Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR095W-A (PCC1)5.705ON88884432e-58
Smik_11.3595.705ON88883911e-50
Skud_11.3355.705ON94943755e-48
Suva_11.3325.705ON1111113462e-43
Kpol_YGOB_1043.725.705ON88883182e-39
NCAS0A031805.705ON88873112e-38
TDEL0B021505.705ON91812982e-36
KAFR0H001905.705ON82812903e-35
NDAI0E050605.705ON86852887e-35
TBLA0G010305.705ON89872825e-34
SAKL0E14982g5.705ON89852801e-33
KNAG0C066205.705ON101892742e-32
KLTH0E00990g5.705ON89882722e-32
Kwal_YGOB_Anc_5.7055.705ON88882704e-32
ZYRO0B16368g5.705ON85812696e-32
KLLA0A00539g5.705ON87862574e-30
TPHA0E002005.705ON85742504e-29
Ecym_40165.705ON125952362e-26
AFR289W5.705ON81792027e-22
CAGL0G02535g5.705ON140541823e-18
Ecym_12203.508ON72874631.3
AGR088W8.260ON288735631.4
KNAG0A042408.455ON69443622.1
Kpol_1031.578.455ON68936603.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR095W-A
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   175   2e-58
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   155   1e-50
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   149   5e-48
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   137   2e-43
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   127   2e-39
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   124   2e-38
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   119   2e-36
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   116   3e-35
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   115   7e-35
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   113   5e-34
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   112   1e-33
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   110   2e-32
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   109   2e-32
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   108   4e-32
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   108   6e-32
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   103   4e-30
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   100   4e-29
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    96   2e-26
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    82   7e-22
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    75   3e-18
Ecym_1220 Chr1 complement(452005..454191) [2187 bp, 728 aa] {ON}...    29   1.3  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...    29   1.4  
KNAG0A04240 Chr1 complement(577186..579270) [2085 bp, 694 aa] {O...    28   2.1  
Kpol_1031.57 s1031 (144087..146156) [2070 bp, 689 aa] {ON} (1440...    28   3.4  

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  175 bits (443), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
          IDDRVLRVGVSSIIDSIKTIVEAMDVLS
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  155 bits (391), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          M+SKRE  L HTLELK+PF+TE+QA IAT+VLSPDPILKPQDFQ+DYSSEKNVMLVQFRS
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
          IDDRVLRVGVSS+IDSIKT+VEAMD LS
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  149 bits (375), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 84/94 (89%), Gaps = 6/94 (6%)

Query: 1  MTSKREKSLDHTL------ELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVM 54
          MTSKRE SLD+TL      EL+IPFETE QA+IATKVLSPDPILKPQDFQVDYSSEKN+M
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 LVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
          LV+FRSIDDRVLRVGVSS+IDSIKTIVE +D LS
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  137 bits (346), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/111 (65%), Positives = 79/111 (71%), Gaps = 23/111 (20%)

Query: 1   MTSKREKSLDHTL-----------------------ELKIPFETERQATIATKVLSPDPI 37
           M S+RE  LDHTL                       ELKIPFETE+QA IAT+VLSPDPI
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 38  LKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
           LKPQDFQ DYSSE NVML +FRSIDDRVLRVGVSS+IDSIKTI+E MD LS
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  127 bits (318), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          M ++R   +DHTL+ +IPFET RQA IA +VL PDPILKPQDFQV YSS  N+++++F+S
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
          IDDRVLRVGVSS+IDS+KTI+E MD LS
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  124 bits (311), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 70/87 (80%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          M + RE SLD+ L L+IPF T RQA IA KVL PDPILKPQDFQV+Y S+ N++ V FR 
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVL 87
          IDDRVLRVGVSS+IDSIKTI+E +D L
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  119 bits (298), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%)

Query: 8  SLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLR 67
          SL+H+L+L+IPF+T  QA IA +VL PDPILKPQDFQVDY++  NV++V F+SIDDRVLR
Sbjct: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLR 61

Query: 68 VGVSSIIDSIKTIVEAMDVLS 88
          VGVSS+IDSIKTIVE +D L 
Sbjct: 62 VGVSSVIDSIKTIVETIDELG 82

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  116 bits (290), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 8  SLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLR 67
          +LDHTL+L+IPFE  +QA IA  VL PDPIL+PQDFQV Y +  NV + +F SIDDRVLR
Sbjct: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61

Query: 68 VGVSSIIDSIKTIVEAMDVLS 88
          VGVS++IDS+KTI+E MD LS
Sbjct: 62 VGVSNVIDSLKTIIETMDELS 82

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  115 bits (288), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 56/85 (65%), Positives = 72/85 (84%), Gaps = 4/85 (4%)

Query: 7  KSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDY----SSEKNVMLVQFRSID 62
          ++LD+TLE++IPF  ER ATIA +VLSPDPILKP+DFQV+Y    +   NV+LV+F+SID
Sbjct: 2  RTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSID 61

Query: 63 DRVLRVGVSSIIDSIKTIVEAMDVL 87
          +RVLRVGVSS++DSIKTI+E MD L
Sbjct: 62 ERVLRVGVSSVLDSIKTILETMDEL 86

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  113 bits (282), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (81%), Gaps = 2/87 (2%)

Query: 3  SKREKSL--DHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          SKR+ ++  +HTL L IPF T +QA IA +VL PDPIL+PQDFQV Y+S+ N ++++F+S
Sbjct: 2  SKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQS 61

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVL 87
          IDDRVLRVGVSS+IDS+KTI+E  D L
Sbjct: 62 IDDRVLRVGVSSVIDSVKTIIETFDEL 88

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (77%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          M + R+ SLDH L L+IP ET  QA IA K L PDP+LKP+DFQV+YS+    + V F+S
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMD 85
          IDDRVLRVGVSS+I+S+KTI+E MD
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMD 85

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  110 bits (274), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 53/89 (59%), Positives = 68/89 (76%), Gaps = 2/89 (2%)

Query: 1  MTSK--REKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQF 58
          MT+K  R  +LDHTL L +PFET RQA IA++VL PDPILKPQDF V Y+++   +  +F
Sbjct: 1  MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF 60

Query: 59 RSIDDRVLRVGVSSIIDSIKTIVEAMDVL 87
             D RVLRVGVSS+IDS+KTI+E++D L
Sbjct: 61 CGRDARVLRVGVSSVIDSLKTIIESLDEL 89

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 66/88 (75%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          M   R+  L +TL L++PF+T +QA  A KVL PDPILKPQDF V+YSS+ + + V F  
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
          +DDRVLRVGVSS+I+SIKTI+E +D  S
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 66/88 (75%)

Query: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60
          M S R  +L +TL L++PF+ ++QA  A +VL PDPILKPQDF V+Y+S  N + V F  
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
          +DDRVLRVGVSS+I+SIKTIVE +D  S
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  108 bits (269), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%)

Query: 7  KSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVL 66
            LDH L L IPF  +R + +A KVL PDPIL+P+DFQV+Y S+ N++ + F+S+DDRVL
Sbjct: 2  NHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVL 61

Query: 67 RVGVSSIIDSIKTIVEAMDVL 87
          RVGVSS+IDS+KTIVE +D L
Sbjct: 62 RVGVSSVIDSVKTIVETIDEL 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  103 bits (257), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 68/86 (79%)

Query: 3  SKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSID 62
          +K + S +H+L L+IPFE+ +QA +A KVL PDPI+KP+DFQV YS++   ++  F S+D
Sbjct: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61

Query: 63 DRVLRVGVSSIIDSIKTIVEAMDVLS 88
          +R+LRVGV+S+I+SIKTIVE +D L 
Sbjct: 62 ERILRVGVNSVIESIKTIVETIDELC 87

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  100 bits (250), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 64/74 (86%)

Query: 14 ELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSI 73
          +L IPFET +QA+IA +VL PDP L+P++F+VDYSS+ + ++V F+S+DDRVLRVGVS++
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 74 IDSIKTIVEAMDVL 87
          IDSIKTI+E +D L
Sbjct: 69 IDSIKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 67/95 (70%), Gaps = 8/95 (8%)

Query: 2   TSKREKSLDH---TLE-----LKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNV 53
           TS  +KSLDH   TL      L++PFE  +QA IA +VL  DP+L+P+DF+VDY+ +   
Sbjct: 30  TSFLKKSLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEK 89

Query: 54  MLVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS 88
           +LV F SID R LRVGVSS+I+SIKT+VE MD  S
Sbjct: 90  LLVNFNSIDARSLRVGVSSVIESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 82.4 bits (202), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (70%)

Query: 9  LDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRV 68
          +DHTL L +PFE+ R A IA + L+PDP+L+P++  V ++S+   + ++  +ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 69 GVSSIIDSIKTIVEAMDVL 87
            +SI +++KT+VE  D L
Sbjct: 61 ATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 74.7 bits (182), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (79%)

Query: 14 ELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLR 67
          +L +PFET R A IA +VL PDPIL+P+DFQV+Y ++  V+ + F++IDDRVLR
Sbjct: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>Ecym_1220 Chr1 complement(452005..454191) [2187 bp, 728 aa] {ON}
           similar to Ashbya gossypii AFR545W
          Length = 728

 Score = 28.9 bits (63), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 14/74 (18%)

Query: 2   TSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQ-----------DFQVDYSSE 50
           T   +K   +T+EL  P+E  + + I T ++ PD    PQ           D+Q+ +S E
Sbjct: 286 TGAVDKLHGNTVELLSPYEYPQLSAIRTSLVDPD---TPQSARTRKAKDGSDWQLVFSDE 342

Query: 51  KNVMLVQFRSIDDR 64
            N +   F S DD+
Sbjct: 343 FNAIGRTFYSGDDQ 356

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 28.9 bits (63), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 34   PDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRV 68
            PD I     F+VD+S E    L++ R IDDR+ +V
Sbjct: 1884 PDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKV 1918

>KNAG0A04240 Chr1 complement(577186..579270) [2085 bp, 694 aa] {ON}
           Anc_8.455 YDR234W gene spans a gap in the genome
           sequence
          Length = 694

 Score = 28.5 bits (62), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 28  ATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGV 70
           ATKV +P  I+   D  +  +SEKN  L ++R+I++   + G+
Sbjct: 71  ATKVANPKQIVNTLDHDIQNTSEKN--LTKYRNIENFAGKHGI 111

>Kpol_1031.57 s1031 (144087..146156) [2070 bp, 689 aa] {ON}
           (144087..146156) [2070 nt, 690 aa]
          Length = 689

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 28  ATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDD 63
           ATK+  PD I+   D  V   SEKN  L ++R+I++
Sbjct: 70  ATKLKYPDQIVNTLDHDVQNKSEKN--LTKYRNIEN 103

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,013,483
Number of extensions: 272770
Number of successful extensions: 839
Number of sequences better than 10.0: 30
Number of HSP's gapped: 836
Number of HSP's successfully gapped: 30
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)