Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR097W (PCK1)5.708ON54954929040.0
Smik_11.3615.708ON54954828440.0
Skud_11.3375.708ON54954928370.0
Suva_11.3345.708ON54854827990.0
KNAG0C066405.708ON54754426260.0
TDEL0B021205.708ON54854725680.0
NDAI0E050805.708ON55155025590.0
NCAS0A031605.708ON55255125500.0
CAGL0H06633g5.708ON54454525140.0
SAKL0E15048g5.708ON54254724780.0
ZYRO0B16456g5.708ON54854824760.0
KAFR0H001605.708ON54954824580.0
KLLA0A00484g5.708ON54354824250.0
Ecym_40135.708ON54254724090.0
AFR292W5.708ON54154723640.0
KLTH0E00902g5.708ON54454623470.0
Kwal_55.196635.708ON54454623040.0
Kpol_1043.755.708ON55851522820.0
TBLA0E017005.708ON57655022800.0
TPHA0E001705.708ON57853122720.0
Kwal_55.19665singletonOFF2142103661e-39
Kwal_55.19664singletonOFF99992462e-24
Kwal_55.19667singletonOFF85641862e-16
Suva_7.275singletonON961131704e-14
TDEL0C063501.67ON69397790.60
Smik_15.4038.637ON86167733.2
YDR102CsingletonOFF11052674.3
Smik_5.3488.242ON112493715.7
TBLA0G030703.258ON114739715.7
TBLA0B001002.1ON171766715.9
KAFR0C052205.500ON149988707.7
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= YKR097W
         (1650 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1123   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1100   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1097   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1082   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1016   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   993   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   990   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   986   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   972   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   959   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   958   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   951   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   938   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   932   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   915   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   908   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   892   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   883   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   882   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   879   0.0  
Kwal_55.19665 s55 (71748..72392) [645 bp, 214 aa] {OFF} [contig ...   145   1e-39
Kwal_55.19664 s55 (71422..71721) [300 bp, 99 aa] {OFF} [contig 1...    99   2e-24
Kwal_55.19667 s55 (72322..72579) [258 bp, 85 aa] {OFF} [contig 1...    76   2e-16
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    70   4e-14
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    35   0.60 
Smik_15.403 Chr15 (699008..701593) [2586 bp, 861 aa] {ON} YOR217...    33   3.2  
YDR102C Chr4 complement(657648..657980) [333 bp, 110 aa] {OFF} D...    30   4.3  
Smik_5.348 Chr5 (541318..544692) [3375 bp, 1124 aa] {ON} YER176W...    32   5.7  
TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {...    32   5.7  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    32   5.9  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    32   7.7  

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
            PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
            gluconeogenesis, catalyzes early reaction in carbohydrate
            biosynthesis, glucose represses transcription and
            accelerates mRNA degradation, regulated by Mcm1p and
            Cat8p, located in the cytosol
          Length = 549

 Score = 1123 bits (2904), Expect = 0.0
 Identities = 549/549 (100%), Positives = 549/549 (100%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL
Sbjct: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61   IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361  ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY
Sbjct: 421  PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD
Sbjct: 481  ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 1621 VLAAGPQFE 1647
            VLAAGPQFE
Sbjct: 541  VLAAGPQFE 549

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
            (REAL)
          Length = 549

 Score = 1100 bits (2844), Expect = 0.0
 Identities = 536/548 (97%), Positives = 542/548 (98%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSKMN TVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1    MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61   IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIFDAIKFG+VLENV YDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301  EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361  ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            PIRYATMLA KMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY
Sbjct: 421  PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            E+LPIFNLQVPTKV GVPAELLNPAKNWSQGE+KY+GAVT+LA LFV+NFKIYQDRATPD
Sbjct: 481  ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 1621 VLAAGPQF 1644
            VLAAGPQF
Sbjct: 541  VLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
            (REAL)
          Length = 549

 Score = 1097 bits (2837), Expect = 0.0
 Identities = 534/549 (97%), Positives = 543/549 (98%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSKM+AT GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1    MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSGVKTGRSPKDKRIVEE TSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61   IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIFDAIKFG+VLENV YDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301  EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361  ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            PIRYATMLATKMS HK+NAYLINTGW+GSSYVSGGKRCPLKYTRAILDSIHDGSLANETY
Sbjct: 421  PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            E+LPIFNLQVPTKV GVPAELLNPAKNWSQGE+KY+G+VTNLANLFV+NFKIYQDRATPD
Sbjct: 481  ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 1621 VLAAGPQFE 1647
            VLAAGPQFE
Sbjct: 541  VLAAGPQFE 549

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
            (REAL)
          Length = 548

 Score = 1082 bits (2799), Expect = 0.0
 Identities = 526/548 (95%), Positives = 538/548 (98%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSKMNA  G+TS VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1    MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61   IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            +NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLSAEKEP
Sbjct: 241  KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIFDAI+FG+VLENV YDE SHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301  EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361  ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            PIRYATMLATKMSQH+ANAYLINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLA  +Y
Sbjct: 421  PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            E+LPIFNLQVPTKVNGVPAELLNPAKNWSQGE+KY+GAVTNLANLFV+NFKIYQDRATPD
Sbjct: 481  ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 1621 VLAAGPQF 1644
            VLAAGPQF
Sbjct: 541  VLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5.708
            YKR097W
          Length = 547

 Score = 1016 bits (2626), Expect = 0.0
 Identities = 489/544 (89%), Positives = 515/544 (94%)
 Frame = +1

Query: 7    PSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIA 186
            PSK N+       VEQKIR+EL LS EV TIRRNAPAAVLYED L E KTVI+SSGALIA
Sbjct: 2    PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61

Query: 187  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 366
            YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 62   YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121

Query: 367  AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 546
            AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 122  AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181

Query: 547  QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 726
            QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+N
Sbjct: 182  QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241

Query: 727  GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 906
            GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 242  GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301

Query: 907  FDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 1086
            FDAI+FGSVLENV YDEKSH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 302  FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361

Query: 1087 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 1266
            LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 362  LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421

Query: 1267 RYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYET 1446
            RYA MLA KMS+HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA   YE+
Sbjct: 422  RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481

Query: 1447 LPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVL 1626
            LPIFNL+VPT VNGVP ELLNPAKNW+QGE+KY GAV+NLA+LFV+NFKIYQD+ATPDVL
Sbjct: 482  LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541

Query: 1627 AAGP 1638
            AAGP
Sbjct: 542  AAGP 545

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
            Anc_5.708 YKR097W
          Length = 548

 Score =  993 bits (2568), Expect = 0.0
 Identities = 474/547 (86%), Positives = 511/547 (93%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSKMN +V   SEVEQKIR EL+LS+EV TIRRNAPAA+LYED L E KT I+SSGAL
Sbjct: 1    MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61   IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121  VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181  HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            Q  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 241  QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EI++AIKFGS+LENV+YD K+  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301  EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361  VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            PIRYATMLA KMS+H+ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E+Y
Sbjct: 421  PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLP FNL +PTKVNGVP ELLNP+KNW +GE+KY  AV NLA LFV+NFKIYQDRATP+
Sbjct: 481  ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 1621 VLAAGPQ 1641
            VLAAGPQ
Sbjct: 541  VLAAGPQ 547

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5.708
            YKR097W
          Length = 551

 Score =  990 bits (2559), Expect = 0.0
 Identities = 474/550 (86%), Positives = 515/550 (93%), Gaps = 3/550 (0%)
 Frame = +1

Query: 1    MSPSKMNATV---GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSS 171
            MSP K + T      +++VEQKIRQEL LS +VTTIRRNAPAA+LYED L E  T+ISS+
Sbjct: 1    MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 172  GALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDH 351
            GAL+AYSG KTGRSP+DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH
Sbjct: 61   GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 352  IYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFP 531
            +YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFP
Sbjct: 121  LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 532  ANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 711
            AN HTQDMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 181  ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 712  QGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAE 891
            QGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS E
Sbjct: 241  QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 892  KEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHP 1071
            KEPEIF+AIK+GS+LENVIYD K+ VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP
Sbjct: 301  KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 1072 KNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 1251
             NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL
Sbjct: 361  SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 1252 ALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAN 1431
            ALHPIRYATMLA K+S+H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 
Sbjct: 421  ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 1432 ETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRA 1611
            + +ETLP+FNLQVPT VN VP ELLNPAKNW+QGE+KY  AV+NLA+LFV+NFKIYQD+A
Sbjct: 481  QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 1612 TPDVLAAGPQ 1641
            TP+VLAA P+
Sbjct: 541  TPEVLAAAPR 550

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
            Anc_5.708 YKR097W
          Length = 552

 Score =  986 bits (2550), Expect = 0.0
 Identities = 474/551 (86%), Positives = 516/551 (93%), Gaps = 4/551 (0%)
 Frame = +1

Query: 1    MSPSKMNAT----VGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISS 168
            MSP K++++    +  +  VEQ IR+EL LS++VTTIRRNAPAAVLYED L E KTVI+S
Sbjct: 1    MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 169  SGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRD 348
            SGALIAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 61   SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 349  HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQF 528
            H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 121  HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 529  PANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 708
            PAN +TQDMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 181  PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 709  NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSA 888
            NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSA
Sbjct: 241  NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 889  EKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSH 1068
            EKEPEIF+AIK+GS+LENVIYD+ + VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSH
Sbjct: 301  EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 1069 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 1248
            PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 361  PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 1249 LALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 1428
            LALHPIRYATMLA K+S H A+A+LINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 421  LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 1429 NETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDR 1608
             ++YETLPIFNL VPT VNGVP E+LNPAKNWS+GE+KY  AV+ L +LFV+NFK YQDR
Sbjct: 481  KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 1609 ATPDVLAAGPQ 1641
            ATPDVLAAGPQ
Sbjct: 541  ATPDVLAAGPQ 551

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
            similar to uniprot|P10963 Saccharomyces cerevisiae
            YKR097w PCK1
          Length = 544

 Score =  972 bits (2514), Expect = 0.0
 Identities = 469/545 (86%), Positives = 505/545 (92%)
 Frame = +1

Query: 7    PSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIA 186
            PSK +    S + VE++IR EL LS EVT IRRNAPAAVLY+D LKE KTVISS+GALIA
Sbjct: 2    PSKSSV---SGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIA 58

Query: 187  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 366
            YSG KTGRSPKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VD
Sbjct: 59   YSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVD 118

Query: 367  AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 546
            AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  T
Sbjct: 119  AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANART 178

Query: 547  QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 726
            QDM+SK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+N
Sbjct: 179  QDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKN 238

Query: 727  GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 906
            GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEI
Sbjct: 239  GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEI 298

Query: 907  FDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 1086
            FDAI+FGSVLENVIYD +SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIIL
Sbjct: 299  FDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIIL 358

Query: 1087 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 1266
            LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+
Sbjct: 359  LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPM 418

Query: 1267 RYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYET 1446
            RYATMLA KM +H ANA+LINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLA   +E+
Sbjct: 419  RYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478

Query: 1447 LPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVL 1626
            LPIFNLQVP  V GVP+ELLNPA+NWS+GE+KY+ AV+ LA LFV+NFK YQD+AT DVL
Sbjct: 479  LPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVL 538

Query: 1627 AAGPQ 1641
            AAGPQ
Sbjct: 539  AAGPQ 543

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
            similar to uniprot|P10963 Saccharomyces cerevisiae
            YKR097W PCK1 Phosphoenolpyruvate carboxykinase key enzyme
            in gluconeogenesis catalyzes early reaction in
            carbohydrate biosynthesis glucose represses transcription
            and accelerates mRNA degradation regulated by Mcm1p and
            Cat8p located in the cytosol
          Length = 542

 Score =  959 bits (2478), Expect = 0.0
 Identities = 462/547 (84%), Positives = 499/547 (91%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSK  A+       EQ+IR EL LSDEV TIRRNAPAA+LYED LKE KT ISSSGAL
Sbjct: 1    MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSG KTGRSP+DKRIV+E TS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 55   IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 115  VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175  HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
             + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCI LSAEKEP
Sbjct: 235  ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EI++AIKFGSVLENVIY+ ++  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 295  EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355  VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P++YATMLA KM++H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA E Y
Sbjct: 415  PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLP FNL++PT+VN VP+ELLNPAKNW +GE+KY  AV NLA LFV+NFK YQDRAT  
Sbjct: 475  ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534

Query: 1621 VLAAGPQ 1641
            VL+AGPQ
Sbjct: 535  VLSAGPQ 541

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
            similar to uniprot|P10963 Saccharomyces cerevisiae
            YKR097W PCK1 Phosphoenolpyruvate carboxykinase key enzyme
            in gluconeogenesis catalyzes early reaction in
            carbohydrate biosynthesis glucose represses transcription
            and accelerates mRNA degradation regulated by Mcm1p and
            Cat8p located in the cytosol
          Length = 548

 Score =  958 bits (2476), Expect = 0.0
 Identities = 454/548 (82%), Positives = 497/548 (90%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSK+   +  T+EVE++IR+ELAL  EV TIR NAPAA LYEDGLKE KT + SSGAL
Sbjct: 1    MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
             AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61   AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121  IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181  NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241  ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EI++AIKFGSVLENV++D  +  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301  EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361  VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P+RYATMLA KM QH ANA+L+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+   Y
Sbjct: 421  PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLPIFNL  P KVNGVP  LLNPAK+W +G +KY  AV  LA  F +NFKIYQD+ATPD
Sbjct: 481  ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 1621 VLAAGPQF 1644
            VLAAGPQF
Sbjct: 541  VLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
            Anc_5.708 YKR097W
          Length = 549

 Score =  951 bits (2458), Expect = 0.0
 Identities = 453/548 (82%), Positives = 502/548 (91%), Gaps = 1/548 (0%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENK-TVISSSGA 177
            MSPSK+   +   + VEQKIRQEL LS  VTTIRRNAP +VLYED LK+ K T+ISS+GA
Sbjct: 1    MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 178  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 357
            LIAYSG KTGR PKDKRIVEE  SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 61   LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 358  IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 537
            IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 121  IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 538  LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 717
             HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 181  FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 718  IQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKE 897
            I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 241  IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 898  PEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 1077
            PEIF++IKFGS+LENV+YD KS  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 301  PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 1078 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 1257
            IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 361  IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 1258 HPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANET 1437
            HP++YATMLA KM +HKANA+LINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL  E+
Sbjct: 421  HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 1438 YETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATP 1617
            +ETLPIFNL+VP  VN VP +LLNP+KNW +GE KY GAV  L+ LF++NFK Y+D+AT 
Sbjct: 481  FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 1618 DVLAAGPQ 1641
            +VLAAGP+
Sbjct: 541  EVLAAGPR 548

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
            highly similar to uniprot|P10963 Saccharomyces cerevisiae
            YKR097W PCK1 Phosphoenolpyruvate carboxykinase key enzyme
            in gluconeogenesis catalyzes early reaction in
            carbohydrate biosynthesis glucose represses transcription
            and accelerates mRNA degradation regulated by Mcm1p and
            Cat8p located in the cytosol
          Length = 543

 Score =  938 bits (2425), Expect = 0.0
 Identities = 450/548 (82%), Positives = 496/548 (90%), Gaps = 1/548 (0%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSP+K      + +  E+ IR EL LS EV TIRRNAPAA+LYED LKE  T IS++GAL
Sbjct: 1    MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 55   IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 115  VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175  HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            Q+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+ LSAEKEP
Sbjct: 235  QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIF+AIKFGSVLEN+IYD  +  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 295  EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 355  VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P++YATMLA KM++H ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E Y
Sbjct: 415  PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474

Query: 1441 ETLPIFNLQVPTKV-NGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATP 1617
            E LPIFNLQ+P  V + VPA LLNP+KNW++GE+KY   V +LANLFV+NFK YQD+AT 
Sbjct: 475  EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534

Query: 1618 DVLAAGPQ 1641
             VLAAGPQ
Sbjct: 535  QVLAAGPQ 542

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
            similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  932 bits (2409), Expect = 0.0
 Identities = 447/547 (81%), Positives = 491/547 (89%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSK+          E+KIR EL LS  V  IRRNAPAA+LYED L E  T ISS+GAL
Sbjct: 1    MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSG KTGRSPKDKRIV+EPTS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 55   IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 115  VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 175  HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
              GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 235  AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIF+AI++GSVLENV+Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 295  EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355  VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P++YATMLA KMSQH ANA+LINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLAN  Y
Sbjct: 415  PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLP+F L +P  V GVP+ELLNP++NW +GE KY  AVT+LANLFVQNFKIYQD+AT +
Sbjct: 475  ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534

Query: 1621 VLAAGPQ 1641
            VL AGPQ
Sbjct: 535  VLYAGPQ 541

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  915 bits (2364), Expect = 0.0
 Identities = 439/547 (80%), Positives = 487/547 (89%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSK+  T       E+KIR EL LS  V TIRRNAPAAVLYED L E KT ISS+GAL
Sbjct: 1    MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IAYSG KTGRSPKDKRIV+EPTS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 55   IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 115  VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 175  HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
             N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP
Sbjct: 234  PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIF+AIK+GSVLENV+YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 294  EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 354  VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P++YATMLA KMSQH A+A+LINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA   Y
Sbjct: 414  PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLP+F L +P  V GVPAELLNPAKNW +GE KY  AV+ LA+ F +NFKIYQD+AT +
Sbjct: 474  ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533

Query: 1621 VLAAGPQ 1641
            V+ AGPQ
Sbjct: 534  VVRAGPQ 540

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
            highly similar to uniprot|P10963 Saccharomyces cerevisiae
            YKR097W PCK1 Phosphoenolpyruvate carboxykinase key enzyme
            in gluconeogenesis catalyzes early reaction in
            carbohydrate biosynthesis glucose represses transcription
            and accelerates mRNA degradation regulated by Mcm1p and
            Cat8p located in the cytosol
          Length = 544

 Score =  908 bits (2347), Expect = 0.0
 Identities = 434/546 (79%), Positives = 484/546 (88%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSP+K    V +    +  IRQELAL +EV TIRRNAPAA+LYED LKENKT I+SSGAL
Sbjct: 1    MSPTKTRNHVSA----KDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+YI
Sbjct: 57   IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 117  VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 177  HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 237  RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIF+AIKFGSVLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKNI
Sbjct: 297  EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357  VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P++YATMLA KMSQH+ANA+LINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA E +
Sbjct: 417  PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLP F L VP  VN VP  +LNPAKNW +GE+KY+  V  LA LF +NFK YQDRA+ D
Sbjct: 477  ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536

Query: 1621 VLAAGP 1638
            V++AGP
Sbjct: 537  VISAGP 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
            YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
            [contig 159] FULL
          Length = 544

 Score =  892 bits (2304), Expect = 0.0
 Identities = 423/546 (77%), Positives = 480/546 (87%)
 Frame = +1

Query: 1    MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 180
            MSPSK+   V     V+ +IR+ELAL +EV TIRRNAPAA+LYED LKENKT IS+SGAL
Sbjct: 1    MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56

Query: 181  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 360
            IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 57   IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116

Query: 361  VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 540
            VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 117  VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176

Query: 541  HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 720
            HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 177  HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236

Query: 721  QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 900
            ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 237  RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 901  EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 1080
            EIF+AI+FGSVLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 297  EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356

Query: 1081 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 1260
            +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357  VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 1261 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 1440
            P++YATMLA KMS HKA+A+LINTGWTG S+V GG RCPLKYTRAILD+IHDG+LA E Y
Sbjct: 417  PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476

Query: 1441 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 1620
            ETLP FNL +P  VN VP+ +LNPA++W  GE+KY+  V  LANLFV+NFK Y+  A+ +
Sbjct: 477  ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536

Query: 1621 VLAAGP 1638
            ++ AGP
Sbjct: 537  IMCAGP 542

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
            (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  883 bits (2282), Expect = 0.0
 Identities = 416/515 (80%), Positives = 461/515 (89%)
 Frame = +1

Query: 94   TIRRNAPAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGP 273
            TI+RN P A LYEDGLKE+ T +SS+GAL+AYSGVKTGRSPKDKRIVEEP+SKD IWWGP
Sbjct: 42   TIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGP 101

Query: 274  VNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNM 453
            VNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YHALFM NM
Sbjct: 102  VNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNM 161

Query: 454  LIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEM 633
            LIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILGTEYAGEM
Sbjct: 162  LIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEM 221

Query: 634  KKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDD 813
            KKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPHR LIGDD
Sbjct: 222  KKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDD 281

Query: 814  EHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSI 993
            EHCWSDHGVFNIEGGCYAKCI L+ EKEPEIF+AIKFGSVLEN +YDE +HVVDYDDS I
Sbjct: 282  EHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRI 341

Query: 994  TENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYT 1173
            TENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMYHFISGYT
Sbjct: 342  TENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYT 401

Query: 1174 SKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHKANAYLINTGWTGSSY 1353
            SKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+ HKA+A+LINTGWTG+SY
Sbjct: 402  SKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASY 461

Query: 1354 VSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQG 1533
             +GGKRCPLKYTRAILD+IH+GSLANE YETLP+FNL +P  V  VP+ELLNP+K WS  
Sbjct: 462  TAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDP 521

Query: 1534 ESKYRGAVTNLANLFVQNFKIYQDRATPDVLAAGP 1638
            +  Y  AV  L +LFVQNF IYQD+AT DV+AAGP
Sbjct: 522  DVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGP 556

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
            Anc_5.708 YKR097W
          Length = 576

 Score =  882 bits (2280), Expect = 0.0
 Identities = 421/550 (76%), Positives = 475/550 (86%), Gaps = 4/550 (0%)
 Frame = +1

Query: 4    SPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALI 183
            +PS     +    ++  ++  + +    +  I+ N  AA+LYED LKE KTVISSSGALI
Sbjct: 26   NPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALI 85

Query: 184  AYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIV 363
            AYSG KTGRSPKDKRIV E  SKD +WWGPVNKPCSE+TW INRER  DYL TR ++Y++
Sbjct: 86   AYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVI 145

Query: 364  DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLH 543
            DA+ GWDP+YR+KVRVVCARAYHALFMTNMLIRPTEEEL +F EPDFTVWNAG F AN +
Sbjct: 146  DAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSY 205

Query: 544  TQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQ 723
            T DM+SK+++EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+
Sbjct: 206  TADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIE 265

Query: 724  NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPE 903
              DVT+FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPE
Sbjct: 266  KKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPE 325

Query: 904  IFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNII 1083
            IFDAI+FGSVLENV Y+E +H VDY+D +ITENTRCAYPIDYI SAKIPCLA+SHPKN+I
Sbjct: 326  IFDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLI 385

Query: 1084 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 1263
            LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP
Sbjct: 386  LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP 445

Query: 1264 IRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYE 1443
            I YATMLA KM Q+K+NA+LINTGWTGSSY +GG RCPLKYTRAILD+IHDG+LANE YE
Sbjct: 446  ITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYE 505

Query: 1444 TLPIFNLQVPTKVNGVPAELLNPAKNWSQGESK----YRGAVTNLANLFVQNFKIYQDRA 1611
            TLP+FNLQ+PT VNGVP E+LNP  +W+   +K    Y  AV  LA LFV+NFKIYQD+A
Sbjct: 506  TLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKA 565

Query: 1612 TPDVLAAGPQ 1641
            T DVLAAGPQ
Sbjct: 566  TDDVLAAGPQ 575

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
            Anc_5.708 YKR097W
          Length = 578

 Score =  879 bits (2272), Expect = 0.0
 Identities = 418/531 (78%), Positives = 467/531 (87%)
 Frame = +1

Query: 46   VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDK 225
            +E+ I   L+ + ++  I+RN P A LYEDGLKENKT +SS+GALIAYSGVKTGRSPKDK
Sbjct: 47   LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105

Query: 226  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 405
            RIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DAF GWDP+YRIK+
Sbjct: 106  RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165

Query: 406  RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 585
            RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T DMSSK+++EINF
Sbjct: 166  RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225

Query: 586  KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTG 765
            K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTG
Sbjct: 226  KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285

Query: 766  KTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENV 945
            KTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP+IF+AIKFGSVLEN 
Sbjct: 286  KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345

Query: 946  IYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 1125
            IYDE++H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILLTCDASGVLPPVS
Sbjct: 346  IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405

Query: 1126 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQH 1305
            KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA KM +H
Sbjct: 406  KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465

Query: 1306 KANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVN 1485
            KANA+L+NTGWTGSSYVSGG RCPLKYTRAILD+IHDGSL NE YETLPIFNLQ+P   N
Sbjct: 466  KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525

Query: 1486 GVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVLAAGP 1638
            GVP+ELLNPA +W+     Y  AV  L  LF +NFK Y+D+AT +V+ AGP
Sbjct: 526  GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kwal_55.19665 s55 (71748..72392) [645 bp, 214 aa] {OFF} [contig
           159] FULL
          Length = 214

 Score =  145 bits (366), Expect = 1e-39
 Identities = 78/210 (37%), Positives = 116/210 (55%)
 Frame = -1

Query: 834 MVGPTMFIIADQQSMWVCG*SGFPGTT*AKE*SNVTVLNTLVGGRVQS*NVMVHRHQVKH 655
           M+ P MF++ D+ +  VCG   FP  T  KE   + V NTLV  RVQ    +V+RHQVKH
Sbjct: 1   MIRPAMFVVTDELACRVCGQRRFPCATETKEKGYIIVANTLVCRRVQGQYTVVNRHQVKH 60

Query: 654 NCENXXXXXXXXXXX*NDHFHCFEVNFYSTL*RHILGV*IGWELTSVPDSKIRFSKMG*F 475
           +CEN            +DH H  E++   +L  H + + IG EL  +P  +I  +K+   
Sbjct: 61  DCENALFHLARIFCAQDDHLHLLEIDLDGSLGGHTVSMRIGRELACIPHCEIGLTKLLQL 120

Query: 474 FFCRSNKHICHE*SVVSPGTNNADFDSVFWIPSCKCIDNINVVSCSQVICSSFTVDRPCS 295
             C  ++H+CHE SVVS  T ++D D++ W+P    + N+ +V+ +Q + S  T+D+P  
Sbjct: 121 LGCWLDQHVCHEESVVSTCTYDSDLDAIAWVPPGVGVHNVEMVTSTQKVRSPLTIDQPGF 180

Query: 294 FRTWFIDRTPPNFVFRGRFFNNTFVLWRSS 205
             T  +D TPPN + R R  +N  VL R S
Sbjct: 181 LGTLLVDGTPPNVLRRCRLVHNPLVLGRPS 210

>Kwal_55.19664 s55 (71422..71721) [300 bp, 99 aa] {OFF} [contig 159]
            FULL
          Length = 99

 Score = 99.4 bits (246), Expect = 2e-24
 Identities = 54/99 (54%), Positives = 65/99 (65%)
 Frame = -2

Query: 1160 MKWYMTCSGVNLDTGGKTPEASQVSRIMFFG*ESAKHGILALGM*SIG*AHLVFSVIEEX 981
            MKWYMTCSGVN +TGG+TP+ASQVS  +F G  SA+ GILALGM S+G A  VFSVI + 
Sbjct: 1    MKWYMTCSGVNFETGGRTPDASQVSNTIFLGCSSARQGILALGMYSMGYAQRVFSVISQF 60

Query: 980  XXXXXXXXXXXXXXSNTEPNLIASKISGSFSADKLIHLA 864
                          S TEP  IA KISGS ++ + +HLA
Sbjct: 61   SKSTSRVKESYATFSRTEPKRIALKISGSLASVRPMHLA 99

>Kwal_55.19667 s55 (72322..72579) [258 bp, 85 aa] {OFF} [contig 159]
           FULL
          Length = 85

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 43/64 (67%), Positives = 49/64 (76%)
 Frame = -2

Query: 248 EVGSSTIRLSFGDLPVLTPE*AINAPLDEMTVLFSFRPSSYKTAAGALRLMVVTSSLRAN 69
           +VGSSTIRLS GDLPVL PE AI+AP  E+ VLFS R SSY +AAGALR +V TSS  A+
Sbjct: 5   DVGSSTIRLSLGDLPVLDPENAISAPDAEILVLFSLRASSYSSAAGALRRIVTTSSPSAS 64

Query: 68  SCLI 57
           S  I
Sbjct: 65  SLRI 68

>Suva_7.275 Chr7
            complement(476201..476281,476285..476410,476414..476494)
            [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 70.1 bits (170), Expect = 4e-14
 Identities = 51/113 (45%), Positives = 59/113 (52%), Gaps = 5/113 (4%)
 Frame = +1

Query: 1129 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHK 1308
            LT E+VMYHF SG+ S   G                 +PFLALHPI Y T++ATKM  H 
Sbjct: 1    LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 1309 ANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANE-----TYETLP 1452
             +AYLINTG+             LK TR   DSIHD SLA E     TY+ LP
Sbjct: 58   -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 35.0 bits (79), Expect = 0.60
 Identities = 23/97 (23%), Positives = 49/97 (50%), Gaps = 8/97 (8%)
 Frame = +1

Query: 718 IQNGDVTLFFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGVFNIEGGCYAKC 873
           ++ G+     G SG+GK+T+++        +  R++IGD       H + +     Y + 
Sbjct: 463 VEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGD-------HNINSFNVRKYRRL 515

Query: 874 INLSAEKEPEIFDAIKFGSVLENVIYDEKSHVVDYDD 984
           + +  ++EP++F+    G++L+N++Y       D DD
Sbjct: 516 LGI-VQQEPQLFN----GTILDNILYTVPPERADNDD 547

>Smik_15.403 Chr15 (699008..701593) [2586 bp, 861 aa] {ON} YOR217W
           (REAL)
          Length = 861

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 21/67 (31%), Positives = 32/67 (47%)
 Frame = -2

Query: 929 EPNLIASKISGSFSADKLIHLA*QPPSILKTPWSDQQCSSSPINNLCGSADKVVFPVPLR 750
           EPN    K     SA K+IH++  P S  K P S ++ +SSP+        K + P    
Sbjct: 43  EPN---DKTPEKSSASKIIHISETPESEKKLPISTKRKASSPVVKSSNFKKKKIVPEVAH 99

Query: 749 PKNKVTS 729
           P + +T+
Sbjct: 100 PASVITA 106

>YDR102C Chr4 complement(657648..657980) [333 bp, 110 aa] {OFF}
            Dubious open reading frame; homozygous diploid deletion
            strain exhibits high budding index
          Length = 110

 Score = 30.4 bits (67), Expect = 4.3
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +1

Query: 868  KCINLSAEKEPEIFDAIK----FGSVLENVIYDEKSHVVDYDDSSITENTRC 1011
            KCI +   K+P IF+A      F SVLE+VIY  K +++  D   +   T C
Sbjct: 7    KCIRVELRKDP-IFNASSSLEIFLSVLESVIYPFKGNLILLDFHLVDVQTTC 57

>Smik_5.348 Chr5 (541318..544692) [3375 bp, 1124 aa] {ON} YER176W
            (REAL)
          Length = 1124

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 30/93 (32%), Positives = 36/93 (38%), Gaps = 1/93 (1%)
 Frame = +1

Query: 1345 SSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNPAKNW 1524
            SS VS      L   ++++D   DG L  E  ETL        TK N     L  P  N 
Sbjct: 433  SSIVSKKSETKLHQDKSVVDKTRDGKLIYEEGETL--------TKYNAFKPTLSYPDLNS 484

Query: 1525 SQGESKYRGAV-TNLANLFVQNFKIYQDRATPD 1620
               +  Y   +   L N FVQNF I   R   D
Sbjct: 485  YLNDYSYALFLEQRLENDFVQNFSILWPRNEKD 517

>TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {ON}
            Anc_3.258 YBR050C
          Length = 1147

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 13/39 (33%), Positives = 25/39 (64%)
 Frame = +1

Query: 1357 SGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVP 1473
            + G R P+ YTR+  ++ H  S++++ +E L   N+Q+P
Sbjct: 19   NSGNRVPIPYTRSKSNTTHYQSISSKNHELLQKNNMQIP 57

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 7/66 (10%)
 Frame = +1

Query: 1000 NTRCAYPIDYI------PSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFI 1161
            +T  A  +DY+       S K+ CL  S     ILLT +AS    P S     +++YH+I
Sbjct: 952  HTALALILDYLIINGSLSSLKVKCLLKS---GTILLTDNASTSSKPPSNKQSNRMLYHYI 1008

Query: 1162 S-GYTS 1176
            S GYT+
Sbjct: 1009 SQGYTT 1014

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 2/88 (2%)
 Frame = +1

Query: 520  GQFPANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIF--TVMFYLMPVHHNVLT 693
            G F A  H     S+ST E +     ++           + +F    + Y +P+ H    
Sbjct: 818  GSFDATNHDLIKDSESTDESSTNGARLL---------KSQAVFHWRNLCYDIPIKHGTRR 868

Query: 694  LHSSANQGIQNGDVTLFFGLSGTGKTTL 777
            L  + +  ++ G +T   G SG GKTTL
Sbjct: 869  LLDNVDGWVKPGTLTALMGASGAGKTTL 896

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 159,093,654
Number of extensions: 3695692
Number of successful extensions: 9921
Number of sequences better than 10.0: 31
Number of HSP's gapped: 9908
Number of HSP's successfully gapped: 31
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)