Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR097W (PCK1)5.708ON54954929810.0
Smik_11.3615.708ON54954829210.0
Skud_11.3375.708ON54954929140.0
Suva_11.3345.708ON54854828780.0
KNAG0C066405.708ON54754427010.0
TDEL0B021205.708ON54854726340.0
NDAI0E050805.708ON55155126250.0
NCAS0A031605.708ON55255226190.0
CAGL0H06633g5.708ON54454625900.0
SAKL0E15048g5.708ON54254825520.0
ZYRO0B16456g5.708ON54854825340.0
KAFR0H001605.708ON54954925170.0
KLLA0A00484g5.708ON54354924940.0
Ecym_40135.708ON54254824720.0
AFR292W5.708ON54154824220.0
KLTH0E00902g5.708ON54454624070.0
Kwal_55.196635.708ON54454623600.0
TPHA0E001705.708ON57853123380.0
Kpol_1043.755.708ON55852423350.0
TBLA0E017005.708ON57657523350.0
Suva_7.275singletonON961131741e-14
TDEL0C063501.67ON69399770.81
NDAI0A005601.67ON71494761.2
ZYRO0F17050g1.67ON71489724.1
TBLA0B001002.1ON171765714.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR097W
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1152   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1129   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1127   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1113   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1045   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...  1019   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...  1015   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...  1013   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...  1002   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   987   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   980   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   974   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   965   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   956   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   937   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   931   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   913   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   905   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   904   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   904   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    72   1e-14
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    34   0.81 
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    34   1.2  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    32   4.1  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    32   4.8  

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/549 (100%), Positives = 549/549 (100%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 541 VLAAGPQFE 549
           VLAAGPQFE
Sbjct: 541 VLAAGPQFE 549

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/548 (97%), Positives = 542/548 (98%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSKMN TVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAIKFG+VLENV YDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           PIRYATMLA KMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           E+LPIFNLQVPTKV GVPAELLNPAKNWSQGE+KY+GAVT+LA LFV+NFKIYQDRATPD
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/549 (97%), Positives = 543/549 (98%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSKM+AT GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEE TSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAIKFG+VLENV YDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           PIRYATMLATKMS HK+NAYLINTGW+GSSYVSGGKRCPLKYTRAILDSIHDGSLANETY
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           E+LPIFNLQVPTKV GVPAELLNPAKNWSQGE+KY+G+VTNLANLFV+NFKIYQDRATPD
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQFE 549
           VLAAGPQFE
Sbjct: 541 VLAAGPQFE 549

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/548 (95%), Positives = 538/548 (98%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSKMNA  G+TS VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           +NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAI+FG+VLENV YDE SHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           PIRYATMLATKMSQH+ANAYLINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLA  +Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           E+LPIFNLQVPTKVNGVPAELLNPAKNWSQGE+KY+GAVTNLANLFV+NFKIYQDRATPD
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/544 (89%), Positives = 515/544 (94%)

Query: 3   PSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIA 62
           PSK N+       VEQKIR+EL LS EV TIRRNAPAAVLYED L E KTVI+SSGALIA
Sbjct: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61

Query: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122
           YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121

Query: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181

Query: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242
           QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+N
Sbjct: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241

Query: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301

Query: 303 FDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362
           FDAI+FGSVLENV YDEKSH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361

Query: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421

Query: 423 RYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYET 482
           RYA MLA KMS+HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA   YE+
Sbjct: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481

Query: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVL 542
           LPIFNL+VPT VNGVP ELLNPAKNW+QGE+KY GAV+NLA+LFV+NFKIYQD+ATPDVL
Sbjct: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541

Query: 543 AAGP 546
           AAGP
Sbjct: 542 AAGP 545

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/547 (86%), Positives = 511/547 (93%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSKMN +V   SEVEQKIR EL+LS+EV TIRRNAPAA+LYED L E KT I+SSGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           Q  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EI++AIKFGS+LENV+YD K+  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           PIRYATMLA KMS+H+ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E+Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLP FNL +PTKVNGVP ELLNP+KNW +GE+KY  AV NLA LFV+NFKIYQDRATP+
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/551 (86%), Positives = 515/551 (93%), Gaps = 3/551 (0%)

Query: 1   MSPSKMNATV---GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSS 57
           MSP K + T      +++VEQKIRQEL LS +VTTIRRNAPAA+LYED L E  T+ISS+
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 58  GALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDH 117
           GAL+AYSG KTGRSP+DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 118 IYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFP 177
           +YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 178 ANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237
           AN HTQDMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 238 QGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAE 297
           QGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS E
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 298 KEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHP 357
           KEPEIF+AIK+GS+LENVIYD K+ VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 358 KNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 417
            NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 418 ALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAN 477
           ALHPIRYATMLA K+S+H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 478 ETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRA 537
           + +ETLP+FNLQVPT VN VP ELLNPAKNW+QGE+KY  AV+NLA+LFV+NFKIYQD+A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 538 TPDVLAAGPQF 548
           TP+VLAA P+ 
Sbjct: 541 TPEVLAAAPRI 551

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/552 (85%), Positives = 516/552 (93%), Gaps = 4/552 (0%)

Query: 1   MSPSKMNAT----VGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISS 56
           MSP K++++    +  +  VEQ IR+EL LS++VTTIRRNAPAAVLYED L E KTVI+S
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 57  SGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRD 116
           SGALIAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 117 HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQF 176
           H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 177 PANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236
           PAN +TQDMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 237 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSA 296
           NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSA
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 297 EKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSH 356
           EKEPEIF+AIK+GS+LENVIYD+ + VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSH
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 357 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 416
           PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 417 LALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 476
           LALHPIRYATMLA K+S H A+A+LINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 477 NETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDR 536
            ++YETLPIFNL VPT VNGVP E+LNPAKNWS+GE+KY  AV+ L +LFV+NFK YQDR
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 537 ATPDVLAAGPQF 548
           ATPDVLAAGPQ 
Sbjct: 541 ATPDVLAAGPQI 552

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/546 (85%), Positives = 505/546 (92%), Gaps = 3/546 (0%)

Query: 3   PSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIA 62
           PSK +    S + VE++IR EL LS EVT IRRNAPAAVLY+D LKE KTVISS+GALIA
Sbjct: 2   PSKSSV---SGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIA 58

Query: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122
           YSG KTGRSPKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VD
Sbjct: 59  YSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVD 118

Query: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  T
Sbjct: 119 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANART 178

Query: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242
           QDM+SK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+N
Sbjct: 179 QDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKN 238

Query: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEI
Sbjct: 239 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEI 298

Query: 303 FDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362
           FDAI+FGSVLENVIYD +SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIIL
Sbjct: 299 FDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIIL 358

Query: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422
           LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+
Sbjct: 359 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPM 418

Query: 423 RYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYET 482
           RYATMLA KM +H ANA+LINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLA   +E+
Sbjct: 419 RYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478

Query: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVL 542
           LPIFNLQVP  V GVP+ELLNPA+NWS+GE+KY+ AV+ LA LFV+NFK YQD+AT DVL
Sbjct: 479 LPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVL 538

Query: 543 AAGPQF 548
           AAGPQ 
Sbjct: 539 AAGPQL 544

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/548 (84%), Positives = 499/548 (91%), Gaps = 6/548 (1%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSK  A+       EQ+IR EL LSDEV TIRRNAPAA+LYED LKE KT ISSSGAL
Sbjct: 1   MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSP+DKRIV+E TS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
            + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCI LSAEKEP
Sbjct: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EI++AIKFGSVLENVIY+ ++  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P++YATMLA KM++H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA E Y
Sbjct: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLP FNL++PT+VN VP+ELLNPAKNW +GE+KY  AV NLA LFV+NFK YQDRAT  
Sbjct: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534

Query: 541 VLAAGPQF 548
           VL+AGPQ 
Sbjct: 535 VLSAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/548 (82%), Positives = 497/548 (90%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSK+   +  T+EVE++IR+ELAL  EV TIR NAPAA LYEDGLKE KT + SSGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
            AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EI++AIKFGSVLENV++D  +  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P+RYATMLA KM QH ANA+L+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+   Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLPIFNL  P KVNGVP  LLNPAK+W +G +KY  AV  LA  F +NFKIYQD+ATPD
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/549 (82%), Positives = 502/549 (91%), Gaps = 1/549 (0%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENK-TVISSSGA 59
           MSPSK+   +   + VEQKIRQEL LS  VTTIRRNAP +VLYED LK+ K T+ISS+GA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119
           LIAYSG KTGR PKDKRIVEE  SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239
            HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 240 IQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKE 299
           I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 300 PEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359
           PEIF++IKFGS+LENV+YD KS  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419
           IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 420 HPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANET 479
           HP++YATMLA KM +HKANA+LINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL  E+
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 480 YETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATP 539
           +ETLPIFNL+VP  VN VP +LLNP+KNW +GE KY GAV  L+ LF++NFK Y+D+AT 
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 540 DVLAAGPQF 548
           +VLAAGP+ 
Sbjct: 541 EVLAAGPRL 549

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/549 (81%), Positives = 496/549 (90%), Gaps = 7/549 (1%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSP+K      + +  E+ IR EL LS EV TIRRNAPAA+LYED LKE  T IS++GAL
Sbjct: 1   MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           Q+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+ LSAEKEP
Sbjct: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AIKFGSVLEN+IYD  +  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P++YATMLA KM++H ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E Y
Sbjct: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474

Query: 481 ETLPIFNLQVPTKV-NGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATP 539
           E LPIFNLQ+P  V + VPA LLNP+KNW++GE+KY   V +LANLFV+NFK YQD+AT 
Sbjct: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534

Query: 540 DVLAAGPQF 548
            VLAAGPQ 
Sbjct: 535 QVLAAGPQL 543

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/548 (81%), Positives = 492/548 (89%), Gaps = 6/548 (1%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSK+  +       E+KIR EL LS  V  IRRNAPAA+LYED L E  T ISS+GAL
Sbjct: 1   MSPSKVFQSP------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSPKDKRIV+EPTS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
             GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AI++GSVLENV+Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P++YATMLA KMSQH ANA+LINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLAN  Y
Sbjct: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLP+F L +P  V GVP+ELLNP++NW +GE KY  AVT+LANLFVQNFKIYQD+AT +
Sbjct: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534

Query: 541 VLAAGPQF 548
           VL AGPQ 
Sbjct: 535 VLYAGPQL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/548 (80%), Positives = 487/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSK+  T       E+KIR EL LS  V TIRRNAPAAVLYED L E KT ISS+GAL
Sbjct: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSPKDKRIV+EPTS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
            N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP
Sbjct: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AIK+GSVLENV+YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P++YATMLA KMSQH A+A+LINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA   Y
Sbjct: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLP+F L +P  V GVPAELLNPAKNW +GE KY  AV+ LA+ F +NFKIYQD+AT +
Sbjct: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533

Query: 541 VLAAGPQF 548
           V+ AGPQ 
Sbjct: 534 VVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/546 (79%), Positives = 484/546 (88%), Gaps = 4/546 (0%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSP+K    V +    +  IRQELAL +EV TIRRNAPAA+LYED LKENKT I+SSGAL
Sbjct: 1   MSPTKTRNHVSA----KDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+YI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AIKFGSVLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKNI
Sbjct: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P++YATMLA KMSQH+ANA+LINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA E +
Sbjct: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLP F L VP  VN VP  +LNPAKNW +GE+KY+  V  LA LF +NFK YQDRA+ D
Sbjct: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536

Query: 541 VLAAGP 546
           V++AGP
Sbjct: 537 VISAGP 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/546 (77%), Positives = 480/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60
           MSPSK+   V     V+ +IR+ELAL +EV TIRRNAPAA+LYED LKENKT IS+SGAL
Sbjct: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236

Query: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AI+FGSVLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480
           P++YATMLA KMS HKA+A+LINTGWTG S+V GG RCPLKYTRAILD+IHDG+LA E Y
Sbjct: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476

Query: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540
           ETLP FNL +P  VN VP+ +LNPA++W  GE+KY+  V  LANLFV+NFK Y+  A+ +
Sbjct: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536

Query: 541 VLAAGP 546
           ++ AGP
Sbjct: 537 IMCAGP 542

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/531 (78%), Positives = 467/531 (87%), Gaps = 1/531 (0%)

Query: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDK 75
           +E+ I   L+ + ++  I+RN P A LYEDGLKENKT +SS+GALIAYSGVKTGRSPKDK
Sbjct: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105

Query: 76  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135
           RIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DAF GWDP+YRIK+
Sbjct: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165

Query: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195
           RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T DMSSK+++EINF
Sbjct: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225

Query: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTG 255
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTG
Sbjct: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285

Query: 256 KTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENV 315
           KTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP+IF+AIKFGSVLEN 
Sbjct: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345

Query: 316 IYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375
           IYDE++H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILLTCDASGVLPPVS
Sbjct: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405

Query: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQH 435
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA KM +H
Sbjct: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465

Query: 436 KANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVN 495
           KANA+L+NTGWTGSSYVSGG RCPLKYTRAILD+IHDGSL NE YETLPIFNLQ+P   N
Sbjct: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525

Query: 496 GVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVLAAGP 546
           GVP+ELLNPA +W+     Y  AV  L  LF +NFK Y+D+AT +V+ AGP
Sbjct: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/524 (79%), Positives = 464/524 (88%)

Query: 25  ALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSK 84
            L ++  TI+RN P A LYEDGLKE+ T +SS+GAL+AYSGVKTGRSPKDKRIVEEP+SK
Sbjct: 35  CLYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSK 94

Query: 85  DEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYH 144
           D IWWGPVNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YH
Sbjct: 95  DNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYH 154

Query: 145 ALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILG 204
           ALFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILG
Sbjct: 155 ALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILG 214

Query: 205 TEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPH 264
           TEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPH
Sbjct: 215 TEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPH 274

Query: 265 RLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVV 324
           R LIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIF+AIKFGSVLEN +YDE +HVV
Sbjct: 275 RELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVV 334

Query: 325 DYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMY 384
           DYDDS ITENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMY
Sbjct: 335 DYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMY 394

Query: 385 HFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHKANAYLINT 444
           HFISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+ HKA+A+LINT
Sbjct: 395 HFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINT 454

Query: 445 GWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNP 504
           GWTG+SY +GGKRCPLKYTRAILD+IH+GSLANE YETLP+FNL +P  V  VP+ELLNP
Sbjct: 455 GWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNP 514

Query: 505 AKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVLAAGPQF 548
           +K WS  +  Y  AV  L +LFVQNF IYQD+AT DV+AAGP  
Sbjct: 515 SKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/575 (74%), Positives = 485/575 (84%), Gaps = 28/575 (4%)

Query: 1   MSPSKMNATVGSTSEVEQKI----------RQELALSDEVTT--------------IRRN 36
           M P++++ T  +TS     I          +Q+L++ D++ +              I+ N
Sbjct: 1   MCPARVSTTTSNTSINGTNINNYNGNPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHN 60

Query: 37  APAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPC 96
             AA+LYED LKE KTVISSSGALIAYSG KTGRSPKDKRIV E  SKD +WWGPVNKPC
Sbjct: 61  PSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPC 120

Query: 97  SERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT 156
           SE+TW INRER  DYL TR ++Y++DA+ GWDP+YR+KVRVVCARAYHALFMTNMLIRPT
Sbjct: 121 SEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPT 180

Query: 157 EEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIF 216
           EEEL +F EPDFTVWNAG F AN +T DM+SK+++EINFKAMEMIILGTEYAGEMKKGIF
Sbjct: 181 EEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIF 240

Query: 217 TVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWS 276
           TVMFYLMP+HHN+LTLHSSAN+GI+  DVT+FFGLSGTGKTTLSADP+RLLIGDDEHCWS
Sbjct: 241 TVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWS 300

Query: 277 DHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTR 336
           DHGVFNIEGGCYAKCI L+ EKEPEIFDAI+FGSVLENV Y+E +H VDY+D +ITENTR
Sbjct: 301 DHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCAITENTR 360

Query: 337 CAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG 396
           CAYPIDYI SAKIPCLA+SHPKN+ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG
Sbjct: 361 CAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG 420

Query: 397 TEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGK 456
           TEQGVTEPE TFSSCFGQPFLALHPI YATMLA KM Q+K+NA+LINTGWTGSSY +GG 
Sbjct: 421 TEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGS 480

Query: 457 RCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESK-- 514
           RCPLKYTRAILD+IHDG+LANE YETLP+FNLQ+PT VNGVP E+LNP  +W+   +K  
Sbjct: 481 RCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNN 540

Query: 515 --YRGAVTNLANLFVQNFKIYQDRATPDVLAAGPQ 547
             Y  AV  LA LFV+NFKIYQD+AT DVLAAGPQ
Sbjct: 541 ISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQ 575

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 59/113 (52%), Gaps = 22/113 (19%)

Query: 377 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHK 436
           LT E+VMYHF SG+ S   G                 +PFLALHPI Y T++ATKM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 437 ANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANE-----TYETLP 484
            +AYLINTG+             LK TR   DSIHD SLA E     TY+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 24/99 (24%)

Query: 240 IQNGDVTLFFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGV--FNIEGGCYA 289
           ++ G+     G SG+GK+T+++        +  R++IGD       H +  FN+    Y 
Sbjct: 463 VEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGD-------HNINSFNVRK--YR 513

Query: 290 KCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVVDYDD 328
           + + +  ++EP++F+    G++L+N++Y       D DD
Sbjct: 514 RLLGI-VQQEPQLFN----GTILDNILYTVPPERADNDD 547

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 237 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLL-IGDDEHCWSDHGVFNIEGGCYAKCINLS 295
           N  I  G+     G SG+GK+T+++   R   + +      D+ + N     Y + I  +
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-T 525

Query: 296 AEKEPEIFDAIKFGSVLENVIY-------DEKSH 322
            ++EP +F+    GS+L+N+IY        EK H
Sbjct: 526 VQQEPSLFN----GSILDNIIYAIPPELTSEKQH 555

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 20/89 (22%)

Query: 237 NQGIQNGDVTLFFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGVFNIEGGCY 288
           N  IQ G+     G SG+GK+T+++        D   + IGD     +D   FN+    Y
Sbjct: 470 NLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGD-----TDLRTFNLRK--Y 522

Query: 289 AKCINLSAEKEPEIFDAIKFGSVLENVIY 317
            + I +   +EP +F+    G++LEN++Y
Sbjct: 523 RRLIGV-VHQEPVLFN----GTILENILY 546

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 10/65 (15%)

Query: 335  TRCAYPIDYI------PSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFIS 388
            T  A  +DY+       S K+ CL  S     ILLT +AS    P S     +++YH+IS
Sbjct: 953  TALALILDYLIINGSLSSLKVKCLLKSGT---ILLTDNASTSSKPPSNKQSNRMLYHYIS 1009

Query: 389  -GYTS 392
             GYT+
Sbjct: 1010 QGYTT 1014

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,304,435
Number of extensions: 2651552
Number of successful extensions: 6713
Number of sequences better than 10.0: 31
Number of HSP's gapped: 6838
Number of HSP's successfully gapped: 31
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)