GHY +           ++   W  F+D  +         
Sbjct: 405 KVPDIIYELIGIVSHRGTVNEGHYIAFCK--------ISGGQWFKFNDSVVT-------- 448

Query: 687 FEAGKTEMSSDEVYVLFY 704
               + E+  ++ Y+LFY
Sbjct: 449 -SIAQGEVLKEQAYLLFY 465

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 116/268 (43%), Gaps = 63/268 (23%)

Query: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKY- 340
           +P++E  + L      +GL N  +TC+++SI+QCL     F    +++     +++NK  
Sbjct: 127 VPIMERRDGL------SGLINMGSTCFMSSILQCLIHNPYFIRHSMSQ-----IHSNKCK 175

Query: 341 ---PKEVQLSRSIYVLFKKMY--LNGGR----AIIPNR-----FLKMCKKLRPDLNIPD- 385
              P +   S ++  + +++Y  LN  +    +   NR     +L  C   + + N+   
Sbjct: 176 VGSPDKC-FSCALDKIIQELYGVLNTDQPSPSSSATNRQTGFIYLLTCA-WKINQNLAGY 233

Query: 386 DQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGL 445
            QQD  EF   ++ +IH+  ++++     P+    D    +VN  + E            
Sbjct: 234 SQQDAHEFWQFIINQIHQSYTHDS-----PNAKEID----RVNNKRCE------------ 272

Query: 446 SPIDHIYRGQLENILKCQRCG-NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCIN 504
             +  ++ G LE+ + C  C  NS  +   F  LSL I          K +K KL +C++
Sbjct: 273 CIVHSVFEGSLESSIVCPGCQKNSKTTIDPFMDLSLDI----------KDKK-KLYECLD 321

Query: 505 LFTGDEELSGDNAWDCPNCRITDSKSKK 532
            F   E+L  D  + C  C  T    K+
Sbjct: 322 SFHKKEQLK-DFNYHCGECNSTQDAIKQ 348

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 28/141 (19%)

Query: 575 KRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI--ILKNGK 629
           K+   +   IK      LPP+LV+ L RF + ++  N  +   I +P IL++   LK+ +
Sbjct: 332 KKCQAQQNPIKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQ 391

Query: 630 ------VIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKD 683
                  I Y+L G ++H+G++  GHY +    E           W  F+D  + +    
Sbjct: 392 NPDEDPSILYELIGIISHTGSVNEGHYVAFCKIENGE--------WFKFNDSMVTK---- 439

Query: 684 RNNFEAGKTEMSSDEVYVLFY 704
                  + ++  ++ Y+LFY
Sbjct: 440 -----ILEKDVLKEQAYLLFY 455

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 75/196 (38%), Gaps = 39/196 (19%)

Query: 520 CPNCRITDSKSKKEEITSQ----KKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKK 575
           CP C++ DSK+ K+         K KS ++                        T+NA K
Sbjct: 292 CPECKM-DSKTTKDPFMDLSLDIKDKSNLYECLDSFHKMEQLHDFNYHCDRCNTTQNAIK 350

Query: 576 RNSKKLTTIKSLDFIVLPPILVIHLSRFYYDL---TKKNSTVITYPLILNI--ILKNGKV 630
           R          L    LP +LV+ L RF + L   + K + ++ +PL LN+        V
Sbjct: 351 R----------LIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDV 400

Query: 631 --IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFE 688
             I ++L G + H G +  GHY +       H        W  F+D  +           
Sbjct: 401 PDIIFELIGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVS---------S 443

Query: 689 AGKTEMSSDEVYVLFY 704
             + E+  ++ Y+LFY
Sbjct: 444 ITEEELLQEQAYLLFY 459

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 6/102 (5%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           G+ N  NTCY+N+ +Q LF     R+  L    +  +         QL R + V F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 359 LNGGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
              G  I P   L++ +++ P  +  D       QQD +E  
Sbjct: 163 DRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELF 204

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 633 YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
           Y L G + H G N  +GHY + +  +   +       W  FDDD +    K++    AG 
Sbjct: 415 YDLIGVITHQGANSESGHYQAFIRDDADEK-------WYRFDDDKVTAIEKEKIESLAGG 467

Query: 692 TEMSSDEVYVLFY 704
            E  SD   +L Y
Sbjct: 468 GE--SDSALILIY 478

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 20/106 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT----YPLILNII---------LKNGKVI 631
           K + F   PP+L + L RF YD        I     +P  +++          L N +  
Sbjct: 380 KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 632 RYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            Y L+G + H+G++  GHY +++    S E       W  FDDD +
Sbjct: 440 IYNLHGVLVHAGDISTGHYYTMIRPGVSDE-------WYRFDDDKV 478

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 25/111 (22%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILK------- 626
           K + F   PP+L + L RF YD     + K N       T+   P +   +LK       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 627 NGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           NG    Y L+G + HSG++  GHY +++        G+  Q W  FDD+ +
Sbjct: 442 NGNPYIYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 485

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 43/108 (39%), Gaps = 10/108 (9%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            G +N   TCY+NS++Q  F T  FR L            N  P  + L R+ Y L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVP--LALQRAFYQL---- 258

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL 405
                 + IP   L++ +    D      Q D QE   I++ R+   +
Sbjct: 259 ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 592 LPPILVIHLSRFYYDLTKKNS----TVITYPLILNIILKNGKVIR--YKLYGTVNHSGNL 645
           LP IL +HL RF Y   K  +      + YPL LN+       I   Y+L G V H G+ 
Sbjct: 645 LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 646 I-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSD-----EV 699
             +GHY S+   +K    G     W+ FDD+ ++         E+   E + D       
Sbjct: 705 PQHGHYVSLCKNDK---FG-----WLLFDDETVESVS------ESTVLEFTGDPNNQATA 750

Query: 700 YVLFY 704
           YVLFY
Sbjct: 751 YVLFY 755

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFR 323
           + G +N  NTCY NS++QCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 16/127 (12%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTK----KNSTVITYPLIL--NIILKNGKVIRYKLYGT 638
           ++++   LP  L++HL RF Y   +    K  + + YPLIL  N   K    I+Y+L G 
Sbjct: 511 RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 639 VNHSGNLIN-GHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSD 697
           V H G+    GHY ++   EK          W+ +DD+ ++   ++      G  E +  
Sbjct: 571 VIHVGDGPQMGHYVALCKTEKYG--------WLFYDDETVESVSEETVLKFIGD-EKTQS 621

Query: 698 EVYVLFY 704
             YVLFY
Sbjct: 622 TAYVLFY 628

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323
           LP  + SN +       G +N  NTCY NS++QCL+    FR
Sbjct: 116 LPFGDGSNKVF------GYENFGNTCYCNSVLQCLYNLPEFR 151

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 18/121 (14%)

Query: 592 LPPILVIHLSRFYYDLTKKNS----TVITYPLILNI--ILKNGKVIRYKLYGTVNHSGNL 645
           LP IL +HL RF Y   +K++      I YPL L++          +Y+L G V H G+ 
Sbjct: 552 LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 646 -INGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVLF 703
             +GHY  +   EK    G     W+ +DD+ ++  R++    F     + ++   YVLF
Sbjct: 612 PQHGHYVCICKNEK---FG-----WLLYDDETVESIREETVLQFTGHPGDQTT--AYVLF 661

Query: 704 Y 704
           Y
Sbjct: 662 Y 662

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 16/70 (22%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKK 356
           + G +N  NTCY NS++QCL+    FR            N  +YP++   +R      +K
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR-----------CNILQYPEKPATNR-----IRK 176

Query: 357 MYLNGGRAII 366
             L G +A I
Sbjct: 177 SDLKGSKARI 186

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 93/239 (38%), Gaps = 53/239 (22%)

Query: 299 GLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVL--F 354
           G  N  N+CY+NS++QCLF  G   +  L        F     YP      + I +L  F
Sbjct: 334 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAF 393

Query: 355 KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYY 414
           K    N    I P  F     +   +    ++QQD  EFL  +L ++ + L  ++     
Sbjct: 394 KLNPENYPEGIKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTLFKKD----- 447

Query: 415 PDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYST 474
                        NP                   ++I +  +E+ ++CQ CGN  YSY  
Sbjct: 448 ------------NNP-------------------NNIMKFIMEDKIQCQSCGNVKYSYEP 476

Query: 475 FYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKE 533
              + L +        T+  + + +E   N F G+     +  +DCP C+ T   +K++
Sbjct: 477 TEYIQLPL------DGTNNPQNL-VETLTNFFNGE-----NIDFDCPTCKKTVVATKRQ 523

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 53/132 (40%), Gaps = 29/132 (21%)

Query: 584 IKSLDFIVLPPILVIHLSRFYYDLTKKNSTV----ITYPLILNIILKNGKV-------IR 632
           IK +    LPP+LV+ L RF + L   NS      I YP  LN+     +        + 
Sbjct: 335 IKQMTIAKLPPVLVLQLKRFEH-LMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMM 393

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKT 692
           Y+L   ++H G++  GHYTS+               W  F+D  I             + 
Sbjct: 394 YELVAVISHEGSVNQGHYTSMCKIPGGQ--------WFRFNDSMI---------VSISEE 436

Query: 693 EMSSDEVYVLFY 704
           E    + Y+LFY
Sbjct: 437 EALRQQAYLLFY 448

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 57/121 (47%), Gaps = 18/121 (14%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNGKVIRYKLYGTVNH-SG 643
           LP  L +HL RF Y   ++N+ +     + YPL L++     +    +Y+L G V H  G
Sbjct: 541 LPHTLALHLKRFKYS-EEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGG 599

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLF 703
           +  +GHY S+   +K    G     W+ FDD+ ++    ++   E      +    YVLF
Sbjct: 600 SPQHGHYVSLCKNDK---FG-----WLLFDDETVES-VTEKTVLEFTGDSSNQATAYVLF 650

Query: 704 Y 704
           Y
Sbjct: 651 Y 651

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFR 323
           + G +N  NTCY NS++QCL+  T  R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 51/137 (37%), Gaps = 32/137 (23%)

Query: 387 QQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLS 446
           QQD  EFL  +L  + E L N          +S+ +N     P K       N + D   
Sbjct: 422 QQDAHEFLNFLLNELSEYLQNH---------ISHPSNKPTDIPFK-------NYVID--- 462

Query: 447 PIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLF 506
               +++G L N +KC  C N +     F    + +              I ++D +  +
Sbjct: 463 ----LFQGVLTNRIKCLTCDNITSRDEPFLDFPIGV---------KGDENIDIQDVLRCY 509

Query: 507 TGDEELSGDNAWDCPNC 523
              E L+G N + C  C
Sbjct: 510 HTREMLNGSNKFYCSQC 526

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYGTVNH-SG 643
           LP  L +HL RF Y   ++NS +     ++YPL L +       I   Y+L G V H  G
Sbjct: 566 LPKTLALHLKRFKYS-EQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGG 624

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQ-HRKDRNNFEAGKTEMSSDEVYVL 702
              +GHY S+   EK    G     W+ FDD+ ++    +    +   K  M++   YVL
Sbjct: 625 GPQHGHYISLCKNEK---FG-----WLLFDDETVEAISEQAVLQYTGDKDTMTT--AYVL 674

Query: 703 FY 704
           FY
Sbjct: 675 FY 676

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 26/166 (15%)

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDL 417
           YL G   + P+ F++M K+    L      QD  EFL+ +L  I + L  +N  K   + 
Sbjct: 412 YLTG--VVTPSAFIEMLKRENV-LFSSMMHQDAHEFLIFLLNEISDFLDKQN--KNALNS 466

Query: 418 VSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYV 477
             YD++  + N         +N ++D       I++G L N +KC  C N++     F  
Sbjct: 467 KIYDSSQGRRNSGTV-----KNFVSD-------IFQGTLTNRIKCLTCDNTTARDEPFLD 514

Query: 478 LSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNC 523
             + +          ++  I +++ +  F   E L G N + C  C
Sbjct: 515 FPIEV---------QENVDIDIQEILESFHQKEMLHGPNKFYCDEC 551

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           I G +N  NTCY NS++QCL+    FR+  L
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRNDML 179

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYGTVNH-SG 643
           LP IL +HL RF Y   K  S +     I YPL L +  K+  ++   Y+L G V H  G
Sbjct: 590 LPKILSLHLKRFKYS-EKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGG 648

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVL 702
              +GHY ++    K    G     W+ +DD+ ++   ++    F   + +M++   YVL
Sbjct: 649 GPQHGHYVAIC---KHDMFG-----WLLYDDETVESIDEETVFKFVGDEKDMTT--AYVL 698

Query: 703 FY 704
           F+
Sbjct: 699 FF 700

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFR 323
           + GL+N  NTCY NS++QCLF  +  R
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSELR 158

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 9/76 (11%)

Query: 448 IDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFT 507
           +  +++G + N +KC  C N + S   F  L  AIP        ++  ++ ++D ++ F 
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIP-------VNEDEEVNIQDMLSNFN 559

Query: 508 GDEELSGDNAWDCPNC 523
             E L+G N + C +C
Sbjct: 560 QREMLNGANKFYCDSC 575

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 57/138 (41%), Gaps = 33/138 (23%)

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNI-----------ILKNG 628
            IK L    LP +LV+ L RF + L   N  +   I +P  LN+            + N 
Sbjct: 345 AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 629 KV--IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNN 686
           KV  I Y+L G V+H G +  GHY +           ++   W  F+D  +         
Sbjct: 405 KVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS-------- 448

Query: 687 FEAGKTEMSSDEVYVLFY 704
               + E+  ++ Y+LFY
Sbjct: 449 -SISQEEVLKEQAYLLFY 465

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 14/107 (13%)

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILNIIL---KNGKVIRY 633
           K    +K    +  P  L++HL +F ++ T   K    ++YP+ L++          ++Y
Sbjct: 610 KTTNAVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKY 669

Query: 634 KLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQ 679
           +L   V H G +L +GHY +   +            W T+DD+YI +
Sbjct: 670 QLLSVVVHEGRSLSSGHYIAHCKQPDG--------TWATYDDEYINK 708

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 18/121 (14%)

Query: 592 LPPILVIHLSRFYYDLTKKNS----TVITYPLILNI--ILKNGKVIRYKLYGTVNHSGNL 645
           LP IL +HL RF Y   +K++      I YPL L++          +Y+L G V H G+ 
Sbjct: 554 LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 646 -INGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVLF 703
             +GHY  +   EK    G     W+ +DD+ ++  +++    F     + ++   YVLF
Sbjct: 614 PQHGHYVCICRNEK---FG-----WLLYDDETVESIKEETVLQFTGHPGDQTT--AYVLF 663

Query: 704 Y 704
           Y
Sbjct: 664 Y 664

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFR 323
           + G +N  NTCY NS++QCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 64/157 (40%), Gaps = 33/157 (21%)

Query: 259 VEKPKEEEGKIE--AIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCL 316
           + KPKE    IE  A E    K   +P+              GL N  NTCY+NS +Q L
Sbjct: 82  ISKPKESNKFIEDLAPEHQRQKFNQMPI--------------GLLNMGNTCYMNSTLQAL 127

Query: 317 FGTTLFRDLFLTKKYRLFLNTN-----KYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFL 371
           +     RD+ L  KY+   N        Y    +L R    L KK Y     +++P  FL
Sbjct: 128 YRVDGLRDMVL--KYKEQANVQPGDELHYKLISELKRCFENLQKKSY----ESVMPVVFL 181

Query: 372 KMCKKLRPDLNIPDD------QQDTQEFLLIVLARIH 402
            + +K  P     D+      QQD +E    + + ++
Sbjct: 182 NLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 14/107 (13%)

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILNIIL---KNGKVIRY 633
           K    +K    +  P  L++HL +F ++ T   K    ++YP+ L++          ++Y
Sbjct: 598 KTTNAVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKY 657

Query: 634 KLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQ 679
           +L   V H G +L +GHY +   +   +        W T+DD+YI +
Sbjct: 658 QLLSVVVHEGRSLSSGHYIAHCKQPDGN--------WATYDDEYINK 696

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 20/123 (16%)

Query: 589 FIVLPPILVIHLSRFYYD-----LTKKNS-----TVITYPLILNIILKNGKVIRYKLYGT 638
           F   PP+L + L RF YD     L K N        I     L+          Y L+G 
Sbjct: 377 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 639 VNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEA--GKTEMSS 696
           + HSG++  GHY +++  +           W  FDDD + +   D+  FE   GK ++  
Sbjct: 437 LVHSGDISTGHYYAMIQPDA-------HGSWYRFDDDRVIK-ATDKQVFEENFGKAKLPD 488

Query: 697 DEV 699
           DE+
Sbjct: 489 DEI 491

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT----YPLILNI--------ILKNGKVIR 632
           K + F   PPIL + L RF YD        I     +P  +++        + +N +  +
Sbjct: 384 KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           Y L+G + H+G++  GHY +++  +   +       W  FDD+ +
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDLQDQ-------WYRFDDEKV 481

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            G +N   TCY+NS++Q  F T  FR L     Y++    N+ P +     S+ +  ++ 
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV----YQI-PTENESPND-----SVPLALQRA 256

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
           +     + IP   L++ +    D      Q D QE   I++ R+
Sbjct: 257 FYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRL 300

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 19/110 (17%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNGKVIR- 632
           K + F   PP+L + L RF YD     L K N       ++   P + +  L+     + 
Sbjct: 380 KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRK 682
           YKL+G + H+G++  GHY +++      E       W  FDDD + +  K
Sbjct: 440 YKLHGVLVHTGDISTGHYYTLIKPSTKDE-------WYRFDDDRVWRATK 482

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 52/105 (49%), Gaps = 14/105 (13%)

Query: 579 KKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILNII--LKNGKV-IRY 633
           K    +K    +  P  L++HL +F ++ T   K    ++YP+ L++    ++ ++ ++Y
Sbjct: 615 KTTNAVKHSSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCESKELPVKY 674

Query: 634 KLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           +L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 675 QLLSVVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDEYI 711

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 293 SELSITGLQNPCNTCYINSIIQCLFGTTLFRDL 325
           SEL  TG+ N  NTCY+NS++Q  F  TLFR+ 
Sbjct: 753 SELWPTGINNIGNTCYLNSLLQYYFSITLFREF 785

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 86/378 (22%), Positives = 152/378 (40%), Gaps = 56/378 (14%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF---LNTNKYPKEVQLSRSIYVLF 354
           TGL N    CY NS +Q L   + F  ++L K   +F   L   K  K+ + +   Y L+
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELELKIEKVEKDAKEAFDTY-LY 123

Query: 355 KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDD---QQDTQEFLLIVLARIHEELSNENVV 411
           K         +IP  +  +C +L  DL    D   ++    F+ I+ A IH+ ++     
Sbjct: 124 K---------VIPVHY-ALC-QLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQ-- 170

Query: 412 KYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSY- 470
           +   +L       LQ      +K+  R  ++  +      + G+L + L C  CG +S  
Sbjct: 171 QDANELTQIVLEVLQNELESLKKYVNRMELSIEVPRFP--FEGKLASYLSCLNCGQTSIP 228

Query: 471 SYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKS 530
           + STF +L +  P+     ++++  +I   + I+  T          + C  C+ T++  
Sbjct: 229 NISTFNILPIQTPQ----EYSAELEEIIYGNQIDQITD---------YSCLVCQ-TNAIL 274

Query: 531 KKEEITSQKKKST----IFGFXXXXXXXXXXXXXXXXXXXXXX---TKNAKKRNSKKLTT 583
           K E+    K  +T    I  +                          K   K  + K T 
Sbjct: 275 KNEKTNGHKGNTTDEHEIVKYLEDVLPVLRINEELDSKTLNYIKYYNKYGMKSGNIKSTI 334

Query: 584 IKSLDFIVLPPILVIHLSRFYYD--LTKKNSTVITYPLILNIILKNG---------KVIR 632
           IK    I  P IL+IHLSR  Y+  +  +NS  + +   ++I  +           +++ 
Sbjct: 335 IKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIELVD 394

Query: 633 YKLYGTVNHSGNLINGHY 650
           Y+L   + H+G   +GHY
Sbjct: 395 YQLQSIIKHTGTHNSGHY 412

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 17/107 (15%)

Query: 580 KLTTIKSLDFIV-LPPILVIHLSRFYYDLTK--KNSTVITYPLILNII--LKNGKV---I 631
           K T     +F++  P  L++HL +F ++ T   K    ++YP+ L++    +N      +
Sbjct: 334 KTTNASKHNFLLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPV 393

Query: 632 RYKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           +Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 394 KYQLISVVVHEGRSLSSGHYIAHCKQPDG--------SWSTYDDEYI 432

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 89/231 (38%), Gaps = 30/231 (12%)

Query: 443 DGLSPIDHIYRGQLENILKCQRCGNSS-YSYSTFYVLSLAIPKLSLYSFTSKSRKIKLED 501
           +GL+      RG L + L C RCG SS  +   F + +L +P  +            L D
Sbjct: 244 EGLAVPAFPIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPNAT---------SADLRD 294

Query: 502 CINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXX 561
              LF    E   D  + C +C+I    + ++    Q   ST                  
Sbjct: 295 M--LFDNQTETIDD--YTCVSCQIRAILATEKNRGRQGVDSTELAIIEELARLAPSISIN 350

Query: 562 X------XXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNST 613
                          K+     + K T +K    +  P +L++HLSR  ++     KN+ 
Sbjct: 351 EDMPPHLAAYVSAYNKDHCITAALKSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTC 410

Query: 614 VITYP--LILN-IILKNGK-----VIRYKLYGTVNHSGNLINGHYTSVVNK 656
            +T+P  L++N  +L+N K      +RYKL   + H G    GHY    +K
Sbjct: 411 NVTFPEELVINEQLLENNKCVGVRAVRYKLCAMIKHIGTHSQGHYACFRHK 461

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 15/107 (14%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK-----YPKEVQLSRSIYVL 353
           GLQN  NTCY+N+ +Q LF     +DL L        N++      Y   ++L R+   L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 354 FKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
            K+ +    ++++P   L   +K  P     D       QQD +E  
Sbjct: 170 KKRSF----KSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELF 212

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 88/216 (40%), Gaps = 30/216 (13%)

Query: 452 YRGQLENILKCQRCGNSS-YSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510
           ++G L   L C RC NSS  +   F + SL +P++S  S         L+D +     D 
Sbjct: 269 FQGSLATNLICLRCNNSSKVNVHRFTMHSLPVPQMSSAS---------LKDMM----FDN 315

Query: 511 ELSGDNAWDCPNCRI----TDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXX 566
           +      + C +CR+     + + +     SQ++++ +                      
Sbjct: 316 QTETIEGYSCISCRLRAILNNERQRDYHNVSQEERAKLDDLAKLLPRICINDDLPEPLEL 375

Query: 567 XXXT--KNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYP--LI 620
              +  K+     S K   +K    +  P +L++HLSR  +D     KNS  + +P  LI
Sbjct: 376 YVKSYHKDGCHIPSLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLI 435

Query: 621 LNII-LKNGKVI-----RYKLYGTVNHSGNLINGHY 650
           LN   +K  + I     RYKL   + H+G    GHY
Sbjct: 436 LNEQEIKEDRCIAVHCVRYKLQAMIKHTGTHFQGHY 471

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 104/472 (22%), Positives = 165/472 (34%), Gaps = 96/472 (20%)

Query: 279 AYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCL----FGTTLFRD-LFLTKKYRL 333
            +     EDS++   +    GL NP N C+INS +Q L    + T    D L L      
Sbjct: 46  GFGAKFTEDSDNKRMDKYTPGLSNPANECFINSSLQALSSLDYLTAYLHDALLLLSPEEE 105

Query: 334 FLNTNKYPKEVQLSRSIYVLFKKM--YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQ 391
            +  N+    V L+RS+  +  ++       + +   +F++  +++     +   Q D  
Sbjct: 106 DVEKNE-GTGVLLTRSLSDIVGQLQTVTCAPQTLSNKQFVRSLERIFRG-RMSRTQNDAH 163

Query: 392 EFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHI 451
           EF  +++    + L +ENV    P     D  AL+                         
Sbjct: 164 EFTQLLV----DTLESENVTVLAPLC---DETALKFP----------------------- 193

Query: 452 YRGQLENILKCQRCGN-SSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510
           + G+  +   C +C   S  S   F +  L +PK S            LED   L  GD 
Sbjct: 194 FEGETTSFSVCLKCKQYSEVSAQKFLIHELVVPKKS---------DAHLEDI--LTDGDS 242

Query: 511 ELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXX------XXXXX 564
           EL  D  + C  C+IT   + +   T         GF                       
Sbjct: 243 ELIED--YSCLYCQITAILTNESNTTKPPT-----GFEAEMVGSLQSLLPDLKINTALPD 295

Query: 565 XXXXXTKNAKKRNSK----KLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYP 618
                 K+ +K N      K   I+       P IL +HLSR  ++     +N   + YP
Sbjct: 296 TLLDYVKSYRKGNCNTSILKTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYP 355

Query: 619 ---LILNIILKNGKV--IRYKLYGTVNHSGNLINGHYTSVVNKEK-----SHEIGLNRQV 668
              ++L   ++NG    I Y+L   + H+G   +GHY    +K          + +NR  
Sbjct: 356 ETLIVLQRDVENGTAERITYRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSP 415

Query: 669 WVTFDDDYIQQHRKDRNNFE----------------AGKTEMSSDEVYVLFY 704
            V      IQ+  K   +                  AGK    S  VY+LFY
Sbjct: 416 TVLARPPMIQERVKTPKSVRRWPYWFISDAVVRESNAGKMLRESKYVYMLFY 467

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 27/131 (20%)

Query: 584 IKSLDFIVLPPILVIHLSRFYYDLTKKNSTV---ITYPLILNII-------LKNGKVIRY 633
           IK +    LPP+LV+ L RF + +   N  +   ITYP  LN+         ++   + Y
Sbjct: 334 IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 634 KLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTE 693
           +L   ++  G++  GHYT +               W  F+D  I             + +
Sbjct: 394 ELVAVISQEGSVNQGHYTCMCKVPGGQ--------WFRFNDTMI---------VSITEED 436

Query: 694 MSSDEVYVLFY 704
           +   + Y+LFY
Sbjct: 437 VLRQQAYLLFY 447

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 18/121 (14%)

Query: 592 LPPILVIHLSRFYYDLTKKNS----TVITYPLILNIILKNGKVI--RYKLYGTVNHSGNL 645
           LP IL +HL RF Y   ++++      I YPL L++       I  +Y+L G V H G+ 
Sbjct: 546 LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 646 -INGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVLF 703
             +GHY  +   EK    G     W+ +DD+ ++  R++    F     + ++   YVLF
Sbjct: 606 PQHGHYVCICKNEK---FG-----WLLYDDETVESIREETVLKFTGHPGDQTT--AYVLF 655

Query: 704 Y 704
           Y
Sbjct: 656 Y 656

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 15/70 (21%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKK 356
           + G +N  NTCY NS++QCL+  + FR            N  +YP+ V +   I    +K
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR-----------CNVLRYPERVPVVSRI----RK 169

Query: 357 MYLNGGRAII 366
             LNG +A I
Sbjct: 170 SDLNGSKARI 179

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 54/121 (44%), Gaps = 18/121 (14%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNGKVIRYKLYGTVNHSGN 644
           LP  LV+HL RF Y   +KN  +     + YP  LNI  +  +    +Y+L   V H G 
Sbjct: 540 LPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGE 598

Query: 645 LIN-GHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLF 703
               GHY ++  K KS+        W+ +DD+ +Q    D         E  S   Y+LF
Sbjct: 599 SPQLGHYVTLC-KHKSYG-------WLIYDDETVQA-VSDELVSRILNNEQRSATAYLLF 649

Query: 704 Y 704
           Y
Sbjct: 650 Y 650

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRD 324
           + G QN   TCY NSI+Q LF    FRD
Sbjct: 105 VFGFQNFGYTCYCNSILQALFNIGSFRD 132

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 75/194 (38%), Gaps = 52/194 (26%)

Query: 299 GLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFK- 355
           GL N  N+CY+NS++Q L   G   +   FL  ++ L +    YP      + I +L   
Sbjct: 324 GLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDV---VYPANNLKCQWIKLLNAM 380

Query: 356 ----KMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVV 411
               K+Y NG   I P  F K   K   + +  + QQD  EFL  +L  +          
Sbjct: 381 KHEPKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSL---------- 426

Query: 412 KYYPDLVSYDANALQVNPSKYEKWYERNVITD---GLSPIDHIYRGQLENILKCQRCGNS 468
                                    +RN  +D   G S  + + R  +E+ L+C +CG  
Sbjct: 427 -------------------------DRNFFSDNSAGASNPNDLMRFMMEDRLQCNKCGKV 461

Query: 469 SYSYSTFYVLSLAI 482
            YSY     + L +
Sbjct: 462 KYSYEPAEAIQLPL 475

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILK----NGK 629
           K + F   PP+L + L RF YD     + K N       T+   P +   +LK    +G 
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 630 VIR----YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
             R    Y L+G + HSG++  GHY +++        G+  Q W  FDD+ +
Sbjct: 442 KSRNPYVYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 42/104 (40%), Gaps = 10/104 (9%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            G +N   TCY+NS++Q  F T  FR L            N  P  + L R+ Y L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVP--LALQRAFYQL---- 258

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
                 + IP   +++ +    D      Q D QE   I++ R+
Sbjct: 259 ----QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRL 298

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 12/106 (11%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           G QN  NTCY+N+ +Q L+ T   R + L   Y+    ++ Y  E ++   I +  K+ +
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMIL--DYKPPAQSSTYNPEDEMHHKIVLEIKRCF 169

Query: 359 LN----GGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
            N      ++++P   L + +K  P     D       QQD +E  
Sbjct: 170 ENLEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELF 215

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 20/142 (14%)

Query: 259 VEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFG 318
           V KP++E   IE ++  A   +           LS+  + GL+N  NTCY+NS +Q L+ 
Sbjct: 33  VTKPQKERRFIEDLDEGAQMQH-----------LSQTPV-GLKNLGNTCYMNSTLQALYQ 80

Query: 319 TTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLR 378
               RD  L   Y++        +  QL   +   F+++      ++ P   L M +K  
Sbjct: 81  IKPLRDEVLN--YKVPREKPSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCY 138

Query: 379 PDLNIPDD------QQDTQEFL 394
           P     D       QQD +E  
Sbjct: 139 PQFAERDQESGFYKQQDAEELF 160

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 19/112 (16%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKN------STVITYP-LILNIILKNGKVIR 632
           K + F   P +L + L RF YD     L K N       T+   P L  +++ KN     
Sbjct: 379 KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
           Y L+G + HSG +  GHY +++  +   +       W  FDDD + +  K++
Sbjct: 439 YNLHGVLVHSGEISVGHYYAMIKPDVGDQ-------WFRFDDDKVWRVTKEQ 483

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 51/115 (44%), Gaps = 16/115 (13%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE---VQLSRSIYVLFK 355
           GL+N   TCY+NS++Q  F T LFR +     Y++  + N+ P +   + L RS Y+L K
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV----YKI-PSENESPNDSVLLALQRSFYLLQK 257

Query: 356 KMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
                          L++ +    D      Q D QE   I++ R+   +    V
Sbjct: 258 SNETLDT--------LELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKGTEV 304

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILN--IILKNGKVIRYKLYGTVNH-SG 643
           LP  L +HL RF Y   ++N  +     I YPL L+      +    +Y+L G V H  G
Sbjct: 568 LPHTLALHLKRFKYS-EEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGG 626

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQ-HRKDRNNFEAGKTEMSSDEVYVL 702
              +GHY S+    K+   G     W+ FDD+ ++  H    + F   +  +++   YVL
Sbjct: 627 GPQHGHYVSLC---KNDNFG-----WLLFDDETVEAVHESTVSKFIGDRDSLTT--AYVL 676

Query: 703 FY 704
           FY
Sbjct: 677 FY 678

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           + G +N  NTCY NS++QCL+  T FR L L
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 60/148 (40%), Gaps = 26/148 (17%)

Query: 259 VEKPKEEEGKIE--AIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCL 316
           V KP E+   IE  A E    ++ +LP+              G QN  NTCY+NS +Q L
Sbjct: 81  VSKPAEKNQFIEDLAPEEQLQRSSDLPI--------------GFQNMGNTCYLNSTLQAL 126

Query: 317 FGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLN----GGRAIIPNRFLK 372
           +     R+L L+        ++     V+  + I +  ++ + N      ++++P   L 
Sbjct: 127 YRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCFQNLKNKSFKSVMPMVLLT 186

Query: 373 MCKKLRPDLNIPDD------QQDTQEFL 394
             +K  P     D       QQD +E  
Sbjct: 187 ALRKCYPQFAERDSQMGFYKQQDAEELF 214

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (46%), Gaps = 16/120 (13%)

Query: 592 LPPILVIHLSRF-YYDLTKKNSTV---ITYPLILNIILKNGKVIR--YKLYGTVNHSG-N 644
           LP  L IHL RF Y D    N  +   I YP+ L +     + +   Y+L G V H G  
Sbjct: 527 LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 645 LINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
             +GHY SV    K+ + G     W+ FDD+ ++   +D      G +  S+   YVLFY
Sbjct: 587 PQHGHYISVC---KTSDYG-----WLLFDDETVECISEDTVLSFVGDSN-SAGTAYVLFY 637

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           + GL+N  NTCY NSI+QCL+    FR+  L
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRENIL 160

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 56/159 (35%), Gaps = 32/159 (20%)

Query: 365 IIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANA 424
           I P  F+++ KK    L   D  QD  EFL  +L  + + L   N  K            
Sbjct: 386 ISPGGFMEIVKKENI-LFATDMHQDAHEFLNFLLNDVSDYLDKANTEK------------ 432

Query: 425 LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPK 484
              NP       E N + D       I++G + N ++C  C   +  Y +F    + +  
Sbjct: 433 ---NPDNTRSGNETNFVND-------IFKGTITNQIRCLTCDTVTSRYESFLDFPIEV-- 480

Query: 485 LSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNC 523
                       I ++  +  +   E L G N + C  C
Sbjct: 481 -------IGDETIDIQKMMISYHQKEMLQGSNKFYCGTC 512

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 292 LSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIY 351
            +EL I G +N  NTCY+N+ +Q LF     R+L L    + F N N  P++    + I 
Sbjct: 103 FNELPI-GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLN--PQDEMHHKLIL 159

Query: 352 VL---FKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
            L   F+ +     ++++P   + + +K+ P     D       QQD +E  
Sbjct: 160 ELKHCFESLKQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELF 211

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 633 YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
           Y L G + H G N  +GHY + +  E       +  VW  F+DD +    K+R    AG 
Sbjct: 430 YNLVGVITHQGANSDSGHYQAFIRDEN------DENVWYKFNDDKVSIVEKERVEALAGG 483

Query: 692 TEMSSDEVYVLFY 704
            E  SD   +L Y
Sbjct: 484 GE--SDSALILMY 494

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 83/216 (38%), Gaps = 30/216 (13%)

Query: 452 YRGQLENILKCQRCGNSS-YSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510
           + GQL + L C +C NSS  +   F +  L +P+         +   KL D ++    D 
Sbjct: 298 FGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQ---------AMSAKLSDMVS----DN 344

Query: 511 ELSGDNAWDCPNCRITD----SKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXX 566
           +      + C  C+++      K +     +Q++K  +                      
Sbjct: 345 QTDTIEGYSCLTCKVSTIVNYEKGRGYAKCTQEEKRILKTLEDALPDMAINDELSDELTS 404

Query: 567 XXXT--KNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITYPLIL- 621
              +  K+       K T +K    +  P  LV+HLSR  +D    ++NS  + +  IL 
Sbjct: 405 YINSYNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILE 464

Query: 622 ---NIILKNGKV----IRYKLYGTVNHSGNLINGHY 650
               +I  N  V    I YKL   V HSG+   GHY
Sbjct: 465 SREQVIRHNKCVGINPISYKLKAIVAHSGSHSQGHY 500

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 53/120 (44%), Gaps = 16/120 (13%)

Query: 592 LPPILVIHLSRFYYD----LTKKNSTVITYPLILNIILKNGKVI--RYKLYGTVNHSGNL 645
           LP  L +HL RF Y        K    I YPL LN+       I  +YKL G V H G+ 
Sbjct: 625 LPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGIVVHMGSS 684

Query: 646 -INGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
              GHY ++    K+ + G     W+ FDD+      ++      G  E S +  YVLFY
Sbjct: 685 PQQGHYVAIC---KTDKYG-----WLLFDDETASWINEEEVLSFIGD-EKSQNTAYVLFY 735

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 265 EEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323
           ++ K  +I S+    Y +P  + SN       I G +N  NTCY NS++QCL+    F+
Sbjct: 129 DKNKFSSILSTMTDDY-IPFGDGSN------KIFGYENFGNTCYCNSVLQCLYHLDDFK 180

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 20/122 (16%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNGKVIRYKLYGTVNHSGN 644
           +P IL +HL RF Y   ++NS +     I YPL L++          RY+L G V H G+
Sbjct: 557 VPYILSLHLKRFKYS-EEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGS 615

Query: 645 L-INGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN-NFEAGKTEMSSDEVYVL 702
              +GHY  +   EK    G     W+ +DD+ ++   ++    F     + ++   YVL
Sbjct: 616 GPQHGHYVCICKNEK---FG-----WLLYDDETVESVSEETVLKFTGHSGDQTT--AYVL 665

Query: 703 FY 704
           FY
Sbjct: 666 FY 667

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 15/70 (21%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKK 356
           + G +N  NTCY NS++QCL+    FR            N  +YP+ + +S  I    +K
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR-----------CNVLRYPERIPVSNRI----RK 179

Query: 357 MYLNGGRAII 366
             L G +  +
Sbjct: 180 SNLTGSKVRV 189

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 19/107 (17%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT----YPLILNIILKNGKVIR-------- 632
           K + F   PP+L + L RF YD        I     +P  +++       +R        
Sbjct: 376 KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQ 679
           Y L+G + H+G++  GHY +++        GL+ + W  FDDD + Q
Sbjct: 436 YNLHGVLVHTGDISTGHYYAMIKP------GLDDK-WYRFDDDKVWQ 475

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 10/115 (8%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFK 355
              GL+N   TCY+NS++Q  + T  FR L           +N  P  + L R+ Y L  
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLVYHIPTDGETPSNSVP--LALQRAFYKL-- 252

Query: 356 KMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
                  R+  P    ++ +    D      Q D QE   I++ R+  ++    V
Sbjct: 253 ------QRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKATEV 301

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 16/106 (15%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           GLQN  NTCY+N+ +Q LF     RDL L        +  K   + ++   I +  K+ +
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILN------YDPAKASPQDEMHHKIVLEMKRCF 161

Query: 359 LN----GGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
            N      ++++P   L + +K  P     D       QQD +E  
Sbjct: 162 ENLENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELF 207

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 18/111 (16%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT----YPLILNI--ILKNGKVIR-----Y 633
           K + F   PP+L + L RF YD        +     +P  +++   L++ K  +     Y
Sbjct: 380 KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 634 KLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
            L+G + H+G++  GHY +++        GL  Q W  FDD+ + +  K++
Sbjct: 440 NLHGVLVHAGDISTGHYYTLIKP------GLEDQ-WYRFDDERVWKVTKNQ 483

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 44/113 (38%), Gaps = 10/113 (8%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            G +N   TCY+NS++Q  F T  FR L            N  P  + L RS Y L    
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTENESPNNSVP--LALQRSFYQLQVSK 260

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           +        P   L++ +    D      Q D QE   I++ R+   +   +V
Sbjct: 261 F--------PLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTSV 305

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 61/147 (41%), Gaps = 29/147 (19%)

Query: 259 VEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFG 318
           + KPKE   K + IE  AP+       + +NDL       G QN  NTCY+N+ +Q L+ 
Sbjct: 82  ISKPKE---KSQFIEDLAPEQQ----FQHANDL-----PIGFQNMGNTCYLNATLQALYR 129

Query: 319 TTLFRDLFLTKKYRLFLNTNKYPKEV-QLSRSIYVLFKKMYLN----GGRAIIPNRFLKM 373
               RD+ L        N N     V +  + I V  K+ + N      ++++P   L  
Sbjct: 130 IEPLRDMILD------YNQNSTTTPVDETHKKIVVEMKRCFENLKSKSYKSVMPMVLLTA 183

Query: 374 CKKLRPDLNIPD------DQQDTQEFL 394
            +K  P     D       QQD +E  
Sbjct: 184 LRKCYPQFAERDPQSGFYKQQDAEELF 210

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 15/116 (12%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEV-----QLSRSIYVL 353
           GL N  N+CY+NS++QC     LF+D   T K ++ +   ++P +V      L   +  L
Sbjct: 321 GLINMGNSCYLNSVLQC-----LFQDETWTGKLQMAVG-EEFPTDVVFPSNNLRCQLIKL 374

Query: 354 FKKMYLNG---GRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELS 406
           ++ M L      + I P  F K C     +      QQD  EFL  ++  + ++LS
Sbjct: 375 YRAMKLEPELYPQGIKPQSF-KKCFSAGHEEFASQRQQDAMEFLTYMIDNLDKKLS 429

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 58/129 (44%), Gaps = 34/129 (26%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYGTVNHSG- 643
           LP IL +HL RF Y   + N+ +     ITYP  L++     + I  +Y+L G + H G 
Sbjct: 549 LPKILSLHLKRFKYS-EENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGA 607

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ--------QHRKDRNNFEAGKTEMS 695
              +GHY ++   EK    G     W+ +DD+ ++        +H  D N+         
Sbjct: 608 GPQHGHYVAMCKTEK---FG-----WLLYDDETVEAVLEKDVLRHVGDSNDLATA----- 654

Query: 696 SDEVYVLFY 704
               Y+LFY
Sbjct: 655 ----YILFY 659

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 11/54 (20%)

Query: 282 LPVIEDSNDLLSELS-----------ITGLQNPCNTCYINSIIQCLFGTTLFRD 324
           +P+  D +D + EL+           + G +N  NTCY NS++QCL+  +  RD
Sbjct: 100 VPMQNDIDDQMQELNNQLGRIDSSTKVFGFENFGNTCYCNSVLQCLYNFSELRD 153

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 112/275 (40%), Gaps = 58/275 (21%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDL--FLTKKYRLFLNTNKYPKEVQLSRSIYVLF 354
           + GL N  NTC++NS++Q L  +   R+L  FL     +   +     E+  S +   L 
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASS---RELAHFLDD---IIEESEPNKNELNFSVAFKTLL 118

Query: 355 KKMYLNGGRA---IIPNRFLKMCKKLRPDLNI--PDDQQDTQEFLLIVLARIHEELSNEN 409
            K+    GR      PN  LK  +   P+ NI    DQ+D QEF   +++++ ++L  E+
Sbjct: 119 DKLNAKYGRNRKYYRPNALLKTMES-GPNKNILLGYDQEDAQEFFQQIISQLEKDLKKED 177

Query: 410 VVKYY---------------PDLVS-YDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453
               +               P L S   A+AL +N    EK     + T+ + P   + +
Sbjct: 178 TDGDFKKEESVQPSSEDDKTPILESDLPADAL-LNQENLEKVGTVYIPTEQVEPNFALGK 236

Query: 454 GQLENI-----------------LKCQRCG-NSSYSYSTFYVLSLAIPKLSLYSFTSKSR 495
           G+ E+                  + C  CG N    YS    LSL +P  ++ +      
Sbjct: 237 GEHESFYTPYKLLTPLDGIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGA------ 290

Query: 496 KIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKS 530
            +KL + ++ +   E + G    DC  C +   +S
Sbjct: 291 TLKLSELLDKWVEPEIIEG---VDCNRCALEAVRS 322

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 26/112 (23%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILK------- 626
           K + F   PP+L + L RF YD     + K N       T+   P +   +LK       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 627 -NGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            +     Y L+G + HSG++  GHY +++        G+  Q W  FDD+ +
Sbjct: 442 KDKNPYVYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 42/104 (40%), Gaps = 10/104 (9%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            G +N   TCY+NS++Q  F T  FR L            N  P  + L R+ Y L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVP--LALQRAFYQL---- 258

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
                 + IP   L++ +    D      Q D QE   I++ R+
Sbjct: 259 ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRL 298

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 86/216 (39%), Gaps = 30/216 (13%)

Query: 452 YRGQLENILKCQRCGNSS-YSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510
           +RG++ + L C  C NSS    + F +L LA+P+    + T+K         +     D 
Sbjct: 335 FRGKVADHLVCTACRNSSKVRVTQFNMLPLAVPQ----AITAK---------LAEMVSDN 381

Query: 511 ELSGDNAWDCPNCRIT----DSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXX 566
           ++     + C  C++     + K +        +++T+                      
Sbjct: 382 QVESIEGYSCLTCKVGKILENEKGRDTSSYETTEQNTLASLARAFPNLTINDDVSEELMN 441

Query: 567 XXXTKNAKKRNSKKL--TTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILN 622
                N     + +L  T +K    +  P +L+IHLSR  ++ T   +N   + +  IL 
Sbjct: 442 YINGYNRDGLVTSQLKSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQ 501

Query: 623 I---ILKNGKV-----IRYKLYGTVNHSGNLINGHY 650
           +   +++N +      + Y+L   V H+G+   GHY
Sbjct: 502 LQEQVIQNDRCVGINSVNYELKAIVKHAGSHSQGHY 537

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 26/112 (23%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIIL-------- 625
           K + F   PP+L + L RF YD     + K N       T+   P +   +L        
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 626 KNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           K+     Y L+G + HSG++  GHY +++        G+  Q W  FDD+ +
Sbjct: 442 KDKNPYIYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 10/103 (9%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           G +N   TCY+NS++Q  F T  FR L            N  P  + L R+ Y L     
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVP--LALQRAFYQL----- 258

Query: 359 LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401
                + IP   +++ +    D      Q D QE   I++ R+
Sbjct: 259 ---QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRL 298

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 54/133 (40%), Gaps = 28/133 (21%)

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTK---KNSTVITYPLILNI--ILKNGKV------I 631
            IK L    LP +LV+ L RF + L     K +  I YP  LN+     +G        +
Sbjct: 342 AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 632 RYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
            Y+L G V H G +  GHY +             RQ W  F+D  +             +
Sbjct: 402 IYELIGVVAHKGTVNEGHYVATTKVA-------GRQ-WFKFNDSMVS---------SVTQ 444

Query: 692 TEMSSDEVYVLFY 704
            E  +++ Y+LFY
Sbjct: 445 EEALNEQAYLLFY 457

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 19/112 (16%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKN-------STVITYPLILNIILKNGKVIR 632
           K + F   PP+L + L RF YD     L K N       S  ++  L   I   N     
Sbjct: 383 KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
           Y L+G + H+G++  GHY +++      +       W  FDDD + +  K++
Sbjct: 443 YDLHGVLVHTGDISTGHYYTMIKPSIEDQ-------WYRFDDDKVWRVTKNQ 487

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 10/113 (8%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            G +N   TCY+NS++Q  F T  FR L         + T+K       + S+ +  ++ 
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ------IPTDKESP----NNSVPLALQRA 255

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           +    ++  P   L++ +    D      Q D QE   I++ R+  ++   +V
Sbjct: 256 FFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGTDV 308

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 38.9 bits (89), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT 328
           I G +N  NTCY NSI+QC F  ++FR   L+
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 52/120 (43%), Gaps = 18/120 (15%)

Query: 592 LPPILVIHLSRFYYDLTK----KNSTVITYPLILNI--ILKNGKVIRYKLYGTVNHSGNL 645
           LP  L +HL RF Y   K    K    I YP  L +     +    RY+L   V H G+ 
Sbjct: 512 LPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGDG 571

Query: 646 IN-GHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFY 704
              GHY S+    K+   G     W+ FDD+ ++    D     +   E +SD  YVLFY
Sbjct: 572 PQYGHYISLC---KTETFG-----WLLFDDETVEA--VDEQTVLSFTGE-NSDTAYVLFY 620

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKN------STVITYPLILNIILKNGKV-IR 632
           K + F   PP+L + L RF YD     L K N       ++   P +   + ++     +
Sbjct: 367 KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           Y L+G + H+G++  GHY +++        GL    W  FDDD +
Sbjct: 427 YNLHGVLVHTGDISTGHYYAMIKP------GL-EDAWYRFDDDKV 464

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 50/113 (44%), Gaps = 12/113 (10%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQL-SRSIYVLFKKM 357
           GL+N   TCY+NS++Q  + T  FR L     Y++       P E +  + S+ +  ++ 
Sbjct: 191 GLKNQGATCYLNSLLQSYYFTKYFRKLV----YQI-------PTEGETPANSVSLALQRA 239

Query: 358 YLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           +    R+  P    ++ +    D      Q D QE   I++ R+  ++    V
Sbjct: 240 FFQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGTEV 292

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 53/133 (39%), Gaps = 30/133 (22%)

Query: 584 IKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIR----------- 632
           I+ L    LPP+L++ L RF + L    S  I   +  ++ L      +           
Sbjct: 352 IRQLSMAKLPPVLMLQLKRFEH-LINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNL 410

Query: 633 -YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
            +KL   + H G +  GHYT++          +N  VW  F+D  +             +
Sbjct: 411 TFKLSAIIPHQGTVDKGHYTTICR--------INGDVWAKFNDSMVTL---------ISE 453

Query: 692 TEMSSDEVYVLFY 704
            +M  ++ Y+L+Y
Sbjct: 454 EDMLKEQAYLLYY 466

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 38.5 bits (88), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 16/122 (13%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE---VQLSRSIYVLFK 355
           G +N   TCY+NS++Q  F T LFR +     Y++  + N+ P +   + L RS Y+L K
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV----YKI-PSDNESPNDSVSLALQRSFYLLEK 257

Query: 356 KMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYP 415
                      P   L++ +    D      Q D QE   I++ R+   +    V     
Sbjct: 258 SKE--------PLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGTEVEGTLN 309

Query: 416 DL 417
           DL
Sbjct: 310 DL 311

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKN-GKVIR 632
           K + F   PP+L + L RF YD     L K N       ++   P +   +  N      
Sbjct: 379 KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           Y L+  + HSG++  GHY +++    + +       W  FDDD +
Sbjct: 439 YNLHCVLVHSGDISAGHYYAMIKPNVTDQ-------WFRFDDDKV 476

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 89/408 (21%), Positives = 146/408 (35%), Gaps = 126/408 (30%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLS-RSIYVLF 354
            ++GL N  +TCY++ IIQCL     F    L + +     T+     +  +  SI   F
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFKICKTHDPTTCISCALDSIVTDF 194

Query: 355 ----------KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEE 404
                     KK   +G   ++   +     K+  +L     QQD  EF   +L R+H E
Sbjct: 195 YGISDLDDDVKKTNNDGLIDLLTCSW-----KINQNL-AGYSQQDAHEFWQFLLNRLHSE 248

Query: 405 LSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDH-IYRGQLENILKCQ 463
                          Y +N   + P+      E N   +  + I H +++G L++ + C 
Sbjct: 249 ---------------YKSN---IGPTDTAPLKEGN--HELCNCIYHKVFQGFLKSSIVCP 288

Query: 464 RC-GNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPN 522
            C  ++  +   F  LSL I             K  L +C+N F   E+L  D  + C N
Sbjct: 289 ECNSDAKTTIEPFMDLSLDIKG-----------KNTLYECLNSFHKKEQLH-DFDYHCKN 336

Query: 523 CRITDSKSKKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLT 582
           C                                                N  +  +K+L 
Sbjct: 337 C------------------------------------------------NTSQDPTKQLA 348

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDLTK---KNSTVITYPLILNI---------ILKNGKV 630
             K      L P+L+    RF + L+    K + VI +PL LN+            N K 
Sbjct: 349 VAK------LSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKP 402

Query: 631 -IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
            + Y+L G + H+G +  GHYT++    +          W+ F+D  +
Sbjct: 403 DLIYELIGIICHTGTVNEGHYTAICKIPEGQ--------WIKFNDSMV 442

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 102/455 (22%), Positives = 178/455 (39%), Gaps = 97/455 (21%)

Query: 275 SAPKAYNL---PV-IEDSNDLLSELSITGLQNPCNTCYINSIIQCLF---GTTLFRDLFL 327
           S  +A+N+   P+ IE+S  L  +   TGL N  N C++NS +Q L      T + + F+
Sbjct: 50  SVSRAFNVKKGPLSIEESKRL--DRFTTGLLNARNDCFLNSSLQALVPIESLTTYLNQFV 107

Query: 328 TKKY-----RLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLN 382
              +     ++F      P    L + ++ L + + +        N    +   LR  ++
Sbjct: 108 EALHSVDEGQVFELERLAPLHANLIKLLHEL-QSLIVKPQTVSAKNIVKTLEDTLRRKMS 166

Query: 383 IPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVIT 442
              DQ D  EF  I+L  +H E                    LQ N            I 
Sbjct: 167 --SDQNDAHEFTQILLETLHSEYIK-----------------LQSN------------IE 195

Query: 443 DGLSPIDHIYRGQLENILKCQRCGNSSYS-YSTFYVLSLAIPKLSLYSFTSKSRKIKLED 501
            G  P    + G   N L C +C   S + +S F +L +A+P          +   KL D
Sbjct: 196 IGSFP----FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPG---------NYSEKLTD 242

Query: 502 CINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQ-----KKKSTIFGFXXXXXXXXX 556
            I L + DE + G   + C  C++ +   K E+  +Q     +++ +I  F         
Sbjct: 243 LI-LHSQDEIIEG---YSCLYCKV-NMILKNEKYLNQLPEYSQEEQSILNFLRNQILTLY 297

Query: 557 XXX---XXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD---LTKK 610
                           +KN     + K   IK    I  P  L++HLSR  ++   +T+ 
Sbjct: 298 INDDLPADVSFYVDHYSKNGCVTANFKSNIIKKNAVIKEPASLIVHLSRSIFNGATITRS 357

Query: 611 NSTV-------ITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSV-----VNKEK 658
              V       +   +++N   +  + I+Y+L   V H+G+ + GHY        + KE+
Sbjct: 358 ACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHTGSHVQGHYQCYRKKPDLMKER 417

Query: 659 SHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTE 693
           + +  +NR          I+++ +D+  F+A K E
Sbjct: 418 NTDTIVNR-------SPMIKKYSQDK--FDASKIE 443

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 27/135 (20%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNSTVITYPLILNI---ILKNGKVIR---- 632
           K + F   PP+L + L RF YD     L K N     +P  +++   I K G        
Sbjct: 370 KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRY-EFPDSIDVSSYIDKMGTEDTEMPP 428

Query: 633 --YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR---NNF 687
             YKL+G + H+G++  GHY +++      +       W  FDD+ + +  K +    NF
Sbjct: 429 CIYKLHGVLVHAGDISTGHYYAMIKPSTEDQ-------WYRFDDEKVWKVTKTQVFDENF 481

Query: 688 EAGKTEMSSDEVYVL 702
             G   +  DEV ++
Sbjct: 482 --GLDRIPDDEVRLM 494

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 20/142 (14%)

Query: 259 VEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFG 318
           V KP++E   IE ++ SA   +           LS+L + GL+N  NTCY+NS +Q L+ 
Sbjct: 79  VSKPQKEHRFIEDLDESAQMQH-----------LSQLPV-GLKNLGNTCYMNSTLQALYQ 126

Query: 319 TTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLR 378
               R+  L   ++         + +QL   +   F+++      +  P   L   +K  
Sbjct: 127 IRPLREEILN--FQPPKENRSGEQHIQLVAELKRCFQQLRDRPQESTTPILLLATLRKCY 184

Query: 379 PDLNIPDD------QQDTQEFL 394
           P     D       QQD +E  
Sbjct: 185 PQFAERDQESGFYKQQDAEELF 206

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 21/107 (19%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNGKVIR- 632
           K + F   P +L + L RF YD     L K N       ++   P +   +LKN      
Sbjct: 386 KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 633 --YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
             YKL+G + H+G++  GHY +++  +   +       W  FDD+ +
Sbjct: 446 HIYKLHGVLVHTGDISTGHYYTMIKPDLGDQ-------WYRFDDERV 485

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDL 325
            G +N   TCY+NS++Q  F T  FR L
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKL 236

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 17/102 (16%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL--FLNTNKYPK-- 342
           D++ L +E   TGL N  NTCY+NS++Q  F  +  R   L  +  +  FLN  +Y    
Sbjct: 722 DASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRR 781

Query: 343 -------EVQLSRSIYV------LFKKMYLNGGRAIIPNRFL 371
                  E ++ RS+        LF  M     R + P + L
Sbjct: 782 IGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKEL 823

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK 330
           GL+N  NTCY+N+ +QCLF     R++ L  K
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYK 141

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 633 YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
           Y L G + H G N  +GHY + +   +  EI      W  F+DD +    K++    AG 
Sbjct: 434 YNLIGIITHQGANSESGHYQAFIRDREDEEI------WYKFNDDKVTIVDKEKIETLAGG 487

Query: 692 TEMSSDEVYVLFY 704
            E  SD   +L Y
Sbjct: 488 GE--SDSALILLY 498

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 94/240 (39%), Gaps = 46/240 (19%)

Query: 299 GLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVL--F 354
           GL N  N+CY+NS++QCL   G   + D         F     YP      + I +L  F
Sbjct: 343 GLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNAF 402

Query: 355 KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYY 414
           K    +    I P  F +   K   +    ++QQD+ EFL  V   + + L        +
Sbjct: 403 KLNPEDYEEGIRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEKGL--------F 453

Query: 415 PDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYST 474
           P +   DA+   +NP+   K+                    +E+ L+C  C N  Y+Y  
Sbjct: 454 PKI--QDAS---INPNNLLKFI-------------------MEDKLQCVECKNVKYTYQP 489

Query: 475 FYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE-ELSGDNAWDCPNCRITDSKSKKE 533
              + L + + +    T+    ++L    + F G+E E S      CP C+      KK+
Sbjct: 490 NECIQLPLKEGNDLVGTTTQNLMEL--ITDYFQGEEIEFS------CPTCKRMTKAVKKQ 541

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 16/120 (13%)

Query: 294 ELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE---VQLSRSI 350
           E    G +N   TCY+NS++Q  F T  FRDL     Y++    ++ P +   + L R+ 
Sbjct: 255 ETGYVGFRNQGATCYLNSLLQSYFFTKYFRDLV----YQI-PTADENPNDSVALALQRAF 309

Query: 351 YVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
           Y L    Y        P   L++ +    D      Q D QE   I++ R+   +   +V
Sbjct: 310 YQLQVSNY--------PLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMKGTSV 361

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNGKVIR- 632
           K + F   P +L + L RF YD     L K N       T+   P +   +LK  K    
Sbjct: 436 KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           Y L+G + H+G++  GHY +++      +       W  FDD+ +
Sbjct: 496 YNLHGVLVHTGDISTGHYYAMIKPTTDDK-------WYRFDDEKV 533

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 77/186 (41%), Gaps = 36/186 (19%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           GL N  N+CY+NS++QCLF   +       K + L      +P++V    + +   + + 
Sbjct: 324 GLINLGNSCYLNSVLQCLFNGGV-------KGWSLKGLGQDFPQDVLYPTNNFKC-QLIK 375

Query: 359 LNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLV 418
           LN    + P  +    + +RP           + F   V  + HEE S+        + +
Sbjct: 376 LNNAMKVEPQNYP---EGIRP-----------KSFKKCV-GQSHEEFSSGRQQDSM-EFL 419

Query: 419 SYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVL 478
            Y  + L           ++ +  +G +P D + +  +E+ L+C  CG   YS      L
Sbjct: 420 GYLVDVL-----------DKKIFKNGSNPND-LMKFTMEDRLQCTNCGKVKYSSEAAESL 467

Query: 479 SLAIPK 484
            L +P+
Sbjct: 468 QLPMPE 473

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 10/133 (7%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF--LNTNKYPKE--VQLSRSIYV 352
           I GL N  NTC++NS++Q L  +    +       R +  +  N++ +E   Q S     
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYEEIEQNEHNEEGNGQESAQDEA 159

Query: 353 LFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVK 412
             KK    GG+      + K  KKL    +  +D++ +QE  +     + + LS  N  K
Sbjct: 160 THKKNTRKGGKV-----YGKHKKKLNRKSSSKEDEEKSQEPDITFSVALRDLLSALN-AK 213

Query: 413 YYPDLVSYDANAL 425
           YY D   +  N+L
Sbjct: 214 YYRDKPYFKTNSL 226

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 35/186 (18%)

Query: 368 NRFLK-MCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY-----D 421
           N  LK M K  R ++ +  DQ+D QEF   +LA +   + + N  K     V+      D
Sbjct: 224 NSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDD 283

Query: 422 ANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI----------------LKCQRC 465
           A   Q+N  +    Y   + T+ + P   ++   ++N                 + C +C
Sbjct: 284 ALVGQLNLGEVGTVY---IPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQC 340

Query: 466 G-NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           G N    YS F  LSL +P  ++ S       +KL   ++ ++  E + G    +C  C 
Sbjct: 341 GENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIEG---VECNRCA 391

Query: 525 ITDSKS 530
           +T + S
Sbjct: 392 LTAAHS 397

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT----YP--------LILNIILKNGKVIR 632
           K + F   P +L + L RF YD        I     +P        +  +++  N     
Sbjct: 380 KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           Y L+G + H+G++  GHY +++        GL  Q W  FDD+ +
Sbjct: 440 YGLHGVLVHTGDISTGHYYALIKP------GLEDQ-WYRFDDERV 477

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 16/116 (13%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKE---VQLSRSIYVLF 354
            G +N   TCY+NS++Q  F T  FR L     Y++   + + PK+   + L R+ Y L 
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV----YQI-PTSQENPKDSVVLALQRAFYQLQ 257

Query: 355 KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENV 410
              Y        P   +++ +    D      Q D QE   I++ R+   +    V
Sbjct: 258 VSQY--------PLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGTTV 305

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 10/90 (11%)

Query: 571 KNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLT--KKNSTVITY--PLILN-IIL 625
           K   K +  K T +K    +  P +L++HLSR  +D    +KN+  +++   L++N  ++
Sbjct: 426 KGGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVI 485

Query: 626 KNGKVI-----RYKLYGTVNHSGNLINGHY 650
           +N K +      YKL   + H G+   GHY
Sbjct: 486 ENNKCVGIRKDSYKLRSMLRHQGSHSTGHY 515

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 99/231 (42%), Gaps = 54/231 (23%)

Query: 299 GLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRL---FLNTNKYPKEVQLSRSIYVL 353
           GL N  N+CYINS++QCL   G   +    L + + L   + +TN   + ++L+ +I  L
Sbjct: 323 GLINLGNSCYINSVLQCLLNGGVKTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIK-L 381

Query: 354 FKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKY 413
             ++Y +G R   P  F K   +   + +  + QQD  EFL            N+ + K 
Sbjct: 382 EPELYPSGIR---PRSFKKCIGQAHEEFS-SERQQDALEFLSFF---------NDTLDK- 427

Query: 414 YPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYS 473
              + S   N    NPS                    + R  +EN L+C +CG     Y+
Sbjct: 428 --KIFSRSEN----NPSD-------------------LMRYIIENRLQCTKCG--KVKYT 460

Query: 474 TFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           T    S+ +P L   S +  S+ + L+  +  F G EEL     + CP C+
Sbjct: 461 TDINESMLVP-LEENSDSQHSQSL-LDRLVEYFHG-EELD----FKCPQCK 504

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 44/108 (40%), Gaps = 21/108 (19%)

Query: 285 IEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDL---FLTKKYRLFLNTNK-- 339
           I D+N L S    TGL N  NTCY+NS++Q  F  +  RD    +      L LN N+  
Sbjct: 683 IIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSG 742

Query: 340 ----------------YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFL 371
                             + VQ    +  LF  M  +  R + P+R L
Sbjct: 743 AMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSREL 790

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323
           LP  + SN +       G +N  NTCY NS++QCL+  T FR
Sbjct: 136 LPYGDGSNKVF------GYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 46/95 (48%), Gaps = 17/95 (17%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYG-TVNHSG 643
           LP IL +HL RF Y  T +N  +     I YPL L +       I  RY+L G  V+  G
Sbjct: 558 LPHILALHLKRFKYSET-QNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMGG 616

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ 678
              +GHY S+   EK    G     W+ FDD+ ++
Sbjct: 617 GPHHGHYVSLCKNEK---FG-----WLLFDDETVE 643

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 580 KLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILN----IILKNGKV--- 630
           K T +K    +  P +L+IHLSR  ++     +NS  + +   L     II KN  V   
Sbjct: 440 KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 631 -IRYKLYGTVNHSGNLINGHY 650
            ++Y+L  TV H G    GHY
Sbjct: 500 NVKYRLRATVRHQGTHSAGHY 520

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 19/93 (20%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFL--TKKYRLFLNTNKYPKEV----------- 344
           TG+ N  NTCY+NS++Q  F  +  R+  L  +K Y  F +  +  K +           
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811

Query: 345 QLSRSIYV------LFKKMYLNGGRAIIPNRFL 371
           ++ RSI        LF  M     R + P R L
Sbjct: 812 EVERSIQFIYQLRDLFYAMIYTNKRCVTPRREL 844

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 17/95 (17%)

Query: 592  LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYGTVNH-SG 643
            LP  L +HL RF Y   ++N  +     + YPL L++       I  RY+L G V H  G
Sbjct: 959  LPKTLSLHLKRFKYS-EEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMGG 1017

Query: 644  NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ 678
               +GHY ++   +K    G     W+  DD+ ++
Sbjct: 1018 GPQHGHYVAICKNDK---FG-----WLLMDDETVE 1044

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           G +N  NTCY NS++QCL+  T  R   L
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           + G +N  NTCY NS++QCL+  T FR   L
Sbjct: 114 VFGYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           G +N  NTCY+N+ +Q L+     RD+ L       + +N   ++ ++ + I +  K+ +
Sbjct: 110 GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGV-SNSGAQDEEIHKQIVIEMKRCF 168

Query: 359 LN----GGRAIIPNRFLKMCKKLRPDLNIPDD------QQDTQEFL 394
            N      ++++P   L   +K  P     D       QQD +E  
Sbjct: 169 ENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELF 214

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 141/415 (33%), Gaps = 93/415 (22%)

Query: 284 VIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL-------- 335
           V  DS   + + +  GL N  N C+I S +Q L G   F +    K+ R  L        
Sbjct: 39  VFGDSKQSIGKYTTVGLINRGNDCFITSSLQGLAGIPRFVEYL--KRIRTVLLELETKLS 96

Query: 336 -----------NTNKYPKEVQLSRSIYVLFKKM---------YLNGGRAIIPNRFLKMCK 375
                      NT ++ +    S S+  L + +           +   +I P   +   +
Sbjct: 97  NNAKGDNPTVDNTTRHSRLENSSNSLAPLHESLTSLILDLISVKDRKTSISPKIVINTLE 156

Query: 376 KLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKW 435
            +     I   Q D  EF LI+L  + EE S          L+ Y      +N  K+   
Sbjct: 157 SIFKS-KISSKQNDAHEFTLILLQTLQEERS---------KLIDYSKQICNLNIPKFP-- 204

Query: 436 YERNVITDGLSPIDHIYRGQLENILKCQRC-GNSSYSYSTFYVLSLAIPKLSLYSFTSKS 494
                           + G+    L C +C G S  SY   ++  L++P+ +        
Sbjct: 205 ----------------FEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQTS------- 241

Query: 495 RKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFXXXXXXX 554
                E+  N+   DE    D+ + C  C+I    + +E      K  T           
Sbjct: 242 -----ENLSNILAHDETEIIDD-YSCLICQIRAILNHEE--YRNFKDCTPDEILMLDRLK 293

Query: 555 XXXXXXXXXXXXXXXTKNAKKRNSK--------KLTTIKSLDFIVLPPILVIHLSRFYYD 606
                           +   KR SK        K   IK    + LP IL++HLSR  ++
Sbjct: 294 NYATKAPINENLPFEVEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFN 353

Query: 607 LTK-----------KNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHY 650
                         +  T+  Y L  +  +   + ++Y L   V H+G+  +GHY
Sbjct: 354 GITYSRNPCNVKFGERITLSEYTLAESGTITENRQVKYNLKSVVKHTGSHSSGHY 408

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 53/140 (37%), Gaps = 36/140 (25%)

Query: 584 IKSLDFIVLPPILVIHLSRFYYDL---TKKNSTVITYPLILNIIL----KNGKV------ 630
           IK L    L P+LV  L RF + L   T K +  I YPL LN+       N         
Sbjct: 365 IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 631 ------IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
                 + Y+L   ++H G +  GHY  VV         +N   W  F+D  +       
Sbjct: 425 SENVPDMIYELTSIISHKGTVNEGHYIVVVK--------VNDGQWFKFNDSMVS------ 470

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
                 + E    + Y+LFY
Sbjct: 471 ---AITEEEALKQQAYLLFY 487

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 11/105 (10%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPK---EVQLSRSIYVLFK 355
           G +N  NTCY+N+ +Q L+     RD  L   + + +N +K  +    ++L   +   F+
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLN--FDVSINNDKNGENETHIKLVTELKRCFE 165

Query: 356 KMYLNGGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
            +     ++++P   L   +K  P     D       QQD +E L
Sbjct: 166 GLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELL 210

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 633 YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691
           Y L G + H G N  +GHY + +  E       +  +W  F+DD +    K++    AG 
Sbjct: 430 YDLVGIITHQGANSESGHYQAFIRDEN------DENIWYKFNDDKVSIIEKEKIESLAGG 483

Query: 692 TEMSSDEVYVLFY 704
            E  +D   +L Y
Sbjct: 484 GE--NDSALILMY 494

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFR 323
           I G +N  NTCY NSI+QCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (47%), Gaps = 18/121 (14%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNGKVI--RYKLYG-TVNHSG 643
           LP  L +HL RF Y L +KN+       I YPLIL++       I  +Y+L    V+  G
Sbjct: 504 LPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLGG 562

Query: 644 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLF 703
              +GHY S+    KS + G     W+ FDD+ ++   ++      G  E  +   YVLF
Sbjct: 563 GPHHGHYVSIC---KSDKFG-----WLLFDDETVESINEETVLKFVGDPEDQT-TAYVLF 613

Query: 704 Y 704
           Y
Sbjct: 614 Y 614

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN 336
           TGL N  NTCY+NS++Q  F  +  RD  L   Y+  LN
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN--YQKMLN 737

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 86/420 (20%), Positives = 149/420 (35%), Gaps = 92/420 (21%)

Query: 281 NLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFG-----------TTLFRDLFLTK 329
           N  V  +S   + + +  GL N  N C+I S +Q L G            ++ R+L+   
Sbjct: 51  NALVFGNSKQRIGKYTTVGLINNGNDCFITSSLQSLAGIPRFVEYLKEINSILRELY-KP 109

Query: 330 KYRLFLNTNKYPKEV-------------QLSRSIYVLFKKMYL--------NGGRAIIPN 368
            ++  L+ N+  + +             QLS S  +    + L           + I P 
Sbjct: 110 DFKFDLSRNEEGENLTTGEIMDASRCGSQLSLSTILHESLLSLVSDLVSIRENKKTISPK 169

Query: 369 RFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYDANALQVN 428
             +K  + +     I   Q D  EF L++L  + EE         +  LV+Y  N   +N
Sbjct: 170 LVVKTLETIFKS-KISSQQNDAHEFTLVLLQTLQEE---------HSKLVNYTKNMPDLN 219

Query: 429 PSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGN-SSYSYSTFYVLSLAIPKLSL 487
             K+                   ++GQ    L C +C   S  SY   ++  L +P+ S 
Sbjct: 220 IPKFP------------------FQGQTSKFLSCLQCHRLSKPSYQESFIRELMVPQRS- 260

Query: 488 YSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRI----TDSKSKKEEITSQKKKST 543
              + K  KI   D   +  G         + C  C++       K +  +  SQ +   
Sbjct: 261 ---SEKLMKILANDETEIIEG---------YSCLICQVRAILNHEKYRTFKNCSQDELRI 308

Query: 544 IFGFXXXXXXXXXXXX--XXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLS 601
           +                            K+  + ++ K T IK    + LP +LVIHLS
Sbjct: 309 LDALKNYANDASINEDLPIKVEQYIKHYAKDKLRTSNVKSTVIKKDIAVQLPEVLVIHLS 368

Query: 602 RFYYD--LTKKNSTVITYPLILNII----LKNG-----KVIRYKLYGTVNHSGNLINGHY 650
           R  ++     +N   + +   + +     ++ G     + I Y L   V H+G+   GHY
Sbjct: 369 RSTFNGMTYTRNPCNVEFEETIKLAEYTSIEKGPSAEYRQIEYHLKSVVKHTGSHSRGHY 428

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYDLTKKNSTVIT----YPLILNIIL--------KNGKVIR 632
           K + F   PPIL + L RF YD        I     +P   +            N +   
Sbjct: 378 KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           Y L+G + H+G++  GHY +++  +   +       W  FDD+ +
Sbjct: 438 YNLHGVLVHTGDISTGHYYAMIKPDLEDQ-------WYRFDDEKV 475

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 12/109 (11%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQL-SRSIYVLFKK 356
            G +N   TCY+NS++Q  F T  FR L             K P E +  + S+ +  ++
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY-----------KIPTESETPNSSVPLALQR 249

Query: 357 MYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL 405
            +     + IP   L++ +    D      Q D QE   I++ R+   +
Sbjct: 250 AFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 298

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 71/189 (37%), Gaps = 42/189 (22%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTL--FRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKK 356
           GL N  N+CY+NSI+Q LF   +  + D+ +    + F     YP    +   +  L   
Sbjct: 320 GLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSN-NVKCQLIKLLNA 378

Query: 357 MYLNGGR---AIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKY 413
           M +N  R    I P  F K C          + QQD  EFL                   
Sbjct: 379 MKINPSRYPEGIKPRSF-KNCIGQNNKEFTSNKQQDALEFL------------------- 418

Query: 414 YPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYS 473
                SY  N L       +K +++ +   G      + R  +E+ L+C RC +  YSY 
Sbjct: 419 -----SYFVNELD------KKLFKKELTNPG-----DLMRCYMEDRLQCLRCKHVKYSYQ 462

Query: 474 TFYVLSLAI 482
               + L +
Sbjct: 463 ANESIQLPL 471

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 81/203 (39%), Gaps = 52/203 (25%)

Query: 292 LSELSITGLQNPCNTCYINSIIQCLFGTTLFRD-LF--LTKKYRLFLNTNKYPKEVQLSR 348
           LSEL   GL N   TCY N+ +Q +      +  LF  L  KY   ++ +       +S 
Sbjct: 362 LSELKPRGLLNHGVTCYTNAAVQAMLHIPAVQHYLFDILRGKYNDIISPD------SVST 415

Query: 349 SIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDD---------QQDTQEFLLIVLA 399
            +    KKM+L   +    N      KKL   L   DD         Q+D+ E+ + +++
Sbjct: 416 VLAETSKKMWLPNNQLKEKNVTFINPKKLISRL---DDINCMMSEWQQEDSHEYFMSLMS 472

Query: 400 RIHEELSNENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI 459
           R+ E+                       +  K +K  E +VI D       I+ G L+ I
Sbjct: 473 RLQED-----------------------SVPKGKKLIE-SVIYD-------IFGGLLKQI 501

Query: 460 LKCQRCGNSSYSYSTFYVLSLAI 482
           + C+ CG  S +    Y LSL +
Sbjct: 502 VTCKSCGGISKTEQPIYDLSLHL 524

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 116/290 (40%), Gaps = 46/290 (15%)

Query: 368 NRFLK-MCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVS-----YD 421
           N  LK M K  R ++ +  DQ+D QEF   +LA +   + + N  K     ++      D
Sbjct: 224 NSLLKSMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDSTPIAKSNLPED 283

Query: 422 ANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI----------------LKCQRC 465
           A   Q N  +    Y   + T+ + P   ++   ++N+                + C +C
Sbjct: 284 ALVGQQNLGEVGTVY---IPTEQIDPNSILHDKSIQNLTPFRLMTPLDGITAERIGCLQC 340

Query: 466 G-NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524
           G N    YS F  LSL +P  ++ S       +KL   ++ ++  E + G    +C  C 
Sbjct: 341 GENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIEG---VECNRCA 391

Query: 525 ITDSKSKKEEITSQ---KKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNS--- 578
           +T + S   E   Q   K + +I                          ++ KK ++   
Sbjct: 392 LTAAHSHLMEQLDQFQKKPEGSIPEKLMNAVKDRVQQIQEVLAKPVIDDEDYKKLHTANM 451

Query: 579 -KKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNSTVITYPLILNI 623
            +K +  K +     PP+L IH++R  +D    + +KN++ + +   LN+
Sbjct: 452 VRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query: 297 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSI 350
           + GL+N  NTCY NS++QCL+     R           +N  KYP   + +  I
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR-----------VNVLKYPTRAEPTERI 140

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 448 IDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFT 507
           I  +++G + N +KC  C N + +   F+    AIP        S+  ++ ++D +  F 
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIP-------VSEDEELNVQDILRDFH 514

Query: 508 GDEELSGDNAWDCPNC 523
             E L+G N + C +C
Sbjct: 515 QREMLNGANKFYCDSC 530

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 575 KRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD--LTKKNSTVITYPLILNIILKNG---- 628
           K N  + + +K   F+  P I VIHLSR  Y+     +N   + +   L+          
Sbjct: 317 KNNVARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTS 376

Query: 629 -----KVIRYKLYGTVNHSGNLINGHY 650
                K +RY+L   V H+G+  +GHY
Sbjct: 377 SNEFTKRVRYRLKSIVIHTGSHYSGHY 403

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRD 324
           TGL N  NTCY+NS++Q  F  +  RD
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 84/233 (36%), Gaps = 59/233 (25%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLS--RSIYVLFK 355
            G +N   TCY+NS++Q  F T  FR L     Y +  N       V L+  R+ Y L  
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV----YGIPTNGENPNDSVPLALQRAFYQL-- 257

Query: 356 KMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYP 415
                   +  P   L++ +    D      Q D QE   I++ R+   +   NV     
Sbjct: 258 ------QVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKGTNVE---- 307

Query: 416 DLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTF 475
                                           ++ I+ G++++ ++C+     S     F
Sbjct: 308 ------------------------------GKLNEIFVGKMKSYIRCKNVDYESSRVEDF 337

Query: 476 YVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDS 528
           + + L +          KS +   E+ I +    E ++G+N +  P+  + D+
Sbjct: 338 WDIQLNVKNF-------KSLQESFENYIEV----ELMNGENQYAAPDFGLQDA 379

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 19/105 (18%)

Query: 585 KSLDFIVLPPILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNGKVIR- 632
           K + F   P +L + L RF YD     L K N        +   P +   +LK     + 
Sbjct: 381 KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 633 YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI 677
           YKL+G + H+G++  GHY +++      +       W  FDD+ +
Sbjct: 441 YKLHGVLVHTGDISTGHYYAMIKPTLEDQ-------WYRFDDEKV 478

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 42/102 (41%), Gaps = 19/102 (18%)

Query: 289 NDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLF----------------LTKKYR 332
           N L +E   TG+ N  NTCY+NS++Q  F  +  R+                  +  K R
Sbjct: 713 NSLPAENWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSIISKRR 772

Query: 333 LF---LNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFL 371
           +    +  N+  + VQ    +  L+  M  +  R + P R L
Sbjct: 773 IGGRQVGKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPKREL 814

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 11/109 (10%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFK 355
           S  G +N  NTCY+N+ +Q L+     RD+ L       ++++    E +  + I +  K
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDE-ETHKQIVIEMK 165

Query: 356 KMYLN----GGRAIIPNRFLKMCKKLRPDLNIPDD------QQDTQEFL 394
           + + N      ++++P   L   +K  P     D       QQD +E  
Sbjct: 166 RCFENLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELF 214

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 16/71 (22%)

Query: 259 VEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSIT--GLQNPCNTCYINSIIQCL 316
           + KPK E   IE ++ S                + +LS T  GL+N  NTCY+N+ +Q L
Sbjct: 77  IAKPKSENRFIEDLDPSVQ--------------MQKLSSTPIGLKNMGNTCYMNATLQAL 122

Query: 317 FGTTLFRDLFL 327
           +  T  R+  L
Sbjct: 123 YQITPLREAIL 133

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 580 KLTTIKSLDFIVLPPILVIHLSRFYYDLTK--KNSTVITYPLILNII---LKNG-----K 629
           K T +K       P IL++HLSR  ++     +NS  +T+   L+     ++N      K
Sbjct: 434 KSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVK 493

Query: 630 VIRYKLYGTVNHSGNLINGHY 650
            I+YKL   V H G    GHY
Sbjct: 494 PIKYKLKAMVKHEGTHSQGHY 514

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 590 IVLPPILVIHLSRFYYDLT-----------KKNSTVITYPLILNIILKNGKVIRYKLYGT 638
           + LP +LVIHLSR  ++             ++   +  Y  I N+ L   + I Y L   
Sbjct: 345 VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 639 VNHSGNLINGHY 650
           V H+G+   GHY
Sbjct: 405 VKHTGSHSRGHY 416

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 17/98 (17%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL--------------TKKYR 332
           D+N L  E    GL N  NTCY+NS++Q  F     R+  L              + K R
Sbjct: 699 DANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRR 758

Query: 333 LF---LNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIP 367
           +    ++ N+  + +Q    +  LF  M  +  R I P
Sbjct: 759 IGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITP 796

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 62/156 (39%), Gaps = 30/156 (19%)

Query: 279 AYNLPVIEDSNDL-LSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337
           +Y L   ++ + L + E+   G+ N  N C+++S++Q L     F D+      R  +N 
Sbjct: 354 SYTLDTAKNEDKLPIREIIPRGIINNANICFMSSVLQVLLYCAPFVDILNVVSTR-NMNA 412

Query: 338 NKYPKEVQLSRSIYVLFKKM---------------YLNGGRAIIPNRFLKMCKKLRPD-- 380
                  +L  +   ++KK                   G +   P  +  + + + PD  
Sbjct: 413 KSGSSSAKLLDACLTIYKKFDKANYEKEKEKESEKEKPGSKKSSPPAYASITEAVNPDEF 472

Query: 381 ----LNIP-------DDQQDTQEFLLIVLARIHEEL 405
                 IP         Q+D +EFL  +L ++HEEL
Sbjct: 473 YRSLSTIPKFKDLRWGHQEDAEEFLTHLLDQLHEEL 508

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 593 PPILVIHLSRFYYDLTK--KNSTVITYPLILNI---ILKNG-----KVIRYKLYGTVNHS 642
           P IL++HLSR  ++ T   +NS  + +   L+     ++N      K I+YKL   V H 
Sbjct: 445 PEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKYKLKSMVKHQ 504

Query: 643 GNLINGHY 650
           G    GHY
Sbjct: 505 GTHSQGHY 512

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKM 357
            GL N  NTCY+NS++Q  F     RD  L  +Y++ +    +  E+ L++ +    +K 
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL--QYQMTM--KHFQNEIVLNKQL----EKR 813

Query: 358 YLNGGRAI 365
              GGR +
Sbjct: 814 RRIGGREV 821

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 11/106 (10%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358
           G +N  NTCY+N+ +Q L+     R++ L       ++ N    E +  + I +  K+ +
Sbjct: 110 GFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDE-ETHKQIVIEMKRCF 168

Query: 359 LN----GGRAIIPNRFLKMCKKLRPDLNIPD------DQQDTQEFL 394
            N      ++++P   L   +K  P     D       QQD +E  
Sbjct: 169 ENLQNKSFKSVLPIVLLNTLRKCYPQFAERDPQGGFYKQQDAEELF 214

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 60/141 (42%), Gaps = 38/141 (26%)

Query: 592  LPPILVIHLSRFYY-DLTKKNSTVITYP-------------------LILNIILKNGKVI 631
            LP +L+IHL RF + + T K++++  Y                    +I    + NGK +
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 632  R-----YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQV--WVTFDDDYIQQHRKD 683
                  Y+L G V H G +   GHYT+ +          +++V  W   DD  + +  KD
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTADI---------YHKEVDKWYRIDDVTVTELEKD 996

Query: 684  RNNFEAGKTEMSSDEVYVLFY 704
             +  + G+    S   Y+L Y
Sbjct: 997  -DVLKGGENSTDSRTAYILMY 1016

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 114/292 (39%), Gaps = 50/292 (17%)

Query: 368 NRFLK-MCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVS---YDAN 423
           NR LK M K  R ++ +  DQ+D QEF   +LA +   + + N  K     ++     A+
Sbjct: 224 NRLLKAMSKSPRKNMLLGYDQEDAQEFFQNLLAELENNIKSLNSEKLDTTPIAKTELPAD 283

Query: 424 ALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI----------------LKCQRCG- 466
           AL V  +  EK     + T+ + P   ++   ++N                 + C +CG 
Sbjct: 284 AL-VGQNNLEKVGTVYIPTEQIDPNSILHDKSIKNFTPYKLITPLDGITAERIGCLQCGE 342

Query: 467 NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRIT 526
           N    YS F  LSL +P  ++         +KL   ++ ++  E + G    +C  C +T
Sbjct: 343 NGGIRYSVFSGLSLNLPNENIGC------TLKLSQLLSDWSKPEIIEG---VECNRCALT 393

Query: 527 DSKS-----------KKEEITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKK 575
            + S           K E    +K  + +                         T N  +
Sbjct: 394 AAHSHLLGQLKEFRKKPEGSIPEKLINAVEDRVQQIEEVLAKPVIDDEDYEKLHTANMVR 453

Query: 576 RNSKKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNSTVITYPLILNI 623
           + SK    + S      PP+L IH++R  +D    + +KN++ + +   LN+
Sbjct: 454 KCSKSKQILISRP----PPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 81/397 (20%), Positives = 146/397 (36%), Gaps = 82/397 (20%)

Query: 296 SITGLQNPCNTCYINSIIQCLFGTT---LFRDLFLTKKYRLFL--------------NTN 338
           +I GL N  NTC++N ++Q +  +     F D  +  K +L                NT+
Sbjct: 83  NIGGLVNDGNTCFMNCVLQSMASSKELLKFLDEEIACKAKLDEDQSNGDDVNNEKPHNTS 142

Query: 339 KYPK--------------EVQLSRSIYVLFKKM---YLNGGRAIIPNRFLK-MCKKLRPD 380
           K  +              +V  S ++  L  K+   Y         N+ LK M K    +
Sbjct: 143 KQQQKREEEAKSEGETVPDVTFSAALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKN 202

Query: 381 LNIPDDQQDTQEFLLIVLARIH---EELSNENVVKYY------PDLVSYDANALQ----- 426
           + +  DQ+D QEF   +L+ +    + L N  + K+       P+        L      
Sbjct: 203 ILLGYDQEDAQEFFQTMLSELEKNAKSLDNTTIDKHAILEKDLPETAVIGQARLDHVGAV 262

Query: 427 -----------VNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNS-SYSYST 474
                      + P   EK++ +  +   ++P+D I    L   + C +CG +    YS 
Sbjct: 263 YIPTEQVTPNLIPPGSKEKYFTKFKL---ITPLDGI----LAERIGCLQCGETGGIRYSV 315

Query: 475 FYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEE 534
              LSL +P  ++ S       +KL D +  +   E + G     C    + D   ++ +
Sbjct: 316 SSGLSLNLPSDNMGS------SLKLSDLLKDYIKPEIIEGVECNRCALIAVRDHLKEQLQ 369

Query: 535 ITSQKKKSTIFGFXXXXXXXXXXXXXXXXXXXXXXTKNAKKRNSKKLTTIKSLDFIVL-- 592
               KK + I                          +  KK +++ +    S    VL  
Sbjct: 370 QYEDKKANAIPAKLCQAFQSRIQELEKVLSKPVIDDEEYKKLHTENMVRKSSKSKQVLIS 429

Query: 593 --PPILVIHLSRFYYD----LTKKNSTVITYPLILNI 623
             PP+L IH++R  +D    + +KN+  + +   LN+
Sbjct: 430 RPPPLLAIHINRSVFDPRTFMIRKNNARVLFKSRLNL 466

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           G +N  NTCY+N+ +Q L+     RD+ L
Sbjct: 110 GFKNMGNTCYLNATLQALYRVDDLRDMIL 138

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 51/140 (36%), Gaps = 35/140 (25%)

Query: 592 LPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIR------------------- 632
           LP + +I L RF +      S ++ Y      + K  K I                    
Sbjct: 647 LPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAIPDATISSVHSSF 706

Query: 633 -------YKLYGTVNHSG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684
                  YKL G V H G +   GHYT  V +E      LN+  W   DD  +Q+  KD 
Sbjct: 707 YKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQET-----LNK--WYRIDDTNVQEIEKDE 759

Query: 685 NNFEAGKTEMSSDEVYVLFY 704
              + G+    S   Y+L Y
Sbjct: 760 -VLKGGEEGNDSRTAYILIY 778

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           D N L  E   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL 765

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 52  INQEMEALTAFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRD 111
           I Q   A ++ ++  +Y   I  ++  FQT  +L  ++A  K +  DE    Y+ +   D
Sbjct: 726 IAQNHGATSSILMNSFYSNSIDSRAKVFQTAGSLPLAFAVAKANGNDELAAYYLEEAGLD 785

Query: 112 ESTVIVDRYLAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNK 156
           E  V++   +  SN +     +  A + PL   P+  A LS   K
Sbjct: 786 EQDVVLPDGITPSNSV-----KTPAITEPLTSWPLKEAELSYFEK 825

>SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {ON}
           similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005C SAD1 Conserved zinc-finger domain protein
           involved in pre-mRNA splicing required for assembly of
           U4 snRNA into the U4/U6 particle
          Length = 472

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 10/88 (11%)

Query: 583 TIKSLDFIVLPPILVIHLSRFYYDL----TKKNSTVITYPLILNIILKNGKVIRYKLYGT 638
           +++    + LPP L++H++RF  +L      +N TV+  P  + +   NG   +YKL   
Sbjct: 353 SVRKYKILKLPPYLMLHINRFEANLELKIKNRNQTVVELPQTMEL---NGA--KYKLISN 407

Query: 639 VNHSGNLINGHYTSVVNKEKSH-EIGLN 665
           V H    ++ +  ++   +KS  +I LN
Sbjct: 408 VVHEAAKVDNNNDNIEVDDKSEWKIQLN 435

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 15/133 (11%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT---------KKYRLFLNT 337
           DSN L     I GL N  NTC++NS++Q L  +    D   T         ++     + 
Sbjct: 117 DSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQEQEQEQEQVGDE 176

Query: 338 NKYPKEVQLSRSIYVLFKKM---YLNGGRAIIPNRFLKMCKKLRPDLN--IPDDQQDTQE 392
            K   ++  + S+  L  ++   Y         N+ LK  K   P+ N  +  DQ+D QE
Sbjct: 177 KKEDVDIGFTLSLNELLSQLNAKYYKERPYFKTNKLLKTMKNA-PNKNMLLGYDQEDAQE 235

Query: 393 FLLIVLARIHEEL 405
           F   +L+ + + L
Sbjct: 236 FFQNILSELEKNL 248

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           D N L  E   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 49/134 (36%), Gaps = 27/134 (20%)

Query: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFL--TKKYRLF-----------------LNTN 338
            G+ N  NTCY+NS++Q  F     R+  L  +K    F                 ++ N
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKTIEDFKTLENNASTVRRIGGREVSNN 772

Query: 339 KYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCK--------KLRPDLNIPDDQQDT 390
           +  + +Q    +  LF  M  +  R + P R L            +   + N P  QQD 
Sbjct: 773 EVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAYLAFAPSNIEVEFETNENQPATQQDN 832

Query: 391 QEFLLIVLARIHEE 404
            E     L +  +E
Sbjct: 833 PEVTTAELGQDKDE 846

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327
           D N L  E   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 724 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323
           D N L  E   TG+ N  NTCY+NS++Q  F     R
Sbjct: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR 761

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 74/183 (40%), Gaps = 29/183 (15%)

Query: 368 NRFLK-MCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELS--NENVVKYYPDLVSYDANA 424
           NR LK M K  R ++ +  DQ+D QEF   +LA +   +   N   +   P   S   + 
Sbjct: 224 NRLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNSETLDTTPTAKSDLPDD 283

Query: 425 LQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI----------------LKCQRCG-N 467
             V     ++     + T+ + P   ++   ++N                 + C +CG N
Sbjct: 284 ALVGQRDLDRVGTVYIPTEQIDPNSILHDKSIKNFTPYKLMTPLDGITAERIGCLQCGEN 343

Query: 468 SSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITD 527
               YS F  LSL +P  ++ S       +KL   ++ ++  E + G    +C  C +T 
Sbjct: 344 GGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIEG---VECNRCALTA 394

Query: 528 SKS 530
           + S
Sbjct: 395 AHS 397

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 11/72 (15%)

Query: 590 IVLPPILVIHLSRFYYDLTK-----------KNSTVITYPLILNIILKNGKVIRYKLYGT 638
           + LP ILV+HLSR  ++              +   +  Y L  N  +   + ++Y L   
Sbjct: 337 VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 639 VNHSGNLINGHY 650
           V H+G+   GHY
Sbjct: 397 VKHTGSHSRGHY 408

>AER110W Chr5 (842596..846513) [3918 bp, 1305 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR425W (TUS1)
          Length = 1305

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 12/116 (10%)

Query: 436 YERNVITDGLS-PIDHIYRGQLENILKCQRCGNSSYSYSTFYV------LSLAIPKLSLY 488
           Y  N  T  L  P D IY  ++ N        N S+++ TF V      +S  +    ++
Sbjct: 827 YRTNASTMALDVPDDLIYSFKVRNT-----ATNDSFTFHTFTVEERDAWISAIVESFRIH 881

Query: 489 SFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTI 544
           + T+  R  KL    +LF  DE  +  N    P   + D   K  + T ++KK+ +
Sbjct: 882 TETNDQRVFKLHVLSDLFKYDERQAPTNLLVAPEGSVIDVALKDYKKTQREKKTPV 937

>Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W
           (REAL)
          Length = 1159

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 260 EKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNT 306
           E P  EE + EA E  +    + P +E  N+LL+E S  G ++P  T
Sbjct: 711 EPPANEELQEEATEDESLVVISSPQVEKKNELLNEGSFVGYEDPVRT 757

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,203,708
Number of extensions: 3503721
Number of successful extensions: 12710
Number of sequences better than 10.0: 258
Number of HSP's gapped: 12704
Number of HSP's successfully gapped: 440
Length of query: 717
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 600
Effective length of database: 40,065,477
Effective search space: 24039286200
Effective search space used: 24039286200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)