Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR096W5.706ON1195119556940.0
Skud_11.3365.706ON1188119545600.0
Suva_11.3335.706ON1187119545320.0
Smik_11.3605.706ON118094542980.0
TDEL0B021405.706ON114794028000.0
ZYRO0B16412g5.706ON137298027400.0
CAGL0G02541g5.706ON129596325730.0
SAKL0E15004g5.706ON119697925270.0
Kpol_1043.735.706ON126096625100.0
NCAS0A031705.706ON1319103924950.0
KLTH0E00968g5.706ON114898124300.0
Kwal_55.196785.706ON117898324140.0
Suva_9.375.706ON111794423320.0
Skud_9.175.706ON111894623140.0
YIL151C5.706ON111894623080.0
TPHA0E001905.706ON136198523230.0
AFR290W5.706ON121798722970.0
Smik_9.185.706ON111894522610.0
Ecym_40155.706ON125798922700.0
KNAG0C066305.706ON128173621760.0
KAFR0H001805.706ON124172221200.0
CAGL0H06611g5.706ON128273718210.0
KLLA0A00528g5.706ON122971917710.0
NDAI0E050705.706ON155638213541e-163
TBLA0E017105.706ON152641311691e-137
TPHA0D046405.706ON9629393616e-34
YPL075W (GCR1)8.543ON78593729.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR096W
         (1195 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  2197   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1761   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1750   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1660   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1083   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1060   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   995   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   978   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   971   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   965   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   940   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   934   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   902   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   895   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   893   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   899   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   889   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   875   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   879   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   842   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   821   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   706   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   686   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   526   e-163
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   454   e-137
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   143   6e-34
YPL075W Chr16 (412254..412261,413013..415362) [2358 bp, 785 aa] ...    32   9.6  

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 2197 bits (5694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1082/1195 (90%), Positives = 1082/1195 (90%)

Query: 1    MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60
            MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS
Sbjct: 1    MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60

Query: 61   KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120
            KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA
Sbjct: 61   KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120

Query: 121  LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180
            LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK
Sbjct: 121  LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180

Query: 181  SEIVGGFQRKSNNSQEINDKDNSARDQDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            SEIVGGFQRKSNNSQEINDKDNSARDQDF                               
Sbjct: 181  SEIVGGFQRKSNNSQEINDKDNSARDQDFNNSGNNNNNNNHSSNNNDNNNNNNDDNNNNN 240

Query: 241  XXXXXXXXXXXXXXXEREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQL 300
                           EREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQL
Sbjct: 241  NSNSRDNNNNSDDSNEREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQL 300

Query: 301  TNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWV 360
            TNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWV
Sbjct: 301  TNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWV 360

Query: 361  YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 420
            YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI
Sbjct: 361  YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 420

Query: 421  ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT 480
            ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT
Sbjct: 421  ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT 480

Query: 481  PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF 540
            PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF
Sbjct: 481  PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF 540

Query: 541  IEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFE 600
            IEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFE
Sbjct: 541  IEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFE 600

Query: 601  LPKYLXXXXXXXXXXXXXXXXXXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFN 660
            LPKYL                        GNSRNDNEDDDEIMSSTTSISDHDLLAEFFN
Sbjct: 601  LPKYLKERKDKKERKKSSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFN 660

Query: 661  DIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFI 720
            DIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFI
Sbjct: 661  DIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFI 720

Query: 721  ISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDY 780
            ISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDY
Sbjct: 721  ISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDY 780

Query: 781  DKXXXXXXXXXXXXXXXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDS 840
            DK                  ILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDS
Sbjct: 781  DKLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDS 840

Query: 841  PTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGS 900
            PTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGS
Sbjct: 841  PTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGS 900

Query: 901  LVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKK 960
            LVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKK
Sbjct: 901  LVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKK 960

Query: 961  LRADYTCFDKNGEFLSASLYTTWYVPXXXXXXXXXXXXXXXEKENEGLFLECIKSDYPEI 1020
            LRADYTCFDKNGEFLSASLYTTWYVP               EKENEGLFLECIKSDYPEI
Sbjct: 961  LRADYTCFDKNGEFLSASLYTTWYVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEI 1020

Query: 1021 DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG 1080
            DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG
Sbjct: 1021 DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG 1080

Query: 1081 IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA 1140
            IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA
Sbjct: 1081 IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA 1140

Query: 1141 SEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
            SEPRLSPRRFNYVVLISDDDAM          TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1141 SEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1761 bits (4560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/1195 (74%), Positives = 968/1195 (81%), Gaps = 7/1195 (0%)

Query: 1    MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60
            MPE SVQNPLRLSEN NTRSMFLSASQ QRP     FP  VRN T  L LS+FQVLNPS+
Sbjct: 1    MPEASVQNPLRLSENGNTRSMFLSASQPQRPP----FPMSVRNATTRLDLSNFQVLNPSA 56

Query: 61   KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120
            KRQNS+SVY+DINSSKRRI+  RF D+E   ND T  ERT +  S   PSPRY +S KR+
Sbjct: 57   KRQNSSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRS 116

Query: 121  LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180
            LKRENSV +T S  LISK  S++G + A++K S +N+   LN S++SLAFVDA +D QS 
Sbjct: 117  LKRENSVEVTGSYPLISKPASQSGKNNAYDKRSSKNL-SLLNPSKSSLAFVDAEADGQSN 175

Query: 181  SEIVGGFQRKSNNSQEINDKDNSARDQDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            ++I+ G  +  +N++E     ++  +                                  
Sbjct: 176  NDII-GNFQHKSNNREHIHDGDNNANNQSYNNSNNNNNNNNNNNNNNNNNNSSNNNNNNN 234

Query: 241  XXXXXXXXXXXXXXXEREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQL 300
                           E EE+D+C+ A++KRS IALIQKLQELYKVIVKQEIELQERCSQL
Sbjct: 235  NNNNNNNINNNDDNNEAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQL 294

Query: 301  TNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWV 360
            TNSQTTELKSLWTIY+INT+L+NNYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWV
Sbjct: 295  TNSQTTELKSLWTIYRINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWV 354

Query: 361  YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 420
            YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI
Sbjct: 355  YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 414

Query: 421  ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT 480
            ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT
Sbjct: 415  ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT 474

Query: 481  PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF 540
            PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYF
Sbjct: 475  PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYF 534

Query: 541  IEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFE 600
            +EKFGIDANGCNIFN EDMF+QNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFE
Sbjct: 535  VEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFE 594

Query: 601  LPKYLXXXXXXXXXXXXXXXXXXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFN 660
            LPKYL                        GNSRNDN DDDEIMSST SISDHD LAEFFN
Sbjct: 595  LPKYLKERKDKKERKKSSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFN 654

Query: 661  DIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFI 720
            DIDTLRRPILPSMLT+EAWLETLKFLNMTSLKCG+IVLRKFLHGPLGIALPHILPWIYFI
Sbjct: 655  DIDTLRRPILPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFI 714

Query: 721  ISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDY 780
            I+ CLKS+QLSDP SK+FWMIIVKR FPWDT+VTFMNVLI YLLDN+  N IIG+LC  Y
Sbjct: 715  IATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKY 774

Query: 781  DKXXXXXXXXXXXXXXXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDS 840
                                I  CWGTLWFDTIC+KN HSISS+DNFQEIGIKDYMALD+
Sbjct: 775  GTLNLAGLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDA 834

Query: 841  PTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGS 900
            PTDGIIFD+KDE+GEKFWKRACR IFLFRELSR+FPIGVI+ NDPLI  SS Q++ IL +
Sbjct: 835  PTDGIIFDDKDESGEKFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRN 894

Query: 901  LVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKK 960
            LV+KLEPL NI +N P+L ALE+ +DISEARS+NN DL+AVPELSVN GDNIFHY GYKK
Sbjct: 895  LVYKLEPLSNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKK 954

Query: 961  LRADYTCFDKNGEFLSASLYTTWYVPXXXXXXXXXXXXXXXEKENEGLFLECIKSDYPEI 1020
            LR DYTCFD+NGEFLSASLYT WY+P               EK +E LFLEC+K D P I
Sbjct: 955  LRPDYTCFDRNGEFLSASLYTRWYLP-NGNNISEALVNSDIEKGDEDLFLECMKPDCPGI 1013

Query: 1021 DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG 1080
            DF+TTYFVFDATSWLRHSARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRG
Sbjct: 1014 DFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRG 1073

Query: 1081 IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA 1140
            IITIRQLYYE+KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES+ KAQEKLE+A
Sbjct: 1074 IITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENA 1133

Query: 1141 SEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
             +P ++PR  NYVVLISDDD M          TLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1134 GQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1750 bits (4532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 882/1195 (73%), Positives = 962/1195 (80%), Gaps = 8/1195 (0%)

Query: 1    MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60
            MPE SVQNPLRLSEN N RSMFLSASQ QRPS   SFP  V N  A L LS+FQVLN S+
Sbjct: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNA-ARLDLSNFQVLNSSA 59

Query: 61   KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120
            KRQNSNSV +DINSSKRRISRP F DIE  NN  +  E+TT+  S  NPS RY+ S KRA
Sbjct: 60   KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119

Query: 121  LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180
            L+RENSV +T+SS LISK  S NG  IA++K +  +    LN+S++SLA+V+A  D QS 
Sbjct: 120  LQRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSN-SLLNMSKSSLAYVEAEPDGQSS 178

Query: 181  SEIVGGFQRKSNNSQEINDKDNSARDQDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            +EI+  FQ K   S +I+++D      D                                
Sbjct: 179  NEIIENFQHKETESDDIHNEDG-----DDGADPNDLSNSENNNNYNNNNNNNINNNNNNN 233

Query: 241  XXXXXXXXXXXXXXXEREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQL 300
                           E+EE++  +PA+NK+S IALIQKLQELYKVIVKQEIELQERCSQL
Sbjct: 234  TNNNNINNNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQL 293

Query: 301  TNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWV 360
            TNSQTTELKSLWTIY+INT+LVNNYVTFITTALLPSQP HDLVIGQEIVEIYRIERRLWV
Sbjct: 294  TNSQTTELKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWV 353

Query: 361  YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 420
            YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI
Sbjct: 354  YGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 413

Query: 421  ALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT 480
            ALYPSSFIDWKLSAEHWYTEAMKY+YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT
Sbjct: 414  ALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFT 473

Query: 481  PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF 540
            PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF
Sbjct: 474  PSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF 533

Query: 541  IEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFE 600
            +EKFGIDANGCNIFN EDMF+QNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFE
Sbjct: 534  VEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFE 593

Query: 601  LPKYLXXXXXXXXXXXXXXXXXXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFN 660
            LPK+L                         NSRN+N+D+DEIMSSTTSIS+ D L EFFN
Sbjct: 594  LPKHLKERKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFN 653

Query: 661  DIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFI 720
            DIDTLRRPI+ SMLTNEAWLE+LKFLNMTSLKCG+IVLRKFLHGPLGIALPH LPWIYFI
Sbjct: 654  DIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFI 713

Query: 721  ISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDY 780
            ISICLKSSQLSDP+SKEFW++IVKR FPWDTMVTFMN+LI  +LDN+ ++ IIG LCD+Y
Sbjct: 714  ISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEY 773

Query: 781  DKXXXXXXXXXXXXXXXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDS 840
                                I GCWGTLWFDTIC+KNT+SISS+D+F+E+GIKDYMALDS
Sbjct: 774  SDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDS 833

Query: 841  PTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGS 900
            P DGIIFD  DENGEKFWKRACRTIFLFRELSRSF IGVII N+  I RSS Q+ NILG+
Sbjct: 834  PIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGN 893

Query: 901  LVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKK 960
            L +KLEPL  + ++IP L  LE IID+ E RSENN DLHAVPELSV +G +IF+Y GYKK
Sbjct: 894  LSYKLEPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKK 953

Query: 961  LRADYTCFDKNGEFLSASLYTTWYVPXXXXXXXXXXXXXXXEKENEGLFLECIKSDYPEI 1020
            L  +YTCFDKNGEFLSASLYT+WYVP               EKENEG FLEC+KSD  EI
Sbjct: 954  LCPNYTCFDKNGEFLSASLYTSWYVP-NGSNNPETNINSNCEKENEGQFLECLKSDDREI 1012

Query: 1021 DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG 1080
            D  TTYFVFDATSWLRHSARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRG
Sbjct: 1013 DLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRG 1072

Query: 1081 IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA 1140
            IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES+MKAQEKLE+A
Sbjct: 1073 IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENA 1132

Query: 1141 SEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
            ++  +S  RFNYV+LISDDD M          TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1133 NQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1660 bits (4298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/945 (84%), Positives = 838/945 (88%), Gaps = 6/945 (0%)

Query: 256  EREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 315
            ER+END+CKPA+NKRSGIALIQKLQELY+VIVKQEIELQERCSQLTNSQTTELKSLWTIY
Sbjct: 237  ERDENDACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIY 296

Query: 316  KINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 375
            KINT+LVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN
Sbjct: 297  KINTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 356

Query: 376  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 435
            FMDPEVCCQFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE
Sbjct: 357  FMDPEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 416

Query: 436  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 495
            HWYTEAMKY YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ
Sbjct: 417  HWYTEAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 476

Query: 496  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN 555
            RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN
Sbjct: 477  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN 536

Query: 556  AEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXX 615
             EDMF+QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL          
Sbjct: 537  CEDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERK 596

Query: 616  XXXXXXXXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLT 675
                          GNSRN NEDDDE MSSTTS+SD DLL EFFNDIDTLRRPILPSMLT
Sbjct: 597  KTSNNDSSVTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLT 656

Query: 676  NEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVS 735
            NEAWLETLKFLNMTSLKCG+IVLRKFLHGPLG+ALPH+LPWIYFIISICLKS+QL+DP+S
Sbjct: 657  NEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPIS 716

Query: 736  KEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXX 795
            KEFW++I+KR FPWDTMVTFMNVLI YLLDN+TSNSIIGDLC++Y K             
Sbjct: 717  KEFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNEN 776

Query: 796  XXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGE 855
                 I GCWGTLWFD IC+KNTHSISSEDNFQEIGI+DYMALDSPTDGIIFD+KDENGE
Sbjct: 777  EDLPEIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGE 836

Query: 856  KFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNI 915
            KFWKRACR IFLFRE+SRSFP+GVI+R+DPL+  SS Q+ NIL  LV+KLEPL NI +++
Sbjct: 837  KFWKRACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSV 896

Query: 916  PVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFL 975
            PVL  LESI DISEARSE NTDLHAVPELSV  GDNIFHYVGYKKLR DYTCFDKNGEFL
Sbjct: 897  PVLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFL 956

Query: 976  SASLYTTWYVPXXXXXXXXXXXXXXXEKENEGLFLECIKS-----DYPEIDFKTTYFVFD 1030
            SASLYT+WYVP               E+ENE LFLEC+KS      YPEIDFKTTYFVFD
Sbjct: 957  SASLYTSWYVP-NCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFD 1015

Query: 1031 ATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYE 1090
            ATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY E
Sbjct: 1016 ATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCE 1075

Query: 1091 NKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRF 1150
            +KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES+MKAQEKLE+A +P +S  RF
Sbjct: 1076 DKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRF 1135

Query: 1151 NYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
            NYVVLISDDD M          TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1136 NYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

 Score =  220 bits (560), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 146/200 (73%)

Query: 1   MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60
           MP+TSVQNP+RLSENENTRS+FLS SQ QRPS   SFPRLV N T  L LSDFQVLNPS 
Sbjct: 1   MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60

Query: 61  KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120
           KRQNSNSV DDIN SKRRISR +FS+ E +N+D T  E+TT   S  N S +++   K +
Sbjct: 61  KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120

Query: 121 LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180
           ++ EN V +TQSSAL+SK  ++   +  +EK   +N++KP N+S++S AFVD  SD QS 
Sbjct: 121 MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180

Query: 181 SEIVGGFQRKSNNSQEINDK 200
           + IV  FQR+S+NS+ + D+
Sbjct: 181 NGIVSNFQRESSNSENVCDE 200

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/940 (57%), Positives = 667/940 (70%), Gaps = 37/940 (3%)

Query: 268  NKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVT 327
            +K+S  AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IYK+N+DL+NNYVT
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 328  FITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 387
            FITTALLP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 388  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 447
            HVF+S+S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKYIY 
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 448  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 507
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHR 472

Query: 508  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFF 567
            NS LIEYLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF QNPD  
Sbjct: 473  NSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQL 532

Query: 568  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 627
            KYFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      
Sbjct: 533  KYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSS 592

Query: 628  XXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPIL--PSMLTNEAWLETLKF 685
                      D++E + S+ S+     + +FF++ID+L  P L  PS+   E W  +LK+
Sbjct: 593  AMA------IDEEEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPPSL---EVWNCSLKY 641

Query: 686  LNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKR 745
            LN+TSL C +IVL+KFL GP+ +ALPH+LPW YFII++  K   ++D  S+EFW+ +V R
Sbjct: 642  LNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNR 701

Query: 746  AFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCW 805
             FPW+T+V F+NVLI Y LDN   +  I  LC++                     +  CW
Sbjct: 702  IFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCW 761

Query: 806  GTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTI 865
            G LWFD IC+K+   +   D+++  GIKD+M LD P DGI FD  DE+G KFWKRACR I
Sbjct: 762  GLLWFDAICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVI 818

Query: 866  FLFRELSRSFPIGVIIRNDPLIY-RSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESI 924
            FLF+ ++ +F   +++ +   ++ R +    ++L S  FKL       N++     L++ 
Sbjct: 819  FLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV-----LQNT 873

Query: 925  IDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWY 984
            I++ E  S+ N D+   P+LSV E ++IF YVGYK+L +D +C+D+ GEF+S SLYT+W 
Sbjct: 874  IEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWG 933

Query: 985  VPXXXXXXXXXXXXXXXEKENEGLFLECIKS-------DYPE--IDFKTTYFVFDATSWL 1035
                                   LF+E I +       D+PE  ++ K T+FV DATSWL
Sbjct: 934  NETSKNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWL 993

Query: 1036 RHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLP 1095
            RH A ++KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY EN++LP
Sbjct: 994  RHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILP 1053

Query: 1096 LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVL 1155
            LRFTGNVATHIEE+LEFEEQITWR+HVDEFV E++ KAQ +L   +      R F++VVL
Sbjct: 1054 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQEN------RDFHHVVL 1107

Query: 1156 ISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
            ++DD  M          TLSTRFVF+ C  +G +  +CT+
Sbjct: 1108 VTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/980 (55%), Positives = 660/980 (67%), Gaps = 69/980 (7%)

Query: 268  NKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVT 327
            +KRS  AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIYKIN+DL+NNYVT
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 328  FITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 387
            F+TTALLPSQ   D++IG+EIVEIYRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 388  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 447
            HVF+S+S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 448  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 507
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR 649

Query: 508  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFF 567
            N+ LIEYLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ 
Sbjct: 650  NTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYL 709

Query: 568  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 627
            +YFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELP++L                      
Sbjct: 710  RYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSS 769

Query: 628  XXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFL 686
                   ++E  D + +             FF +I+TLR P  +PS L  E W E+L ++
Sbjct: 770  TMAIDDLEDEQSDRMSTPEG----------FFGNIETLRFPYSVPSNL--EIWNESLNYI 817

Query: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746
            NMTSLKC ++VL+KFL GPL +ALPH +PW YFIIS+  K   L+   S++FW+  V R 
Sbjct: 818  NMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRI 877

Query: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWG 806
            FPW+T+V+F+NVLI Y+LDN   +S++  LC  Y                    +  CWG
Sbjct: 878  FPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWG 937

Query: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866
            TLWFDTIC K    +   ++ + +GIK++M LD+P DGI FD  DE+GE FWKRACR IF
Sbjct: 938  TLWFDTICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIF 994

Query: 867  LFRELSRSFPIGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLCN---IHNNIPV---- 917
            LF+ L+ +FPIG+ +     +Y  R+     +IL S  FKL    +   +  N P     
Sbjct: 995  LFKGLAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTT 1054

Query: 918  ---LGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEF 974
               L  L++ ++I E  S  N  +  +P LSV EG++IF Y GY++L  DY  +DKNGEF
Sbjct: 1055 AIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEF 1114

Query: 975  LSASLYTTWY----------VPXXXXXXXXXXXXXXXEKE----------------NEGL 1008
            LSASLYT+WY          +P                +E                 + L
Sbjct: 1115 LSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDL 1174

Query: 1009 FLECIKSDYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKS 1068
            FL    + Y      TTYFV D T+WLRH   I+KLA + +L+FAICLTTF ELRFLRK 
Sbjct: 1175 FLR--DALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKP 1232

Query: 1069 KDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIE 1128
            KDENV+EAATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE
Sbjct: 1233 KDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIE 1292

Query: 1129 SVMKAQEKLESAS-----------EPRLSPRR--FNYVVLISDDDAMXXXXXXXXXXTLS 1175
            +V KAQ K +  +           + R    R    +VVL++DD  M          T S
Sbjct: 1293 AVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFS 1352

Query: 1176 TRFVFSLCTKLGEQRHLCTD 1195
            T+FVFSLC  +G +  +CT+
Sbjct: 1353 TKFVFSLCNSIGLRSKICTN 1372

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/963 (53%), Positives = 666/963 (69%), Gaps = 55/963 (5%)

Query: 260  NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT 319
            N+S KP        AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IY+IN 
Sbjct: 361  NNSNKPTQ------ALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINV 414

Query: 320  DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP 379
            +LV NYVTFI+TALL SQ  +DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDP
Sbjct: 415  ELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDP 474

Query: 380  EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT 439
            EVC QFITHVF+S+STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY 
Sbjct: 475  EVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYN 534

Query: 440  EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV 499
            +A+KY Y +GKLYYHMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+
Sbjct: 535  QALKYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFI 594

Query: 500  ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM 559
            ER + N RNS LIEYLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF   D+
Sbjct: 595  ERGSNNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDI 654

Query: 560  FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXX 619
            F+QNP+  KYFFRH P+FA+SHILQ VGFG+ KNPFA+LF+LPK+L              
Sbjct: 655  FLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTK- 713

Query: 620  XXXXXXXXXXGNSRNDNEDDDEIMS----STTSISDHDLLAEFFNDIDTLRRPILPSMLT 675
                        S  +   ++ +MS    ST S+   D   ++F+++++++ P LP    
Sbjct: 714  ------------SSGEPTSNESVMSLDNISTDSLISSD---QYFSNLESMQHPYLPPPRY 758

Query: 676  NEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVS 735
             + WL++L +LN+T+++CG+IVLRKFLHGP  +ALPH++ W YFIIS+CLKS  L D  S
Sbjct: 759  -DIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEES 817

Query: 736  KEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXX 795
            + FW   ++R  P +++V+F+NVLI Y LDN   +++I  + ++ D              
Sbjct: 818  RYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNN 877

Query: 796  XXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGE 855
                 +  CWGTLWFD I +K+    +S   +++IG+ D++  DSP DGI+FD KDENGE
Sbjct: 878  EELPEVWKCWGTLWFDAITDKSNTDTNS---YEKIGVSDHLFFDSPIDGIVFDSKDENGE 934

Query: 856  KFWKRACRTIFLFRELSRSFPIGVIIRNDPLIY--RSSFQNTNILGSLVFKLEP-LCNIH 912
            KFWKRA R IFLF++++ +F IG+ + +   +Y  R   +  +ILGS  FK+E  L N +
Sbjct: 935  KFWKRALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGN 994

Query: 913  N-NIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKN 971
               + +   L +II+++E  +E N  + A P +S+ E +NIF Y GYK++  +   FDKN
Sbjct: 995  TVQVEIENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKN 1054

Query: 972  GEFLSASLYTTWY-----------VPXXXXXXXXXXXXXXXEKENEGLFL------ECIK 1014
            GE  SA+ YT+WY            P               +   E +F       E   
Sbjct: 1055 GELRSAANYTSWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENST 1114

Query: 1015 SDYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVM 1074
            S    ++ +TT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDENVM
Sbjct: 1115 SLLDGLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVM 1174

Query: 1075 EAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQ 1134
            EAA R II IRQLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIES+ KAQ
Sbjct: 1175 EAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQ 1234

Query: 1135 EKLES--ASEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHL 1192
            +K        P  +  RF   VL+SDD+ M          T +TRFVF+LC+++G+ R +
Sbjct: 1235 KKFLQPFVQNPVDNDSRF--FVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLI 1292

Query: 1193 CTD 1195
            CT+
Sbjct: 1293 CTN 1295

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/979 (50%), Positives = 659/979 (67%), Gaps = 78/979 (7%)

Query: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328
            K +  AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT++K+LW IYK+N +L+NNY++F
Sbjct: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299

Query: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388
            ITTALLPSQP  DL+IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359

Query: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ Y Y H
Sbjct: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419

Query: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 508
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479

Query: 509  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFK 568
              ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+  N  + F+ + +F+Q+ +  +
Sbjct: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539

Query: 569  YFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXX 628
            YFF H P+FA+SHILQ+VGFG+P+NPFAILFELPK+L                       
Sbjct: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD 599

Query: 629  XGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLN 687
             GN            SS+ S+ DH     +F +ID+ R P   P  +  + W ++L +LN
Sbjct: 600  DGNG-----------SSSISV-DH-----YFENIDSHRVPYSFPQDI--QIWQQSLSYLN 640

Query: 688  MTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAF 747
            +TS++C + VL+KFLH PL  ALPH+LPW +F++S+ ++ S LS    K+FW++ ++R F
Sbjct: 641  LTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIF 700

Query: 748  PWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWGT 807
            PW+++V+F+N L+ +LLDN  + S +  LC++Y+K                  +  CWGT
Sbjct: 701  PWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGT 760

Query: 808  LWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFL 867
            LWFDTI  K+    SS    Q  GI+D++ LD+P DGI FD+ DE+G KFWKRACR IF+
Sbjct: 761  LWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFM 817

Query: 868  FRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESIIDI 927
            F+ +++ F  G+ + + P+  R      + L    FK E L    +N   L + ++ I +
Sbjct: 818  FKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKV 876

Query: 928  SEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTW---- 983
             E  S  N++  AVP LS+ +G++IF + GY+++  DY CF+KNG+ ++ SLYT+     
Sbjct: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936

Query: 984  -------------YVPXXXXXXXXXXXXXXXEKENEGL----------------FLECIK 1014
                         +V                E+  E +                F+E ++
Sbjct: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996

Query: 1015 -SDYPEIDFK------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRK 1067
             S +P  D         TYFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRK
Sbjct: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056

Query: 1068 SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1127
            SKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFVI
Sbjct: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116

Query: 1128 ESVMKAQEKLES-------------ASEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTL 1174
            E+V K+Q K +               ++P+    +FN+VVL++DD  M            
Sbjct: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPK-DDDKFNFVVLVTDDLNMRTKAEAHDIHIF 1175

Query: 1175 STRFVFSLCTKLGEQRHLC 1193
            S+RF+F+ C +LG  + +C
Sbjct: 1176 SSRFMFAFCNQLGYNQKVC 1194

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/966 (52%), Positives = 639/966 (66%), Gaps = 78/966 (8%)

Query: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328
            ++S  AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IYK+N DL+NNYVTF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388
            ITTAL PSQ   DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448
            VF+S+S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 507
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 508  N-SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNI--FNAEDMFVQNP 564
            N  LL++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F    MF+QN 
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 565  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXX 624
            D  K++FRH  +FA++ ILQ+VG+G PKNPFA+LF LPKYL                   
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK-------- 663

Query: 625  XXXXXGNSRNDNEDDDEIMSSTTSISDHDLLA-----------EFFNDIDTLR-RPILPS 672
                    +N    +D   ++ +S+S  + +            +FFN+ID L     +P+
Sbjct: 664  -------PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPN 716

Query: 673  MLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSD 732
             ++   W ++LK+ N T+ KC +IVL+KFL+GPL +ALPHILPW+YF+ISI L+  +  D
Sbjct: 717  SIS--LWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQD 774

Query: 733  PVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXX 792
                EFW   +KR FPW++MV F+NVL+ Y++DN   NS + +LCD Y            
Sbjct: 775  TAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNF 834

Query: 793  XXXXXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDE 852
                    +  C G+LWFD I EK   +  + D++ E GIKDY  LD P DGI FDE DE
Sbjct: 835  NANEDLPEVWKCRGSLWFDIIDEK--RNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDE 892

Query: 853  NGEKFWKRACRTIFLFRELSRSF-PIG--VIIRNDPLIYRSSFQNTNILGSLVFKLEPLC 909
             G KFWKR+ R IFLFR +   F   G   I  N P+I R      + L    FKL    
Sbjct: 893  IGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKS 952

Query: 910  -NIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCF 968
             +I  +  ++   E I         NN+D +A+P LS+  G+NIF YVGYK++ ADY  F
Sbjct: 953  DDIMFDDMLVSNFEEI-------DSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSF 1005

Query: 969  DKNGEFLSASLYTTWYV---------PXXXXXXXXXXXXXXXEKENEGLFLECIKSDYPE 1019
            DKNG+ +S S Y TW +         P                 E E LF +C   +Y  
Sbjct: 1006 DKNGDLISTSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEKE-LFNKCFDPEYDS 1064

Query: 1020 ID-------------------FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQ 1060
            +D                   ++ TYF+ DATSWLRH A ++K+A N +L+F+ICLTTFQ
Sbjct: 1065 VDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQ 1124

Query: 1061 ELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRT 1120
            ELRFLRKSKDENV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+
Sbjct: 1125 ELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRS 1184

Query: 1121 HVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVF 1180
            HVDEFVIE+V+KA+ K +   E  +   +   +VL++DD  M          T STRFVF
Sbjct: 1185 HVDEFVIEAVIKAETKRK---EQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVF 1241

Query: 1181 SLCTKL 1186
            ++   L
Sbjct: 1242 AISNYL 1247

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1039 (52%), Positives = 654/1039 (62%), Gaps = 125/1039 (12%)

Query: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328
            K++G AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIYK+N DL+NNYVTF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388
            ITTALL SQ   DL IG+EI+EIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448
            VF+SLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNH
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 508
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 509  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI-------------------DAN 549
              LIEYLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +  
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 550  GCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXX 609
              ++F + DMF+QNP+  KYFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELPKYL    
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 610  XXXXXXXXXXXXXXXXXXXXGNSRN------DN----EDD------DEIMSSTTSISDHD 653
                                  + +      DN    EDD      D +M+  TS     
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTS----- 708

Query: 654  LLAEFFNDIDTLRRP-ILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPH 712
               EFF +I+ LR    +P+ L  E W+ +L  +N+ SLKC +IVL+KFLHGPL IALPH
Sbjct: 709  --EEFFQNIEQLRFDYFIPNSL--EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPH 764

Query: 713  ILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDN------ 766
            +LPW YFIISI LK   L+   SK FW+ I+K  FPW+ ++ F+NVL+ Y LDN      
Sbjct: 765  LLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTP 824

Query: 767  --------QTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWGTLWFDTICEKNT 818
                    +  N  I DLC+ Y                    +  CWGTLWFDTI  KN 
Sbjct: 825  SAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNG 884

Query: 819  HSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSF-PI 877
                  D+F+ +GIKD+M LD P DGI +  +DE GE FWKR  R IFLF+ ++ +F  +
Sbjct: 885  M---DADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSL 941

Query: 878  GVIIR-NDPLIYR-SSFQNTNILGSLVFK------------LEPLCNIHNNIPVLGALES 923
            G+ +  N    YR ++    NIL    FK            L     I+ N  ++  +  
Sbjct: 942  GLKVSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNT-IINRITE 1000

Query: 924  IIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTW 983
             +DI E   E N +    P  S+   ++IF Y GYKKL  +   FDKNGEF S S+YT W
Sbjct: 1001 FVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAW 1060

Query: 984  YVPX-XXXXXXXXXXXXXXEKENEGLFLECIKSD--------YPEIDFKT---------- 1024
             +                   E   LF   +  D         PE   K+          
Sbjct: 1061 PMDYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEP 1120

Query: 1025 -----TYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATR 1079
                 TYFVFDATSWLRH A I+KLA N +L+FA+CLTTFQELRFLRKSKD NV+EA+TR
Sbjct: 1121 FNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTR 1180

Query: 1080 GIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEK--- 1136
             IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE+VMKAQEK   
Sbjct: 1181 AIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVK 1240

Query: 1137 ------LESAS--------------EPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLST 1176
                  +E  S              E       F YVVLI+DDD+M          T  T
Sbjct: 1241 SKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGT 1300

Query: 1177 RFVFSLCTKLGEQRHLCTD 1195
            + VFS+C+ +G    +CT+
Sbjct: 1301 QVVFSVCSMMGIDEGVCTN 1319

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/981 (50%), Positives = 642/981 (65%), Gaps = 83/981 (8%)

Query: 265  PASNKRSGI---ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDL 321
            PA+ + S     AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IYK+NT+L
Sbjct: 201  PAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTEL 260

Query: 322  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 381
            +NNYV FITTALLPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEV
Sbjct: 261  INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 320

Query: 382  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 441
            CCQFITHVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A
Sbjct: 321  CCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQA 380

Query: 442  MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 501
            + +I+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ER
Sbjct: 381  LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 440

Query: 502  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFV 561
            N GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+
Sbjct: 441  NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFL 500

Query: 562  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXX 621
            Q+ +  KYFFRH P+FA+SHILQ+VGFG PKNPFA+LFELPK+L                
Sbjct: 501  QDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSN 560

Query: 622  XXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWL 680
                               E  S T+ I       E+   +D+ R     P+ L    W 
Sbjct: 561  SFTSM--------------EAPSPTSPI-------EYLESVDSPRFVYEFPTDLA--IWQ 597

Query: 681  ETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWM 740
            ++L  +N TS+KC  +VL+KFLHGPL  A  H+LPW YF++S+ ++  +L  P  K+FW+
Sbjct: 598  QSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWI 657

Query: 741  IIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXX 800
             + ++ FPW+++V F+N++I + LDN    S I +LC+ +D                   
Sbjct: 658  ALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPE 717

Query: 801  ILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKR 860
            +  CWG LWFD I +K   S   ++      ++D+M  D P DGI FDE DE G +FWKR
Sbjct: 718  VWKCWGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKR 774

Query: 861  ACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGA 920
            ACR +F+F+ +++ F +G+ + + PL  R S    + L +  FK E       + PV   
Sbjct: 775  ACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFE-------DPPVDSE 827

Query: 921  LESIIDIS----EARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLS 976
              ++I       E  SE N D +A P  S+ EG ++F   GY++L AD+TCF+K G  ++
Sbjct: 828  SYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLIT 887

Query: 977  ASLYTTWYV---PXXXXXXXXXXXXXXXEKEN-------------EGLFLE-CIKSDYPE 1019
             SLYT+  +   P               ++ N             E ++L+ C+  ++ E
Sbjct: 888  CSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIE 947

Query: 1020 ---------------IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRF 1064
                            D   +YFV DATSWLRH A ++KLA N +LRFAICLTTFQELRF
Sbjct: 948  QTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRF 1007

Query: 1065 LRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE 1124
            LRKSKDE+V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDE
Sbjct: 1008 LRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDE 1067

Query: 1125 FVIESVMKAQEKLES----ASE------PRLSPRRFNYVVLISDDDAMXXXXXXXXXXTL 1174
            FVIE+V KAQ K E+    A E      P      F+++ L+SDD  M          T 
Sbjct: 1068 FVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTF 1127

Query: 1175 STRFVFSLCTKLGEQRHLCTD 1195
            S+RF+F++C ++G   H CT+
Sbjct: 1128 SSRFMFAVCNQIGLAHHACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/983 (50%), Positives = 633/983 (64%), Gaps = 85/983 (8%)

Query: 262  SCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDL 321
            +  P+S+  S  AL+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+LW IYKIN +L
Sbjct: 232  AVSPSSSPTSQ-ALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIEL 290

Query: 322  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 381
            +NNYV FITTALLPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEV
Sbjct: 291  INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 350

Query: 382  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 441
            CCQFITHVF+S+STM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A
Sbjct: 351  CCQFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQA 410

Query: 442  MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 501
            + +I+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ER
Sbjct: 411  LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAER 470

Query: 502  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFV 561
            N GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFG+  +  + FN  DMF+
Sbjct: 471  NGGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFL 530

Query: 562  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXX 621
            Q+ +  KYFFRH P+FA+SHILQ VGFG+PKNPFA+LFELPK+L                
Sbjct: 531  QDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKS---- 586

Query: 622  XXXXXXXXGNSRNDNEDDDEIMSSTTSI--SDHDLLAEFFNDIDTLRRPI-LPSMLTNEA 678
                               +   S TSI  + H   +E+  ++D+ R     P  L    
Sbjct: 587  -------------------KSSHSFTSIETTSHLSPSEYLENVDSPRYAYEFPEDLA--I 625

Query: 679  WLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF 738
            W E+L  +N+TS +C  IV +KFL GPL +A+ H+LPW YF++S+ LK   L     K F
Sbjct: 626  WRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSF 685

Query: 739  WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXX 798
            W+ +V++ FPW+++V F+N+L+ ++LDN    S I  LC+  D                 
Sbjct: 686  WITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDL 745

Query: 799  XXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW 858
              I  CWG LWFD I +K   S   + +    G KD+   D P DGI FDE DE GEKFW
Sbjct: 746  PEIWRCWGALWFDVIADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFW 802

Query: 859  KRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVL 918
            KRACR IF+F+ +++ F +G+ +       R      + L +  F  E        IP  
Sbjct: 803  KRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE-------EIPAQ 855

Query: 919  GALESI----IDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEF 974
              ++S     I + E  +  N D +  P  S+ EG++IF + GY+++ ADYTCF+K+G  
Sbjct: 856  SQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSL 915

Query: 975  LSASLYTTWYV---PXXXXXXXXXXXXXXXEKENEG-----LFLECIKSDY------PEI 1020
            +S SLYT+  +   P               E  N+        LE ++ D+      PE 
Sbjct: 916  ISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEF 975

Query: 1021 ------------------DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQEL 1062
                              D   +YFV DATSWLRH A +FKLA N +LRF ICLTTFQEL
Sbjct: 976  IEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQEL 1035

Query: 1063 RFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHV 1122
            RFLRKSKDE+V+EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HV
Sbjct: 1036 RFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHV 1095

Query: 1123 DEFVIESVMKAQEKLESASE----------PRLSPRRFNYVVLISDDDAMXXXXXXXXXX 1172
            DEFVIE+V KAQ+K E+ +                  F++V L+SDD  M          
Sbjct: 1096 DEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQ 1155

Query: 1173 TLSTRFVFSLCTKLGEQRHLCTD 1195
            T STRF+F++C ++G     CT+
Sbjct: 1156 TFSTRFMFAVCNQIGLAHQACTN 1178

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/944 (49%), Positives = 611/944 (64%), Gaps = 53/944 (5%)

Query: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYK+NT+L+ NY+ FI TAL
Sbjct: 205  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITAL 264

Query: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ F+ +
Sbjct: 265  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICI 324

Query: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 325  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 384

Query: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 506
            H++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++GN        
Sbjct: 385  HIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAH 444

Query: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 445  RNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPES 504

Query: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXX 626
             +Y+FRH P+FA+S ILQ++GFG PKNPFA+LF+LPK+L                     
Sbjct: 505  LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAA------ 558

Query: 627  XXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686
                          EI        D      +F +IDTL             WL++L ++
Sbjct: 559  --------------EIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYI 604

Query: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746
            NMTS++C I VL KFLH PL +ALPH L W++FII++  K   ++      FW+  ++R 
Sbjct: 605  NMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRT 664

Query: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWG 806
             PW++MVTF NVL+ Y+LDN   +  +    + +                    +  CWG
Sbjct: 665  MPWNSMVTFSNVLVCYMLDNL--HPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWG 722

Query: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866
            +LWFD + + +   I         G++D++  DSP DGI+FD+KDE GEKFW R+ RTI 
Sbjct: 723  SLWFDAVKKCDVMEIP--------GVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL 774

Query: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPL-CNIHNNIPVLGALE 922
              + +++ FP +G+ +     ++  R+       L +L FKL+P   +  N+   L  L 
Sbjct: 775  TLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELY 834

Query: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982
              I+I+E     N DL A P+LSV  G++IF Y GY +L  DY CFDKNG F SA +YT 
Sbjct: 835  DTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ 894

Query: 983  WYVPXXXXXXXXXXXXXXXEKENEGLFLECIKSDYPEI----------DFKTTYFVFDAT 1032
            W                     N+ L L   K  + ++             + YFV DAT
Sbjct: 895  WSNVGNGVTLDVSSESLYDSTTND-LSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDAT 953

Query: 1033 SWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENK 1092
            SWLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K
Sbjct: 954  SWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKK 1013

Query: 1093 VLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASE-PRLSPRRFN 1151
            ++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI+++ K  +  ++     +   R   
Sbjct: 1014 IIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKE 1073

Query: 1152 YVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
            + VL++DDD M          T +T+++FSL +KLG    LCT+
Sbjct: 1074 FAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/946 (49%), Positives = 616/946 (65%), Gaps = 57/946 (6%)

Query: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IY++NT+L+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 506
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445

Query: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505

Query: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXX 626
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LPKYL                     
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATEV---- 561

Query: 627  XXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686
                  +  +  DD+I SS +   + D L   F+DI        P+ L    WL++L  +
Sbjct: 562  -----PQYRDPFDDQI-SSESYFQNIDSLTSNFDDI--------PTNLN--IWLDSLNHI 605

Query: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746
            NMTS++C I VL KFLH PL +ALPH L W++FI++I  K   ++      FW+  ++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665

Query: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWG 806
             PW++MV   NVL+ Y+LDN   +  +    + +                    I  CWG
Sbjct: 666  MPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723

Query: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866
            +LWFD I + +   I         G++D++  DSP DGI+FDEKDE GE+FW R+ RTI 
Sbjct: 724  SLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775

Query: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPL-CNIHNNIPVLGALE 922
            + + +++ FP +G+ +     ++  R+       L +  FKL+    N HN+   L  L 
Sbjct: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELY 835

Query: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982
              I+I+E     N DL A P LSV  G+NIF Y GY +L  DY CFDKNG F SA +Y+ 
Sbjct: 836  DTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895

Query: 983  WYVPXXXXXXXXXXXXXXXEKEN------EGLFLECIKSDYPEIDFK---TTYFVFDATS 1033
            W                     N      E +F + I +     D     + YFV DATS
Sbjct: 896  WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATS 955

Query: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093
            WLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 956  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1015

Query: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFN-- 1151
            +PLRFTGN+AT++EENLEFEEQITW THVDEFVI+++ K  +  ++    RL  +  N  
Sbjct: 1016 IPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTE---RLIDKNKNKN 1072

Query: 1152 --YVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
              Y VL++DDD M          T +T+++FSL +K+G    LCT+
Sbjct: 1073 NAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/946 (49%), Positives = 615/946 (65%), Gaps = 57/946 (6%)

Query: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NT+L+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 506
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAH 445

Query: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPES 505

Query: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXX 626
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LPKYL                     
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEAT------ 559

Query: 627  XXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686
                 + +  +  D  +SS +   + D L   FNDI        P+ L    WL++L  +
Sbjct: 560  ----ETSSYTDPFDVQISSESYFQNIDALNSSFNDI--------PTNLN--IWLDSLNHI 605

Query: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746
            NMTS++C I VL KFLH PL +ALPH L W++FI++I  K   ++      FW+  ++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRT 665

Query: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWG 806
             PW+++VT  NVL+ Y+LDN   +  +    + +                    I  CWG
Sbjct: 666  MPWNSIVTLGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWG 723

Query: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866
            TLWFD I + +   I         G++D++  DSP DGI+FDEKDE GEKFW R+ R + 
Sbjct: 724  TLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVL 775

Query: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLC-NIHNNIPVLGALE 922
            L + +++ FP +G+ +     ++  R+       L +L FKL+    + +N+   L  L 
Sbjct: 776  LLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLY 835

Query: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982
              I+I+E     N D  A P LSV  G++IF Y GY +L  DY CFDKNG F SA +Y+ 
Sbjct: 836  DTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895

Query: 983  WY-VPXXXXXXXXXXXXXXXEKENEGLFLECIKSDYPEIDFK--------TTYFVFDATS 1033
            W  V                   N  L  E I  D      K        T YFV DATS
Sbjct: 896  WSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATS 955

Query: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093
            WLRH A IFKLA+N  L+FAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E K+
Sbjct: 956  WLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKI 1015

Query: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFN-- 1151
            +P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI+++ K  ++ ++    RL+    N  
Sbjct: 1016 IPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAE---RLTDENKNKG 1072

Query: 1152 --YVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
              + VL++DDD M          T +T+++FSL +KLG    LCT+
Sbjct: 1073 KEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/985 (48%), Positives = 630/985 (63%), Gaps = 87/985 (8%)

Query: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328
            ++S   L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIY++N++LV+NY+TF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388
            ITTA+ P+QP  D  IG+EI+EIY+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 506
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGC--NIFNAEDMFVQNP 564
             + LL++Y+KH E  LLP+F ES +LQ VVL YFI+KFG+D N    N+F +  MFVQN 
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 565  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXX 624
            D FK F+R+  +FA+S ILQIVG+G  K+PF++LFELPKYL                   
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 625  XXXXXGNSRNDNEDDDEIMSSTTSISDHDLL---AEFFNDIDTLRRP-ILPSMLTNEAWL 680
                    R        + ++  ++ ++++     EFF +IDT+  P  +P+ +  + W 
Sbjct: 738  ITQPRLYHR-------WVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSV--DIWN 788

Query: 681  ETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWM 740
             +L++ N  S+KC +IV +KFLH P  IALPH LPW YFIISI L+  +  +    EFW+
Sbjct: 789  HSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWV 848

Query: 741  IIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXX 800
              V+R FPW+++V F+NVL+ Y++DN    SI+ +LC  Y+                   
Sbjct: 849  EFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPE 908

Query: 801  ILGCWGTLWFDTICE-------KNTHSISSED----NFQEIGIKDYMALDSPTDGIIFDE 849
            +  C G+LWFDTI E       KN   I+  D    +++  G+KDY   D P DG  FDE
Sbjct: 909  VWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDE 968

Query: 850  KDENGEKFWKRACRTIFLFRELSRSFP--IGVIIRNDPLIY---RSSFQNTNILGSLV-- 902
             DE GE+FWKRA R IFLF++L+ S+    G+I+  +  ++   +  ++   +   L+  
Sbjct: 969  SDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEF 1028

Query: 903  -FKLEPLCNIHNNIPVLGA-LESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKK 960
             FKL        N    G  L+ II+  E   E N D H  P LS+ +GD+IF YVGYK+
Sbjct: 1029 SFKL--------NASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKR 1080

Query: 961  LRADYTCFDKNGEFLSASLYTTWYVPXXXXXXX-------------------XXXXXXXX 1001
            +  ++  FDKNG+F+S S + +W +                                   
Sbjct: 1081 VCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNN 1140

Query: 1002 EKENEGL-FLECIKSDYPEI----------DFKT-------TYFVFDATSWLRHSARIFK 1043
            +  NE L F EC    Y  +          D +T       TYF+ DATSWLRH A I+K
Sbjct: 1141 DPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYK 1200

Query: 1044 LAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA 1103
            +A +++L+FAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+EN +LPLRFTGNVA
Sbjct: 1201 IATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVA 1260

Query: 1104 THIEENLEFEEQITWRTHVDEFVIESVMKAQEKL-----ESASEPRLSPRRFNYVVLISD 1158
            THIEE+LEFEEQITWR+HVDEFVIE+V+KA+EK      +   +     +    ++L++D
Sbjct: 1261 THIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTD 1320

Query: 1159 DDAMXXXXXXXXXXTLSTRFVFSLC 1183
            D  M          T STRF+FS+ 
Sbjct: 1321 DITMKNKAMDRKIKTFSTRFIFSMA 1345

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/987 (47%), Positives = 631/987 (63%), Gaps = 104/987 (10%)

Query: 267  SNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYV 326
            + K+S  AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IYK+N +L++NY 
Sbjct: 277  TAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYF 336

Query: 327  TFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI 386
             FITTALLP+QP  DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI
Sbjct: 337  MFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI 396

Query: 387  THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIY 446
             +VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY +
Sbjct: 397  IYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTF 456

Query: 447  NHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL 506
             HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ 
Sbjct: 457  GHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHH 516

Query: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566
            RN+ L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+   +FVQ+ + 
Sbjct: 517  RNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSER 575

Query: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXX 626
             K+FFRH   +A+SH+LQ+VGFG+P+NPFA+LFELPK+L                     
Sbjct: 576  LKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHL--------------------- 614

Query: 627  XXXGNSRNDNEDDDEIMSST-----TSISDHDLLA---EFFNDIDTLRRPI-LPSMLTNE 677
                  R D  +  +  SST     TSI D    A   EFF  ID+ +     P  +   
Sbjct: 615  ----KERKDRREKRKSKSSTSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDIN-- 668

Query: 678  AWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKE 737
             W E+L + N+T++KC +IVLRKFLHGPL  ALPH+LPW YF+ +   +   +     + 
Sbjct: 669  IWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRR 728

Query: 738  FWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXX 797
            FW+ +V++ FP++T++TF+NVL++Y+ +   +N    +  + +                 
Sbjct: 729  FWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEE 788

Query: 798  XXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKF 857
               +  CWGTLWFD +   NT  I++  +    G+KD+M +DSP DGI FD  DE+GEKF
Sbjct: 789  LPEVWECWGTLWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKF 845

Query: 858  WKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLE----PLCNIHN 913
            WKR  R I LFR L+   P+G+   +    +R          SLVFK E      C+++ 
Sbjct: 846  WKRCARVILLFRALALECPVGLREISGGRNWR----------SLVFKFEEPPSEWCDMY- 894

Query: 914  NIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGE 973
                L     + D  E  S  N D  A P   +    +I    GY+ L  DY CF++NG+
Sbjct: 895  ----LEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGD 950

Query: 974  FLSASLYTTWYVPXXX------------------XXXXXXXXXXXXEKENEGLFLECIKS 1015
             ++ SLYT   +                                  ++E + +  E ++ 
Sbjct: 951  MITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRH 1010

Query: 1016 DYPEIDFK-----------------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTT 1058
             + + D +                  TYFV DAT+WLRH   ++KLA N +L+FAICLTT
Sbjct: 1011 THCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTT 1070

Query: 1059 FQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITW 1118
            FQELRFLRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TW
Sbjct: 1071 FQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTW 1130

Query: 1119 RTHVDEFVIESVMKAQEKLESASE----------PRLSPRRFNYVVLISDDDAMXXXXXX 1168
            R+HVDEFVIE++ KAQ+K  + ++          P  + +RFN++ L++DD  M      
Sbjct: 1131 RSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGA 1190

Query: 1169 XXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
                  STRF+FS+C +LG  +++CT+
Sbjct: 1191 QNIKAFSTRFMFSVCNELGHAKNVCTN 1217

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/945 (48%), Positives = 609/945 (64%), Gaps = 55/945 (5%)

Query: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NT+L+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393
            L +QP +DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 266  LTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER-------NNGNL 506
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R       N    
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAH 445

Query: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566
            +NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF  KFG D NG ++F+ +DMF QNP+ 
Sbjct: 446  KNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPES 505

Query: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXX 626
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LPKYL                     
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATETPQYR 565

Query: 627  XXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686
                + +          S  +   + D L+  F+DI        P+ L    WLE+L  +
Sbjct: 566  DPFHDKK----------SPESYFQNIDALSSNFDDI--------PTNLN--IWLESLNHI 605

Query: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746
            NMTS++C I VL KFLH P  IALPH L W+YF+++I  +   ++      FW+  ++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRT 665

Query: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWG 806
             PW++MV+  NVL+ Y+LDN   +  +    + +                    I  CWG
Sbjct: 666  MPWNSMVSLANVLVCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWG 723

Query: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866
            +LWFD I + +   I         G++D++  DSP DGI+FDEKDE GE+FW R+ R I 
Sbjct: 724  SLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAIS 775

Query: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLC-NIHNNIPVLGALE 922
            L + +++ FP +G+ +     ++  R+       L    FKL+      +N+   L  L 
Sbjct: 776  LLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELY 835

Query: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982
              I+I+E     N DL A P LSV  G++IF Y GY +L  DY CFDKNG F SA +Y+ 
Sbjct: 836  ETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895

Query: 983  WYVPXXXXXXXXXXXXXXXEKEN------EGLFLECIKSDYP---EIDFKTTYFVFDATS 1033
            W                    +N      E +F + I + Y    E D  T YFV DATS
Sbjct: 896  WSNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATS 955

Query: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093
            WLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 956  WLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKI 1015

Query: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA---SEPRLSPRRF 1150
            +P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI+++ K  +  ++    +E +   ++F
Sbjct: 1016 IPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQF 1075

Query: 1151 NYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
               VL++DDD M          T +T+++FSL +KLG    LCT+
Sbjct: 1076 --AVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/989 (47%), Positives = 624/989 (63%), Gaps = 84/989 (8%)

Query: 256  EREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 315
            +   N S     +K S   L++KLQE+YK IVKQE ELQERCSQLT SQTT+LK+LW IY
Sbjct: 304  DNNHNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIY 363

Query: 316  KINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 375
            K+N +L++NY TFITTALLP+QP  DL+IGQEI+E+YRIERRLW+YGTITFLDVLKNFSN
Sbjct: 364  KLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSN 423

Query: 376  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 435
            FMDPEVCCQFI +VF+S+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAE
Sbjct: 424  FMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAE 483

Query: 436  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 495
            HWY EA+KY + HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQ
Sbjct: 484  HWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQ 543

Query: 496  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN 555
            RAF ERN+G+ R S ++EYLKH+E MLLPSFLE+ + Q VVL++F +KFG   +  N F+
Sbjct: 544  RAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFD 602

Query: 556  AEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXX 615
               +FVQ+ +  K+FFRH   +A+SHILQ+VGFG+P+NPFA+LFELPK +          
Sbjct: 603  PSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCI---------K 653

Query: 616  XXXXXXXXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLT 675
                           ++++D   DD  +             +FF  +++ +     S   
Sbjct: 654  ERKERKEKRKSKSTASNQSDMSIDDTFLGDP---------VQFFETLNSTKTAYRFSQDL 704

Query: 676  NEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVS 735
            N  W E+L ++N TS++C ++VLRKFL+  L  ALPH+LPW YF++++ L+   + +  S
Sbjct: 705  N-IWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDS 763

Query: 736  KEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXX 795
            K FW++ +++ FPW+++  F+NVL++Y+ D + +   I +   +Y               
Sbjct: 764  KRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCEN 823

Query: 796  XXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGE 855
                 +  CWGTLWFD I   N+  +S+  +    G+KD+M LD+P DGI FD  DE+GE
Sbjct: 824  EDLPEVWNCWGTLWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGE 880

Query: 856  KFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKL-EPLCNIHNN 914
            KFWKR  R I LFR ++  FP G           + F  ++   SLVFK  EP       
Sbjct: 881  KFWKRCVRVILLFRGIAYQFPFGF----------TEFNGSDDWKSLVFKFNEPPAEWKEQ 930

Query: 915  IPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEF 974
               LG+        E+ S  NTDL + P   +  G +I    GYK+L  DY CF+KNG+ 
Sbjct: 931  --YLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDL 988

Query: 975  LSASLYTTWY------VPXXXXXXXXXXXXXXXE---------------KENEGLFLECI 1013
            ++ SLYT+        VP               E               KE   +  E +
Sbjct: 989  ITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFL 1048

Query: 1014 KSDY-----------PEIDFK------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICL 1056
            K  Y           P  D +       TYFV DAT+WLRH   ++KLA + LL+FAICL
Sbjct: 1049 KWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICL 1108

Query: 1057 TTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQI 1116
            TTFQELRFLRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+
Sbjct: 1109 TTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQM 1168

Query: 1117 TWRTHVDEFVIESVMKAQEKLESAS-EPRLSPR---------RFNYVVLISDDDAMXXXX 1166
            TWR+HVDEFVIE++ KAQ K    + + + S R         +FN++ L++DD  M    
Sbjct: 1169 TWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKA 1228

Query: 1167 XXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
                    ST+F+F++C ++G  + +CTD
Sbjct: 1229 RAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/736 (57%), Positives = 517/736 (70%), Gaps = 22/736 (2%)

Query: 258 EENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKI 317
           +++D+   +  ++S  AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIYKI
Sbjct: 274 DQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 333

Query: 318 NTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM 377
           NTDL+NNY TFITTALLPSQP  D++IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFM
Sbjct: 334 NTDLINNYTTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFM 393

Query: 378 DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHW 437
           DPEVC QFITHVF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHW
Sbjct: 394 DPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 453

Query: 438 YTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRA 497
           Y EAMK+ Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR 
Sbjct: 454 YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRT 513

Query: 498 FVERN-NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNA 556
           FV+RN  GN RN  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ 
Sbjct: 514 FVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDT 573

Query: 557 EDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXX 616
           +DMF Q P   ++FFRH P+FA+SHILQ+VGFG PKNPFA+LFELPKYL           
Sbjct: 574 QDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNK 633

Query: 617 XXXXXXXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLA-----EFFNDIDTLRRPI-L 670
                          + +D   D+    +  +  DH+L A     E+ ++I+TL+  I  
Sbjct: 634 SKSTSTADVSSTAPKTVDDQATDN---VNEGTNDDHELTATLSGPEYLDNIETLKYAIET 690

Query: 671 PSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQL 730
           P + T   W+++L F+NMTSLKC +IVL+KFLHGPL IALPH LPW  FII+  +K ++L
Sbjct: 691 PDICT---WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNEL 747

Query: 731 SDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXX 790
            +  + +FW I++KR FPWDT+ +F+NVL+ Y+LDN  + +II +LC  Y          
Sbjct: 748 ENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLA 807

Query: 791 XXXXXXXXXXILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEK 850
                     +  CWGTLW+D IC KN+      D F   GI D+M LD P DGI FD +
Sbjct: 808 HFNKSEDLPEVWKCWGTLWYDAICNKNS---VDADTFAGFGIGDHMFLDFPIDGIEFDAE 864

Query: 851 DENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIY-RSSFQNTNILGSLVFKLEPLC 909
           DE G KFWKRA R IFLF+ +S+ F  G+ I ++  +Y R+     + L    FKLE   
Sbjct: 865 DETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESY- 923

Query: 910 NIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFD 969
               + P        I + E  S  N D  A P LSV +G+NIF Y+GY+ L  D   FD
Sbjct: 924 ----DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFD 979

Query: 970 KNGEFLSASLYTTWYV 985
           KNGE +S+S+YT+W +
Sbjct: 980 KNGEIVSSSIYTSWMI 995

 Score =  234 bits (598), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 142/195 (72%), Gaps = 13/195 (6%)

Query: 1014 KSDYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENV 1073
            +S   E+D   T+F+FDATSWLRH A I+K+A N +L+F +CLTTFQELRFLRKSKDENV
Sbjct: 1087 ESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENV 1146

Query: 1074 MEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKA 1133
            +EAA R IIT+RQLY EN++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE+VMKA
Sbjct: 1147 VEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKA 1206

Query: 1134 QEKLESASE-----------PR--LSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVF 1180
            Q+K  +A E           PR  L  +RF+YV L+++D  M          T ST FVF
Sbjct: 1207 QDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVF 1266

Query: 1181 SLCTKLGEQRHLCTD 1195
            SLC+KLG    LCT+
Sbjct: 1267 SLCSKLGMSLDLCTN 1281

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1241

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/722 (56%), Positives = 511/722 (70%), Gaps = 16/722 (2%)

Query: 269 KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328
           K++   LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IYK+NTDL+NNY+TF
Sbjct: 278 KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337

Query: 329 ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388
           ITTALLPSQ   D+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 338 ITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397

Query: 389 VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448
           VF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 398 VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457

Query: 449 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 507
           GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 458 GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517

Query: 508 NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFF 567
           NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 518 NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577

Query: 568 KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 627
           +++FRH P+FA+SHILQ+VGFG PKNPFA+LF+LP +L                      
Sbjct: 578 RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTM- 636

Query: 628 XXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFL 686
               S + N+    I++++  +++ +++ E+F++ID+LR PI  P++L    WL++L+ L
Sbjct: 637 ----SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL---VWLKSLEHL 689

Query: 687 NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746
           NMTSLKC +IVLRKFL GPL IALPH+LPW YFII+  LK+    +  S +FW I+++R 
Sbjct: 690 NMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRI 749

Query: 747 FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXX-XILGCW 805
            PW+T+ +F+NVL+ Y+LDN      I  LC+ Y                     I  CW
Sbjct: 750 LPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCW 809

Query: 806 GTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTI 865
           GTLWFD I  K      + D F  +GI+D+M LD P DGI FDE DE GE FW RA R +
Sbjct: 810 GTLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIV 866

Query: 866 FLFRELSRSFPIGV-IIRNDPL-IYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALES 923
           FLF+ ++ +   G+ + R  P+   R      +IL S  FK+E       +      +  
Sbjct: 867 FLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINK 926

Query: 924 IIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTW 983
           ++ + E   E N D  A P LSV +G+NIF YVGYKKL  +   FD+NGE +S+S+YT W
Sbjct: 927 LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986

Query: 984 YV 985
            +
Sbjct: 987 VI 988

 Score =  233 bits (595), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 137/177 (77%)

Query: 1019 EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1078
            EI+   TYFVFDATSWLRH A I+KL+ N +L FA+CLTTFQELRFLRKSKDENV+ AA 
Sbjct: 1065 EINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAA 1124

Query: 1079 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLE 1138
            R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE+V+KAQ K  
Sbjct: 1125 RAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFI 1184

Query: 1139 SASEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1195
            SA+E     + FN+VVL++DD  M          T +T F+FS+C KLG Q ++CT+
Sbjct: 1185 SANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/737 (47%), Positives = 473/737 (64%), Gaps = 36/737 (4%)

Query: 262 SCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDL 321
           S  P +  RS  ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN +L
Sbjct: 263 SILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVEL 322

Query: 322 VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 381
           VNNYV FITTALLPSQ   DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+
Sbjct: 323 VNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEI 382

Query: 382 CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 441
           CCQFI HVF+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EA
Sbjct: 383 CCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEA 442

Query: 442 MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 501
           MKY Y  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R
Sbjct: 443 MKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISR 502

Query: 502 NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFV 561
              +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MFV
Sbjct: 503 GEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFV 562

Query: 562 QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXX 621
           QN +  K++FRH P FAQ+HILQ+VG+G   N FA+L+ELPK++                
Sbjct: 563 QNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGV 622

Query: 622 XXXXXXXXGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWL 680
                        DN   D +    +    HD + E+FN ++ + +   LP  +  + W+
Sbjct: 623 -------------DNMSIDTLSFQVSGNEIHD-VGEYFNSLENIDKEFTLPPNV--DIWI 666

Query: 681 ETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWM 740
           ++L++ N T + CG++VL+KFL GP   ALPH+LPW+YF+IS+  K   L D  S+ FW 
Sbjct: 667 QSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWK 726

Query: 741 IIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXX 800
           + ++R FPW+T++ F+NVLI +L DN  S S++  LC+ Y +                  
Sbjct: 727 LFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPE 786

Query: 801 ILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKR 860
           +  CWG+LWFDTI  K+  S S     +  GIKD   LD+P DGI+FDE+D+NG KFWKR
Sbjct: 787 VWNCWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKR 843

Query: 861 ACRTIFLFRELSRSFPIGVIIRN-------DPLIYRSSFQNTNILGSLVFKLEPLCNI-- 911
           ACR +FLF+  +  F  G+ + N       +  I+    +  NI    +FK +P  ++  
Sbjct: 844 ACRILFLFKGYAEKFDQGLRLTNINSLNSEEENIFTKKQEKRNI--DFLFKFDPTYDLLP 901

Query: 912 -----HNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYT 966
                +    V       +   E+ SENN  L AVP+LSV +G++IF YVGYKKL   Y 
Sbjct: 902 IDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYY 961

Query: 967 CFDKNGEFLSASLYTTW 983
            +DKNG     ++Y+ W
Sbjct: 962 YYDKNGNVNKGAIYSNW 978

 Score =  196 bits (497), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 134/203 (66%), Gaps = 27/203 (13%)

Query: 1020 IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATR 1079
            + + +TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR
Sbjct: 1080 VAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATR 1139

Query: 1080 GIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKL-- 1137
             +I IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE+V K+QE    
Sbjct: 1140 AVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF 1199

Query: 1138 -----ESA-----------SEPRLSPRRFN---------YVVLISDDDAMXXXXXXXXXX 1172
                 ESA           ++   + +R N           VL++DD  M          
Sbjct: 1200 DELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIR 1259

Query: 1173 TLSTRFVFSLCTKLGEQRHLCTD 1195
            T STRF+FS+C++LG +  +CT+
Sbjct: 1260 TCSTRFIFSICSQLGMKYGICTN 1282

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W
          Length = 1229

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/719 (49%), Positives = 469/719 (65%), Gaps = 46/719 (6%)

Query: 275 LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALL 334
           L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN +L++NY+ FITTALL
Sbjct: 284 LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 335 PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 394
           PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct: 344 PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 395 TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 454
            M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct: 404 NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 455 MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 514
           MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 464 MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 515 LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHG 574
           LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +F+Q+ +  K+FFRH 
Sbjct: 524 LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 575 PSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXXXGNSRN 634
             F+QSHILQ+ GFG+PKNPFA+LFEL K+L                          S +
Sbjct: 583 SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKST------------KSTS 630

Query: 635 DNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC 693
           +   D    SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct: 631 EGSLDPVEFSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC 684

Query: 694 GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMV 753
           G+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+FW++ ++R FPWD+++
Sbjct: 685 GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI 744

Query: 754 TFMNVLIVYLLDNQTSNSIIGDLCDDYDKXXXXXXXXXXXXXXXXXXILGCWGTLWFDTI 813
           TFMN LI Y +   T N  I      Y                       CWG+LWF+TI
Sbjct: 745 TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI 804

Query: 814 CEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFR---- 869
            +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W+R CRT+ LF     
Sbjct: 805 SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861

Query: 870 -ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALE 922
            E    +  G    N        L++R    N +    L  +L P  N   + P     E
Sbjct: 862 WEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYPEEN--ESFP-FEKFE 915

Query: 923 SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYT 981
            I +++ + +  +     +P +S+       +  G+K +  DY CF+KNG+ ++ASLYT
Sbjct: 916 IISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFCFNKNGDLITASLYT 968

 Score =  195 bits (495), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 135/191 (70%), Gaps = 14/191 (7%)

Query: 1019 EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1078
            + D   T+FV DAT+WLRH A I+KLA + +L+FAICLTTFQELRFLRKSKDE+V+EAAT
Sbjct: 1039 QADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAAT 1098

Query: 1079 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLE 1138
            R +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI+++ KAQ+K  
Sbjct: 1099 RAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFN 1158

Query: 1139 --------------SASEPRLSPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCT 1184
                            SE   S +RFN+V L++DD  M          T STRFVF++C 
Sbjct: 1159 VLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICR 1218

Query: 1185 KLGEQRHLCTD 1195
            +LG +  +CT+
Sbjct: 1219 ELGRETGVCTN 1229

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  526 bits (1354), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 268/382 (70%), Positives = 302/382 (79%), Gaps = 43/382 (11%)

Query: 267 SNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYV 326
           + K S  ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIYKIN DL+NNY+
Sbjct: 390 TTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYI 449

Query: 327 TFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI 386
            FIT ALLP+Q  +DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI
Sbjct: 450 NFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFI 509

Query: 387 THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIY 446
           +HVF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y
Sbjct: 510 SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTY 569

Query: 447 NHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL 506
           +HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN 
Sbjct: 570 SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNH 629

Query: 507 RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI-------------------- 546
           RN  LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI                    
Sbjct: 630 RNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGAN 689

Query: 547 -----------------------DANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHIL 583
                                       +IF  +DMF+QNPD  KYFFRH  +FAQSHIL
Sbjct: 690 VNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHIL 749

Query: 584 QIVGFGEPKNPFAILFELPKYL 605
           Q+VGFG+PKNPFA+LFELPK+L
Sbjct: 750 QLVGFGDPKNPFALLFELPKFL 771

 Score =  210 bits (534), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 138/391 (35%), Positives = 198/391 (50%), Gaps = 63/391 (16%)

Query: 654  LLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPH 712
            L  EFF +ID L+ P  +P  +  E WLE+LK +N+ SLKC IIVL+KFL+GP+ IALPH
Sbjct: 864  LCEEFFENIDLLQFPYKIPQTI--EIWLESLKNINLISLKCSIIVLKKFLNGPILIALPH 921

Query: 713  ILPWIYFIISICLK-SSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNS 771
            +L WI+FIISI LK  + ++D  SK FW   +K   PW+++V F+NVL+VYLLDN    +
Sbjct: 922  LLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN 981

Query: 772  --IIGDLCDDYDKXXXXXXXXXXX---XXXXXXXILGCWGTLWFDTICEKNTHS------ 820
              +I  L + Y+                      I  CWGTLWFD IC KN +S      
Sbjct: 982  FKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLN 1041

Query: 821  ---------------------ISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWK 859
                                   ++   + +GI+D+  LD P DGI F   DE+G  F+K
Sbjct: 1042 QNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYK 1101

Query: 860  RACRTIFLFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLC------- 909
            R+ R IFL + +  +FP +G+ I ++   Y   +      IL +  FKL  L        
Sbjct: 1102 RSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII 1161

Query: 910  ----------------NIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEG-DNI 952
                            ++  N  +L  +     I E   E N +L   P LS+  G +NI
Sbjct: 1162 PQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221

Query: 953  FHYVGYKKLRADYTCFDKNGEFLSASLYTTW 983
            F+Y+GYK+L  +   F +NGE +S S+Y++W
Sbjct: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSW 1252

 Score =  190 bits (482), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 86/117 (73%), Positives = 106/117 (90%)

Query: 1025 TYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITI 1084
            T+FVFDATSWLRH A I+KL++N  L+FA+CLTTFQELRFLRKSKD NV+EA+TR IIT+
Sbjct: 1331 TFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITM 1390

Query: 1085 RQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESAS 1141
            RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE+++++QE+ ++ S
Sbjct: 1391 RQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKS 1447

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  454 bits (1169), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 283/413 (68%), Gaps = 76/413 (18%)

Query: 269 KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328
           K+S   LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IYK+N DL+NNY+ F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 329 ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388
           I T+L PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITH
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 389 VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448
           VF S+S MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 449 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----- 503
           GKLYYH+STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ERN+     
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 504 ------------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFG 545
                              N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 546 ----------------------------------------------------IDANGCNI 553
                                                               +  N  N+
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 554 FNAEDMFVQ-NPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL 605
           FN  ++F Q N D  KYFF++  +FA+SHILQ++GFG+PKNPFA+LF+LPKYL
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  233 bits (593), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/331 (42%), Positives = 174/331 (52%), Gaps = 73/331 (22%)

Query: 929  EARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYV--- 985
            E  S  NTDL+  P LS+ E +++F Y GYK+   D++ FDKNGE +S SLYT+  +   
Sbjct: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTI 1210

Query: 986  -------------------------PXXXXXXXXXXXXXXXEKENEGLFL-------ECI 1013
                                                       +N+ LFL       + +
Sbjct: 1211 NGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKIL 1270

Query: 1014 KSDYPEID--------------FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTF 1059
              DY  ID              F  TYFV DATSWLRH A ++KLA N +L+FAICLTTF
Sbjct: 1271 DPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTF 1330

Query: 1060 QELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWR 1119
            QELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITWR
Sbjct: 1331 QELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWR 1390

Query: 1120 THVDEFVIESVMKAQEKLESASEPRLSPRRFNY--------------------VVLISDD 1159
            +HVDEFVIE++ +AQ K         S    +                      VL++DD
Sbjct: 1391 SHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDD 1450

Query: 1160 DAMXXXXXXXXXX----TLSTRFVFSLCTKL 1186
             +M              T ST+FVFSLC  L
Sbjct: 1451 ISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  203 bits (517), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/280 (39%), Positives = 169/280 (60%), Gaps = 17/280 (6%)

Query: 634  NDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLK 692
            N  ED+DE++ + +         +FFN++++L+    LP+ L  E W E+LK++N+ SL 
Sbjct: 774  NGMEDEDEMLDNLSP-------QDFFNNLESLKLSFFLPNSL--EIWNESLKYINIISLN 824

Query: 693  CGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTM 752
            C IIVL+KFL+GPL ++LPH+LPW YFIIS+ L+   L +  S+ FW+  +++ FPW+++
Sbjct: 825  CSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSI 884

Query: 753  VTFMNVLIVYLLDNQTSNSIIGDLCDDY-DKXXXXXXXXXXXXXXXXXXILGCWGTLWFD 811
            V+++NV+I  LLDN   NS+I  L ++Y +K                  +  C+G+LWFD
Sbjct: 885  VSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFD 944

Query: 812  TICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFREL 871
             I E   + I S D  + I +KD   L+ P DG+ FDE +ENG  FWKR+CR IFLF+ +
Sbjct: 945  VIAEN--YQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTM 1002

Query: 872  SRSFP--IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEP 907
               F    G+ I ++  +Y  RS   N +IL +  FKL P
Sbjct: 1003 ITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLP 1042

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  143 bits (361), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 193/939 (20%), Positives = 372/939 (39%), Gaps = 191/939 (20%)

Query: 311  LWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 370
            L  ++K++T +V+ Y  FI  AL  +    DL+ G+E V   R+  RL  +     L+++
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 371  KNFSNFM----------DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 420
            +N+ N M          + +   +FI    + ++ M+ +IP K+   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 421  ALYPSSFIDWKLSAEHWY-----TEAMKYIYNHGK----------LYYHMSTVQQNTLEA 465
             L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 466  FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPS 525
             V L K +  + T        QL ID I  +   ++   NL+ S+    +      LL  
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYFTLLSL 381

Query: 526  FLESPD------LQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNP----------DFFKY 569
            F  S        ++   L YF  +F       N ++     ++ P          ++  +
Sbjct: 382  FFGSTSSSQLSGMERSSLHYFWNEFA------NEYHLNYSSLRKPVNCKYRQKEINYSMF 435

Query: 570  FFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXXX 629
            +F + P F+   I++ +   +  NPF  +++                             
Sbjct: 436  YFNNAPLFSLISIVETIIMNKKLNPFFCVYK----------------------------- 466

Query: 630  GNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFLNMT 689
                  + DD EI S   S+S+  +L E  +D                           T
Sbjct: 467  ------SSDDFEIKS--VSLSNWKILIEQMDD---------------------------T 491

Query: 690  SLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPW 749
             L    ++ +KFL   + I+ P ILPW+ F IS+  + + ++D      W  +++   PW
Sbjct: 492  LLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPW 551

Query: 750  DTMVTFMNVLIVYL----LDNQTSNSIIGDL--CDDYDKXXXXXXXXXXXXXXXXXXILG 803
            D +VT++N  I  +    ++++T  ++I ++  C  YD                   I  
Sbjct: 552  DDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYD------LLYYMMYESNFQEISM 605

Query: 804  CWGTLWFDTICEK-NTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRAC 862
            C G +WFD++  K    SI++ ++  +     + + ++  D +I+D+ D+   K W RA 
Sbjct: 606  CEGFIWFDSLASKIKQASITTNESLMK-----FKSYNASEDSLIYDDDDQVYTKMWTRAL 660

Query: 863  RTIFLFRELSRSFP--IGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGA 920
              I L + +   +P  I V IR   L   S  +N++ L +                    
Sbjct: 661  LIILLIKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTN-------------------- 700

Query: 921  LESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLY 980
             + + D     + NN     + + +++  + IF +        D+  FDKNG+       
Sbjct: 701  -DYLFDWGFELNNNNA---VIIDDTLHGRNRIFKF----SYIPDFQDFDKNGDI------ 746

Query: 981  TTWYVPXXXXXXXXXXXXXXXEKENEGLFLE-------CIKSDYPEIDFK-------TTY 1026
             TW                    E +G F +          +DY E   K         Y
Sbjct: 747  -TW--GYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNY 803

Query: 1027 FVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIR 1085
            F+ D  +WL+HS ++ +      ++  + ++   +L  L+  S+ E+V  +A+R +I I 
Sbjct: 804  FMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVIN 863

Query: 1086 QLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRL 1145
             LY  N++  L+   +  +   +N++  + + +       ++       ++L       +
Sbjct: 864  YLYAMNQINILKEFESPISKALKNIDGSQILNFNGKFKNDLLTKENGPGQQL------NM 917

Query: 1146 SPRRFNYVVLISDDDAMXXXXXXXXXXTLSTRFVFSLCT 1184
               R + VV++SDD              +ST+ +FS+ +
Sbjct: 918  IELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>YPL075W Chr16 (412254..412261,413013..415362) [2358 bp, 785 aa]
           {ON}  GCR1Transcriptional activator of genes involved in
           glycolysis; DNA-binding protein that interacts and
           functions with the transcriptional activator Gcr2p
          Length = 785

 Score = 32.3 bits (72), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 11/93 (11%)

Query: 893 QNTNILGSLVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNI 952
           +N+N LG+   K  P+ NIHN+     +  ++   + +  ++++    + +     G N 
Sbjct: 575 KNSNPLGTDADKPVPISNIHNSTEAANSSGTVTKTAPSFPQSSSKFEIINKKDTKAGPN- 633

Query: 953 FHYVGYKKLRADYTCFDKNGEFLSASLYTTWYV 985
              + YK  R + T +D         LY  WY+
Sbjct: 634 -EAIKYKLSRENKTIWD---------LYAEWYI 656

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 122,269,093
Number of extensions: 5360278
Number of successful extensions: 19499
Number of sequences better than 10.0: 157
Number of HSP's gapped: 20118
Number of HSP's successfully gapped: 203
Length of query: 1195
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1074
Effective length of database: 39,606,813
Effective search space: 42537717162
Effective search space used: 42537717162
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)