Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR095W (MLP1)5.702ON1875187581860.0
Skud_11.3345.702ON1885185659540.0
Smik_11.3585.702ON1878184858820.0
Suva_11.3315.702ON1898186357150.0
ZYRO0G06600g5.702ON1820181123480.0
TDEL0B021905.702ON1810186723010.0
SAKL0E14916g5.702ON1779179922650.0
Ecym_40185.702ON1769177620030.0
NCAS0A032005.702ON1788178519750.0
CAGL0G02497g5.702ON1780172419020.0
Kwal_55.196975.702ON1760141718370.0
KLTH0E01056g5.702ON1771136718060.0
NDAI0E050405.702ON1973171516610.0
KLLA0A00594g5.702ON1748141115281e-180
AFR286W5.702ON1758140814251e-165
TBLA0E017305.702ON1820141811001e-122
Suva_9.395.702ON168215608636e-93
Skud_9.195.702ON168014228031e-85
Smik_9.205.702ON168213847663e-81
YIL149C (MLP2)5.702ON167914167413e-78
NCAS0G002305.702ON173512356394e-66
KNAG0C065905.702ON165110075841e-59
KAFR0H002105.702ON145411275751e-58
Kpol_1043.705.702ON13214704524e-44
NDAI0F002905.702ON15545553603e-33
KNAG0L021405.702ON16089003551e-32
KAFR0D022205.702ON16746443173e-28
TPHA0E002305.702ON12844823012e-26
TPHA0D046105.702ON11836671931e-13
Kpol_2001.755.702ON1006861097e-04
TPHA0B008304.238ON253695920.078
YDL058W (USO1)4.238ON1790396910.089
KAFR0G032004.238ON1869290870.27
Skud_7.1966.188ON745127840.57
NDAI0D029304.46ON960213840.59
TDEL0B070902.616ON773153830.69
NDAI0A008301.162ON68491820.96
KAFR0D00520na 1ON59862811.1
KLLA0E05281g4.238ON1755183802.1
TBLA0B028908.849ON64876783.2
NCAS0A059604.46ON920250773.6
Ecym_12373.492ON72739765.2
KNAG0F006501.110ON1306164765.7
KLTH0D09504g8.604ON718313756.5
ZYRO0D15642g7.186ON1170192756.6
Smik_5.501.487ON95868756.6
ZYRO0B08778g4.375ON166234757.9
TDEL0A054908.604ON781172748.5
Ecym_53454.238ON1366398748.7
ZYRO0C00814g7.21ON71389749.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR095W
         (1875 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...  3157   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...  2298   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...  2270   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...  2206   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   909   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   890   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   877   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   776   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   765   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   737   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   712   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   700   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   644   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   593   e-180
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   553   e-165
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   428   e-122
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   337   6e-93
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   313   1e-85
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   299   3e-81
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   290   3e-78
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   250   4e-66
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   229   1e-59
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   226   1e-58
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   178   4e-44
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   143   3e-33
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   141   1e-32
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   126   3e-28
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   120   2e-26
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    79   1e-13
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    47   7e-04
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    40   0.078
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    40   0.089
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    38   0.27 
Skud_7.196 Chr7 (350356..352593) [2238 bp, 745 aa] {ON} YGL086W ...    37   0.57 
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    37   0.59 
TDEL0B07090 Chr2 complement(1249326..1251647) [2322 bp, 773 aa] ...    37   0.69 
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    36   0.96 
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...    36   1.1  
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    35   2.1  
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...    35   3.2  
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    34   3.6  
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    34   5.2  
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    34   5.7  
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    33   6.5  
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    33   6.6  
Smik_5.50 Chr5 (72674..75550) [2877 bp, 958 aa] {ON} YEL043W (REAL)    33   6.6  
ZYRO0B08778g Chr2 complement(685232..690220) [4989 bp, 1662 aa] ...    33   7.9  
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    33   8.5  
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    33   8.7  
ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON...    33   9.8  

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 3157 bits (8186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1639/1875 (87%), Positives = 1639/1875 (87%)

Query: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60
            MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN
Sbjct: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60

Query: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120
            LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL
Sbjct: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120

Query: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180
            EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180

Query: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240
            TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR
Sbjct: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240

Query: 241  NELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQ 300
            NELNRLRNDFQMERTNNDVLKQKNN            IKGLSDSLNSEKQEFSAEMSLKQ
Sbjct: 241  NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ 300

Query: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKE 360
            RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPEN              AQCEKE
Sbjct: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKE 360

Query: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420
            CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI
Sbjct: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480
            INSFKERTDM             HTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL
Sbjct: 421  INSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480

Query: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540
            CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII
Sbjct: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540

Query: 541  QLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRI 600
            QLQEKNAELLKVVRNLAD                   TVNEAKEAIITLKSEKMDLESRI
Sbjct: 541  QLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRI 600

Query: 601  XXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660
                       TSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL
Sbjct: 601  EELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660

Query: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720
            LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT
Sbjct: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720

Query: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSL 780
            ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVH            SPEKDSL
Sbjct: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSL 780

Query: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840
            RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN
Sbjct: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840

Query: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900
            IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI
Sbjct: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900

Query: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960
            NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD
Sbjct: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960

Query: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020
            EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES
Sbjct: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020

Query: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080
            KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ
Sbjct: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080

Query: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140
            LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG
Sbjct: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140

Query: 1141 PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS 1200
            PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS
Sbjct: 1141 PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS 1200

Query: 1201 SIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTA 1260
            SIIQQHDDIMEKLNQLNLLRESNIT               QSELDKLKQNVAPIESELTA
Sbjct: 1201 SIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTA 1260

Query: 1261 LKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXR 1320
            LKYSM             VHRWKKRSQDILEKHEQLSSSDY                  R
Sbjct: 1261 LKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKER 1320

Query: 1321 QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQN 1380
            QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQN
Sbjct: 1321 QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQN 1380

Query: 1381 AKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXXX 1440
            AKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTING                
Sbjct: 1381 AKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQR 1440

Query: 1441 XXXXXXXATSANEQNDLSNIVESMXXXXXXXXXXXXXXXTQEVNEKILEAQERLNQPSNI 1500
                   ATSANEQNDLSNIVESM               TQEVNEKILEAQERLNQPSNI
Sbjct: 1441 QIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNI 1500

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXX 1560
            NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT                        
Sbjct: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVE 1560

Query: 1561 XXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKL 1620
                SMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKL
Sbjct: 1561 ERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKL 1620

Query: 1621 RAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPP 1680
            RAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPP
Sbjct: 1621 RAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPP 1680

Query: 1681 KSVNNVQNPLLGLPRKIEENSNSPFNPXXXXXXXXXXXXXXXXXXFNPFTSPSPNKHLQN 1740
            KSVNNVQNPLLGLPRKIEENSNSPFNP                  FNPFTSPSPNKHLQN
Sbjct: 1681 KSVNNVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKLNSKSSSGGFNPFTSPSPNKHLQN 1740

Query: 1741 DNDKRESLANKTDPPTHLEPSFNIPASRGLIXXXXXXXXXXNDEELTSNNPAQKDSSNRN 1800
            DNDKRESLANKTDPPTHLEPSFNIPASRGLI          NDEELTSNNPAQKDSSNRN
Sbjct: 1741 DNDKRESLANKTDPPTHLEPSFNIPASRGLISSSSTLSTDTNDEELTSNNPAQKDSSNRN 1800

Query: 1801 VQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDEDDTTENINESXXXXXXX 1860
            VQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDEDDTTENINES       
Sbjct: 1801 VQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDEDDTTENINESKKIKTED 1860

Query: 1861 XXXXXXXXVNDENSI 1875
                    VNDENSI
Sbjct: 1861 EEEKETDKVNDENSI 1875

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 2298 bits (5954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1230/1856 (66%), Positives = 1444/1856 (77%), Gaps = 3/1856 (0%)

Query: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60
            MSD    M+S QN E + ERLN IASFF CSLEQVKS D D++  LN+KL+QFNELKSEN
Sbjct: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60

Query: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120
            L++TVSFDELK +SLKKIDGLKTEMENV+R+ND+IRKERNDT  KFE ++NEK++LS+EL
Sbjct: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120

Query: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180
            E VKRKL+DLTEEKKE QSNQQRTLKILDERLKE+E+ +VENNR+N+EC+ LRST+++LE
Sbjct: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180

Query: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240
            TKQQ YITNDLNSR+ELERKTQEL LLQSN DWLEKEL SK+EQYLSYRQ+TD  I +IR
Sbjct: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240

Query: 241  NELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQ 300
            +ELNRL+NDFQ+E+TNNDVLKQKNN            +K LSDSLN+EKQEFS E++LKQ
Sbjct: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300

Query: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKE 360
            RL+DLLE+QLNAVKEEL SIR+ +++ V +DDS+K   EN              AQCE E
Sbjct: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360

Query: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420
            CLRLSSIT+E  E++  L+++SS+DFI LKKQ IKE+R KE LQNQIE+FIVELEHKVP+
Sbjct: 361  CLRLSSITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480
            INSFKERTDM             HTSNEKNAK++ELN KN+K+ +CEND+  LT+QRLDL
Sbjct: 421  INSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480

Query: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540
            CRQ+QYLLITNSVSNDSKGPLRKEEI+FIQNI+Q D+S  TESDSQK++T RLVEF+N+I
Sbjct: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540

Query: 541  QLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRI 600
            +LQEKN ELL++ RNLAD                   T+NEAKEAI++L+SEKM LES++
Sbjct: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKV 600

Query: 601  XXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660
                       +S+  + +S++N  I+QLT+TKR+LESQVQDLQ RISQITREST+NMSL
Sbjct: 601  EELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660

Query: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720
            LNKEIQD+YDSKSDISI+LGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKR D LQ++
Sbjct: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720

Query: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSL 780
            I KQDSKTHETLNEY+SCKSKLS+ ET L NLK EQKL++             S EK SL
Sbjct: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780

Query: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840
            RIMVTQLQTLQKEREDLL+E RKSCQ KI+E+E+A +ELK ETS KD HI QLEEDN S 
Sbjct: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840

Query: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900
            IEWYQNKIE LKKD +SV+  V+ KQT+IEKLQYKVKSLEKEIEE+KIRLHTYNVMDETI
Sbjct: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900

Query: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960
            NDDSLRKELE SKINLT+AYSQI+EYK LYE+T+QSL++ NSKLDES + F+NQI++LTD
Sbjct: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960

Query: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020
            EK +LEDK+SLLKEQ FNLNNELDLQK  MEK+K +FKK I+ILQNNNKE+E VKSEYES
Sbjct: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020

Query: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080
            KLSKIQ+DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+GQVKTL LSR +
Sbjct: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080

Query: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140
            LEN LKENEKSW+SQK+SLLEQLDLSNSRIEDLSSQNKLLY+QI++YTAA   V ++ NG
Sbjct: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140

Query: 1141 PGLNN-ILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENH 1199
            P LNN IL+TLRRERDILDTKVTVAERDAKMLRQKI+LMDVELQDARTKL+NSRVE +  
Sbjct: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200

Query: 1200 SSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELT 1259
            SSI+QQHD IMEKLNQLNLLRESNIT               QSEL KLK+ +APIESEL+
Sbjct: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260

Query: 1260 ALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXX 1319
            ALKYSM             VHRWKKRSQDILEKH+QLSS+DY                  
Sbjct: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320

Query: 1320 RQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQ 1379
            +QG EAEE+FNRLRRQAQE+LKTSKL+Q++LTEQ+N L+DAK  LE SL++AN RI+EL+
Sbjct: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380

Query: 1380 NAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXX 1439
              KVA+ NN+ E I++ QEDAEK+SREL+ KLEE+  SY ST+                 
Sbjct: 1381 GEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQ 1440

Query: 1440 XXXXXXXXATSANEQNDLSNIVESMXXXXXXXXXXXXXXXTQEVNEKILEAQERLNQPSN 1499
                      + +   DLSNIVESM               T+EVN+KI EAQERLNQPS+
Sbjct: 1441 GQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSS 1500

Query: 1500 INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXX 1559
            +N++E+KK+WE+EHE+EV++++REAEEALKKRIRLPT                       
Sbjct: 1501 VNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKL 1560

Query: 1560 XXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDK 1619
                 S+  S +++ +L+KQLE +VQEKQKELE+EYN+KLQE+LK+V HSS IS +E+D+
Sbjct: 1561 EEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE 1620

Query: 1620 LRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESP 1679
            LRAEIE++LREE N+ELQ +KKKSF+EGKQQA MKTTLLERKLAKMESQLSE KQSAESP
Sbjct: 1621 LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP 1680

Query: 1680 PKSVNNVQNPLLGLPRKIEENSNSPFNPXXXXXXXXX-XXXXXXXXXFNPFTSPSPNKHL 1738
            PK  NNV NPLLGLPRKIEENSNSPFN                    FNPFTSPSP K L
Sbjct: 1681 PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSKSSSSGAFNPFTSPSPKKLL 1740

Query: 1739 QNDNDKRESLANKTDPPTHLEPSFNIPASRGLIXXXXXXXXXXNDEELTSNNPAQKDSSN 1798
            Q D+ ++E+  NKTDPPTHL PSFNIPA+R L           NDEELT N P QK SS 
Sbjct: 1741 QKDDVQKETSNNKTDPPTHLAPSFNIPATRVLTSSSSTLSTDTNDEELTVNEPGQKISSA 1800

Query: 1799 RNVQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDED-DTTENINES 1853
             N  S+  +E+ +E E  +     EE+TKSNKRPIDEV ELK+D+D D+ E  NES
Sbjct: 1801 INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNES 1856

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 2270 bits (5882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1219/1848 (65%), Positives = 1425/1848 (77%), Gaps = 11/1848 (0%)

Query: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60
            M DHD  ++S+QN +N+DERL AIASFFG S EQV+S + D++KHLNDKLLQFNELKSEN
Sbjct: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60

Query: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120
            L++TVSFDELK +S KKID LK EMEN+I++ND IRKER+DT  K ES +NEK K+S+EL
Sbjct: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120

Query: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180
            E +KR+ DDL EEKKE Q NQQRTLKILDERLKE+E+ R +NNRS++ECK+LRSTI+DLE
Sbjct: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180

Query: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240
            TKQQ  IT+DLNSR ELERK QEL +LQS NDWLEKEL SKNEQYLSYR+KTDK+IL+IR
Sbjct: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240

Query: 241  NELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQ 300
            NELN LR+DFQ+E+T NDVL QKN+            IK LSD L+SEKQEFS E++LKQ
Sbjct: 241  NELNHLRSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQ 300

Query: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKE 360
            RLVDLLESQLNAVKEEL+S R L T+    +DSKK   E               AQC+ E
Sbjct: 301  RLVDLLESQLNAVKEELDSTRGLETS----NDSKKHMSEKEDLVKELQLTKEELAQCKSE 356

Query: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420
            C+RLSSI  E DE++ + +++SSSDFI LKKQLIKE+R KEHLQNQIE+FI+ELEHKVPI
Sbjct: 357  CIRLSSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480
            INSFKERTD              HTSNEKNAK++EL+AK++KL +CEND+QTL KQRLDL
Sbjct: 417  INSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476

Query: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540
            CRQ+QYLLITNSVS DSKGPLRKEEI FIQNI+Q D  T TE+DSQK+VTERLVEF++II
Sbjct: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536

Query: 541  QLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRI 600
            +LQEKN ELLK+VRNLAD                   T+NEAKEAI+TLK+EK  LES++
Sbjct: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKV 596

Query: 601  XXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660
                         + NE+ S+ N TI+QL ETKR+LE Q+QDLQ+ ISQITRESTENMSL
Sbjct: 597  EELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656

Query: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720
            LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFD LQ+T
Sbjct: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716

Query: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSL 780
            ILKQDSKT ETLNEY+SCKSKL+I ETEL NLKEEQKL++             S EK  L
Sbjct: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776

Query: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840
            RIMVTQLQTLQKERE+LL+ETRKS Q KIDELE A +ELK E S KD  IKQLEEDNNS+
Sbjct: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836

Query: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900
            IEWYQNKIE LKKD ES+I S++ KQ +IEKLQ+KVKSLEKEI+E+KIRLHTYNV+D TI
Sbjct: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896

Query: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960
            NDDSLRKELEKSKI+LTDAYSQI+EYK+LYET ++SL+Q +SK +ES KDF+N+IKNLT+
Sbjct: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956

Query: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020
            EK+SLE+KISLLKEQ+FNLNNELDLQ KGM++EKA+F+K+ISILQNNNKEVEAVKSEYES
Sbjct: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016

Query: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+ QV TL LSR+Q
Sbjct: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076

Query: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140
            LE+ LKENE+SW+SQ+++L+EQL+ SNSRIEDL+SQNKLLYDQI++YT ADK V ++ + 
Sbjct: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136

Query: 1141 PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS 1200
            P LN+IL++LRRERDILDTKVTVAERDAKMLRQKISLMD+ELQ+ARTKLDNSR+E+E   
Sbjct: 1137 PALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRP 1196

Query: 1201 SIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTA 1260
            +IIQQH+DIMEKLNQLNLLRESNIT               QSELDKLKQ++APIESEL A
Sbjct: 1197 TIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAA 1256

Query: 1261 LKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXR 1320
            LKYSM             VHRWKKRSQDILEKH Q+SSSDY                  R
Sbjct: 1257 LKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTR 1316

Query: 1321 QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQN 1380
            QGAEAEE+FNRLRRQAQERLKTSKLS D+LTEQVN L++AK  LE SL +AN +IEEL+N
Sbjct: 1317 QGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELEN 1376

Query: 1381 AKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXXX 1440
            AK  Q NNQL+AI++LQ+DAE +S+E + KLEE  T Y+STI                  
Sbjct: 1377 AKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQR 1436

Query: 1441 XXXXXXXATSANEQNDLSNIVESMXXXXXXXXXXXXXXXTQEVNEKILEAQERLNQPSNI 1500
                   +  ANEQNDLS IVESM               T+EVNEKILEAQERLNQPSNI
Sbjct: 1437 RIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI 1496

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXX 1560
            N++E+K KW++EHE+EV  +IREAEEALKKRIRLPT                        
Sbjct: 1497 NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVE 1556

Query: 1561 XXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKL 1620
                 + QSG++DV  +KQ E ++QEKQKELE++YN+K    LK++ HS+ IS DERD+L
Sbjct: 1557 ERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEK----LKELSHSNSISIDERDQL 1612

Query: 1621 RAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPP 1680
            RAEIE+++R+E +NELQ IKKKSF+EGKQQAMMKTTLLERKLAKMESQLSETK+  ESP 
Sbjct: 1613 RAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPS 1672

Query: 1681 KSVNNVQNPLLGLPRKIEENSNSPFNP-XXXXXXXXXXXXXXXXXXFNPFTSPSPNKHLQ 1739
            K VN+ QN LLGLPRKIEENS+S FNP                   FNPFTSPSPNK  Q
Sbjct: 1673 KHVNHTQNQLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKSSQ 1732

Query: 1740 NDNDKRESLANKTDPPTHLEPSFNIPASRGLIXXXXXXXXXXNDEELTSNNPAQKDSSNR 1799
              +D+RE   NK DPPTHL PSFNIPA RGLI          NDEELT N   Q +SS+ 
Sbjct: 1733 KVDDQRELTTNKADPPTHLTPSFNIPAGRGLISSSSTLSTDTNDEELTGN--EQNNSSDG 1790

Query: 1800 NVQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDEDDTT 1847
            N Q E   EK +E E  ++ + +E +T S+KRPIDEV ELK+D+D+ +
Sbjct: 1791 NTQLEAGIEKAEEKEFAEKKKEVEGETTSHKRPIDEVRELKDDDDEVS 1838

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 2206 bits (5715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1863 (63%), Positives = 1430/1863 (76%), Gaps = 11/1863 (0%)

Query: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60
            MSD +  M S QN E++ ERLNAIASFF CSLEQVKS D D+V HLNDKLLQFNELKSEN
Sbjct: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60

Query: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120
            +++TV+ DELK +S KKI+ LKTEME+V+R+ND+IRKERNDT  KFESV+ EK  LS+EL
Sbjct: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120

Query: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180
            E +KRKL DL+EEKKE QS+QQRTLKILDERLKE+E+V+  +N S+SECKKLRSTI++LE
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240
            TKQQ YI+NDLNS+++LER+TQEL LLQSN DWLEKEL SKN+QYLSYRQKT+ +I +IR
Sbjct: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240

Query: 241  NELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQ 300
            N+LNR+RNDFQ+E+TNNDVL+QKNN            IK LSDS NSEK++FSAE++LKQ
Sbjct: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300

Query: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKE 360
            RL+DLLESQLNAVKEELN+ RE N + V +DDSK+   EN               QCE E
Sbjct: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360

Query: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420
            CLRLSSIT+EA +++  L++KS+ DFI LKKQLIKE+R KEHLQNQIE+FIVELEHKVPI
Sbjct: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480
            INSFKERTD              HTSNEKNAK+KEL  KN+KL E ++++  L+KQRLDL
Sbjct: 421  INSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480

Query: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540
            CRQIQYLL+TNSVSNDSKGPLRKEEI+FIQNI+Q DDS  TESDSQK+VTERLVEF++II
Sbjct: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540

Query: 541  QLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRI 600
            QLQEKN+ELL+V RNLAD                   T+NEAKEAI+TL+S+K+ LES+I
Sbjct: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600

Query: 601  XXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660
                           +++ S +N  I+QLTETKR+LESQ QDLQ RISQ+TRESTENMSL
Sbjct: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660

Query: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720
            LNKE+QDLYDSKS +SI+LG+EKSSRILAEERFKLLSNTLDL KAENDQLRKR   LQN 
Sbjct: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720

Query: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSL 780
            I KQDSKT ETLN+YVSCKSKLS +ETEL NLK E+ L++             S EK SL
Sbjct: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSL 780

Query: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840
             IMVTQLQTLQKERE+LL+ET+KSCQ KID L++A +ELK E  +KD +IKQLEEDN+S 
Sbjct: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840

Query: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900
            IEWYQNKIE L+KD+ESV++S++ KQ ++E+ QY++KSLEKEIEE+KIRLHTYNV+DE+I
Sbjct: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900

Query: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960
            NDDSLR+ELEKSKINLTDAYSQI+EYK LYETT +SLQ+ +S+LDES K F+NQI+NLTD
Sbjct: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960

Query: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020
            EKTSLEDK+SLL+EQM NLNNELDLQ + MEKEKA+FKK+ISILQNNNKE+EAVK+EYES
Sbjct: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYES 1020

Query: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQV+TLNL+R Q
Sbjct: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080

Query: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140
             E ALKENE +W+SQKESLLEQLDLSNSRIEDLSSQNKLLYDQI++YT    +  ++ +G
Sbjct: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140

Query: 1141 PGLNN-ILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENH 1199
              LNN ILITLRRERDILDTKV VAERDAKMLRQKISL+DVELQ+ARTKL NS+VE E  
Sbjct: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200

Query: 1200 SSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELT 1259
            S IIQQHD++MEKLNQLNLLRESN T               QSEL++L+ N+APIESEL 
Sbjct: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260

Query: 1260 ALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXX 1319
            ALK+S+             VHRWKKRSQDI+EKH+QLSS+DY                  
Sbjct: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320

Query: 1320 RQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQ 1379
            +QGA++EEKFNRLRRQAQE+LK SKLSQDS  EQ+N L+DAK  LE SL+ ANARI+EL+
Sbjct: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380

Query: 1380 NAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXX 1439
            +AKVA+  NQL  I+KLQED E+ S+EL+ KLEE+  SY+ST+                 
Sbjct: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQ 1440

Query: 1440 XXXXXXXXATSANEQNDLSNIVESMXXXXXXXXXXXXXXXTQEVNEKILEAQERLN---- 1495
                    A +  EQ+DLS +VESM               T+EVN+KI E QE       
Sbjct: 1441 RQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEET 1500

Query: 1496 --QPSNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXX 1553
              +PSNIN++EIKK+WE+EH +EVS+KIREAEEALKKRIRLPT                 
Sbjct: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEK 1560

Query: 1554 XXXXXXXXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHIS 1613
                       S+ QSG+++ + +KQLE+++QEKQKELENEYNKKLQE+L+++P S  IS
Sbjct: 1561 EFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIIS 1620

Query: 1614 DDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETK 1673
             D++DKLRA+IE++LREEFN+ELQ IKKKSF+EGKQQAMMKTTLLERKLAKMESQLSETK
Sbjct: 1621 SDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680

Query: 1674 QSAESPPKSVNNVQNPLLGLPRKIEENSNSPFNP-XXXXXXXXXXXXXXXXXXFNPFTSP 1732
            QS +SPPK ++ + NPLLGLPRKIEENSN P+NP                   FNPFTSP
Sbjct: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSP 1740

Query: 1733 SPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASRGLIXXXXXXXXXXNDEELTSNNPA 1792
            SPNK LQ D  +RE  +N+T+PPTHL PSFNIPA++GL           NDEE T N   
Sbjct: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGLNSSSSTLSTDTNDEERTVNEQE 1800

Query: 1793 QKDSSNRNVQSEEDTEKKKEGEP-VKRGEAIEEQTKSNKRPIDEVGELKNDEDDT-TENI 1850
            + ++ +  +   +D + ++EGE  ++   A ++++KSNKRPIDEVGELK+D+D+  T++ 
Sbjct: 1801 ENNAFD-GIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDST 1859

Query: 1851 NES 1853
            NE+
Sbjct: 1860 NEA 1862

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1811 (35%), Positives = 1005/1811 (55%), Gaps = 124/1811 (6%)

Query: 1    MSDHDTPMESI-QNGEN-SDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKS 58
            MS+ +T + +I  +G+N +D  L  +++F+G   +Q+   DG ++  L +K+L FNELKS
Sbjct: 1    MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKS 60

Query: 59   ENLKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSS 118
            +NL++ V+ DE+K  S K+ +GLK E+EN++++ND IR ER+    +      +K K+ +
Sbjct: 61   QNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQN 120

Query: 119  ELEFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMD 178
            E+E ++ KL DL +E++  + +++  + +L+E++KE+E  R E+ +S  + K+LR  +++
Sbjct: 121  EVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLE 180

Query: 179  LETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILD 238
            LET  Q   + +L  ++E++  TQ LT+LQ N+ WLE+E+ SK EQ +S R+K D  +  
Sbjct: 181  LETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDR 240

Query: 239  IRNELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSL 298
            + +E    +N+ Q+E++ N V+  KN             +K LSDSL  EKQEF+ EMS+
Sbjct: 241  LTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSM 300

Query: 299  KQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCE 358
            KQ+L+DLLE+Q+ +++ ELN+  + +  +++A  S ++  EN               + E
Sbjct: 301  KQKLIDLLENQVKSLQGELNASLDKDNVELLA--SGERNTENEKLIQELITLKENFEESE 358

Query: 359  KECLRLSSIT------DEADEDNENLSA------KSSS--DFIFLKKQLIKERRTKEHLQ 404
            +E LRL ++       D++ +D  N S+      K SS  D   LKK+LIKER  KE LQ
Sbjct: 359  RERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQ 418

Query: 405  NQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLV 464
             Q+E+FIVELE+K+P+INSFKERT M             HTSNEK  + +E  A ++K+ 
Sbjct: 419  RQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVK 478

Query: 465  ECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESD 524
            + E+ + TLT+QR DL  Q+Q+LL+  SV  DS G L  EE+ FI+ I+  DD   +ESD
Sbjct: 479  DSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPN-SESD 537

Query: 525  SQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKE 584
            SQ+V++ERLVEF NI  LQEKN ELLK VR LA+                   T+ EAKE
Sbjct: 538  SQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKE 597

Query: 585  AIITLKSEKMDLESRIXXXXXXXXXXXTSVPNEDASYSNVTIKQ-LTETKRDLES---QV 640
            AI++L+    +LES++            ++ + + S  N ++    T+  R+  S   ++
Sbjct: 598  AIVSLQDYNANLESKVEILTKECDAFK-AICSRNGSDQNGSLSANGTQGNRNGSSDEEKL 656

Query: 641  QDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTL 700
            + L+ R++ +T ES++N  +LN EI +LY SK+ ISI+L KE+SS+ L EER KL+ +TL
Sbjct: 657  RTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTL 716

Query: 701  DLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRV 760
            +LT+ EN QL KR   LQ+   +QDS+T ET+NE ++C SKL+++ET++ NL+ E++L  
Sbjct: 717  ELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQ 776

Query: 761  HXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELK 820
                         S E++SLRIMV+QLQTLQ ERE  L+E + + ++ +D LE   ++ +
Sbjct: 777  SSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADAR 836

Query: 821  KETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLE 880
                 K    + +E    + I+WYQ+K++++  + + +   + +K   +  L+ +V+ LE
Sbjct: 837  ARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLE 896

Query: 881  KEIEEDKIRLHTYNVMD----ETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQS 936
            K++EE + R+ +Y V+     ET  + SLRKELEK+KINL+D Y++I +YK+L  TT +S
Sbjct: 897  KQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEES 956

Query: 937  LQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKAD 996
            L Q         ++   Q++ L +EK+ L+D ++ L E +  L   L    K  E EK  
Sbjct: 957  LSQLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNT 1016

Query: 997  FKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKT 1056
             +K+I+ L+  +K    +K EY++++ K+Q DL+QQ  +AN AQ NYE+ELQK ++VSKT
Sbjct: 1017 LQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKT 1076

Query: 1057 ISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQ 1116
            ISELREQ    +  +  L  S +Q+   L++NEKSWS+QKE    QL+ S   +EDLS+Q
Sbjct: 1077 ISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQ 1136

Query: 1117 NKLLYDQIQIYTAADKEVNNSTNG--PGLNNILITLRRERDILDTKVTVAERDAKMLRQK 1174
            N LLYDQI++++   K+ ++  NG    +  IL  LRRERDIL TK+TV++R+ + LR  
Sbjct: 1137 NSLLYDQIELFS---KDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGS 1193

Query: 1175 ISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXX 1234
            ++ ++ EL   + +L   + E   HS +I QH+ I+E+LNQLNLLRESNIT         
Sbjct: 1194 LASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEEN 1253

Query: 1235 XXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHE 1294
                  Q EL++L++ + P+ESEL  L  S+              +RWK+RSQ+IL KH+
Sbjct: 1254 KKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHD 1313

Query: 1295 QLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQV 1354
            ++   D+                  ++  E +++FNRL++QA E+L +SK++Q +L+ Q+
Sbjct: 1314 RIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQL 1373

Query: 1355 NSLRDAKNVLENSLSEANARIEELQNAKVAQGNN--QLEAIRKLQEDAEKASRELQAKL- 1411
            N LR+AK+ LE        ++ ELQ    A GN+   +E+++K   DA + SREL+  L 
Sbjct: 1374 NELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLS 1433

Query: 1412 ------EESTTSYESTINGXXXXXXXXXXXXXXXXXXXXXXXATSANE-QNDLSNIVESM 1464
                  EE T      I+                        AT+  E   DLSN+VESM
Sbjct: 1434 ATLQQNEEITKKLNDEIDS----------LKLELHSLKEQSAATAKGEISEDLSNVVESM 1483

Query: 1465 XXX------------XXXXXXXXXXXXTQEVNEKILEAQERLNQPSNINMEEIKKKWESE 1512
                                       T +VN       E   QP  +N EEIK++WESE
Sbjct: 1484 RRSFEEEKINFLKEKTEELKKLEEEKHTLQVN-----GNEPQQQP--VNYEEIKRQWESE 1536

Query: 1513 HEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEI 1572
             E+ + ++I EAEE LKKRIRLPT                            S+E S   
Sbjct: 1537 QEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGN 1596

Query: 1573 DVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEF 1632
            +  L+KQLE  +QE                                K  AE+++      
Sbjct: 1597 NSDLKKQLEKDLQE--------------------------------KFEAEVQA------ 1618

Query: 1633 NNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPPKSVNNVQN-PLL 1691
                  +KKK+F+EGKQQA MK+TLLERK++K+ESQL       +SP KS +   + P  
Sbjct: 1619 ------VKKKAFEEGKQQAAMKSTLLERKISKLESQL---HGKVDSPDKSSSETSSVPKP 1669

Query: 1692 GLPRKIEENS----NSPFNPXXXXXXXXXXXXXXXXXXFNPFTSPSPNKHLQNDNDKRES 1747
             LP KI+E S     S  NP                  F+ F+  +P      +ND   +
Sbjct: 1670 NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGT 1729

Query: 1748 LANKTDPPTHL 1758
             A    P   L
Sbjct: 1730 SAFGFKPTFTL 1740

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1867 (34%), Positives = 1008/1867 (53%), Gaps = 121/1867 (6%)

Query: 9    ESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVV--KHLNDKLLQFNELKSENLKVTVS 66
            E++     +DE    IA F G S +++K    D V    L +KL +FN L+S NL++  +
Sbjct: 5    ETLVGSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHAT 64

Query: 67   FDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRK 126
             DELKA    K+D LK E E +IREND  ++ RN    +   +  EK     ++E VK +
Sbjct: 65   VDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFE 124

Query: 127  LDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGY 186
            L +  E+K   +SN+Q  +K+L+E++ E+E  +VE+    ++ K LR  +M+ + + Q  
Sbjct: 125  LQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTL 184

Query: 187  ITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRL 246
              N L  ++ELE   Q++ +L  +N+WLEKE+ SK EQ + YRQ+ D  +     E+ RL
Sbjct: 185  KCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARL 244

Query: 247  RNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLL 306
            +ND+Q+E+++ + L +KN             IK LSD LN+EKQEFS EMSLKQ+L+DL 
Sbjct: 245  KNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQ 304

Query: 307  ESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSS 366
            + QL + KEEL    E + +   AD+   Q+ +                +   E LRL +
Sbjct: 305  DEQLQSFKEELRLTEEKHNS-TEADNL--QSTQQARFMDDLAQVRQQLEESNHERLRLQA 361

Query: 367  ITDEADEDNENLSAKSSS---------DFIFLKKQLIKERRTKEHLQNQIETFIVELEHK 417
            + +E   D+E     S++         D   LKKQLIKER  KE+LQ QIE+F+VELE+K
Sbjct: 362  VVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYK 421

Query: 418  VPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQR 477
            VP+INS KER+               HTS+EK  K +EL +   K+ + E +  TL +QR
Sbjct: 422  VPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQR 481

Query: 478  LDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFK 537
             DL RQ+Q+LL   ++ NDS+GPL  +E+ FI+ I+ E+++   ESDSQ ++TERLVEFK
Sbjct: 482  SDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKII-ENENPSNESDSQSIITERLVEFK 540

Query: 538  NIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLE 597
            +I  LQE+N ELLK  R LAD                   T++EAKEAIITL+    ++E
Sbjct: 541  DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE 600

Query: 598  SRIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTEN 657
            S++             +     S+ N+      +  ++ +  ++ L+ ++S +T E+++N
Sbjct: 601  SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN 660

Query: 658  MSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYL 717
              LLN+EI++LY SK+ ++I   KE+SSR LAE+R KLL +TL++TK EN +L +R   L
Sbjct: 661  NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHEL 720

Query: 718  QNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEK 777
            Q+ + KQ+++  ET+N+Y+SC+SKLS++E    NL  E+ L               S E+
Sbjct: 721  QSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVER 780

Query: 778  DSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDN 837
            +SL +MVTQLQTLQ ERE+LL+E++ S +  I +LE   SELK E S KD+ IK  E+  
Sbjct: 781  NSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAK 840

Query: 838  NSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMD 897
             +  +W+Q KI+ +  D   +   + +K   + +L+ +V  L+K+IEE   R+ +Y  ++
Sbjct: 841  RAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN 900

Query: 898  ETINDDS----LRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTN 953
            +  N ++    LRK+LEK+ I L  AYSQ +E+K +  T  ++L+  +++ +E  +   +
Sbjct: 901  DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS 960

Query: 954  QIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEA 1013
              +    EK  LE  +S LK+ +  LNNE  LQK   E+EK +  K++  L+++   +  
Sbjct: 961  NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ 1020

Query: 1014 VKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKT 1073
            VK EY+ KL ++Q DL+QQT YAN AQ NYE+ELQKHA+VSK IS+LR ++ + + +++ 
Sbjct: 1021 VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ 1080

Query: 1074 LNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKE 1133
            L  S  Q +  L+  EKSW +QK  L   +D    +++++SSQNKLL+ Q+++ + +++E
Sbjct: 1081 LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE 1140

Query: 1134 VNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSR 1193
              N    PG + +LI+LRRERDIL+TK+TV++R+ K+L QK   ++ EL +AR KL   +
Sbjct: 1141 FENKL-LPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQ 1199

Query: 1194 VEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAP 1253
                NHS I +QH+DIME+LNQ+NLLRESN+T               QSEL+ L+  + P
Sbjct: 1200 ENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILP 1259

Query: 1254 IESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXX 1313
            + SEL+  + S+               RWK+RS DIL +HE++   +Y            
Sbjct: 1260 LNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKK 1319

Query: 1314 XXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANA 1373
                  ++  +  ++F RL++QA E+L  SK++Q +L+ +VN L+  K  +E  L E   
Sbjct: 1320 ELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQT 1379

Query: 1374 RI---EELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGXXXXXX 1430
            ++   E+L   + ++  N  E +R   +DA +  +E++ KL E+  S E   +       
Sbjct: 1380 KVLNLEKLLTERDSESANN-EDLRHELDDALERCKEIEVKLGETVGSSEGLTS--QLNEE 1436

Query: 1431 XXXXXXXXXXXXXXXXXATSANEQNDLSNIVESMXXXXXXXXXXXXXXXTQEVNEKILEA 1490
                             +T    Q  LSN+VESM               T+E N+K  E 
Sbjct: 1437 INSLKEQVRIFKEKENDSTLEGSQG-LSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEE 1495

Query: 1491 QERLN-------QP-SNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXX 1542
            + +L+       +P S  ++  +KK+WE E+E    Q+I+EAEE LKKRIR+PT      
Sbjct: 1496 KAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEER--- 1552

Query: 1543 XXXXXXXXXXXXXXXXXXXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQE- 1601
                                         I  VL K        ++ ELE E+ ++L+E 
Sbjct: 1553 -----------------------------IKKVLDK--------RKTELEEEFQRRLKEN 1575

Query: 1602 ELKDVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERK 1661
             L+  P        ER++L+ ++ES    ++   L + KKK+F+EGKQQA MK+TLLERK
Sbjct: 1576 NLQ--PEGGDAK--EREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERK 1631

Query: 1662 LAKMESQLSETKQSAESPPKSVNNVQNPLLGLPRKIEEN------SNSP-FNPXXXXXXX 1714
            ++K+ESQL+ +     +P K+        +GLP KI+E+      + +P F         
Sbjct: 1632 ISKLESQLNSSNNP--TPEKAAATS----VGLPTKIDESRTENMATGTPAFGEKVLKLSD 1685

Query: 1715 XXXXXXXXXXXFNPFTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASRGLIXXX 1774
                        NPFTS  P     N+N           P     P  + P SR      
Sbjct: 1686 KPAFSFQPSSKSNPFTSALPG----NNN------VFGMKPTFSFTPGSSQPESRPTFGST 1735

Query: 1775 XXXXXXXNDEELTSNNPAQKDSSNRNVQSEEDTEKKKEGEPVKR--GEAIEEQ----TKS 1828
                          N  A+ +S+  + QSEE   +K+E   V+   G+  EE     T +
Sbjct: 1736 GF------------NTTAEPESNRSSSQSEESIPEKQESASVQGQNGKVAEEAGSNVTTT 1783

Query: 1829 NKRPIDE 1835
             KRP D+
Sbjct: 1784 QKRPADD 1790

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/1799 (35%), Positives = 993/1799 (55%), Gaps = 113/1799 (6%)

Query: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60
            M++ ++P      GE     +  I+SF      +V + D  VV+ L+ K  QF +LK++N
Sbjct: 1    MAEQNSPTTPSVIGEID---VTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQN 57

Query: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFV--KFESVENEKMKLSS 118
            LK +V+ DELK+SS ++ +  K ++E +    + +RKE+ D F   KF+ + +EK   S 
Sbjct: 58   LKYSVTLDELKSSSERRSEAFKLQLEKINENTESLRKEK-DAFEDEKFKLI-DEKANASK 115

Query: 119  ELEFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMD 178
            E+  +K +L +L ++ +  +S++Q  +++L+E++ ++E  + E  +     K LR  +++
Sbjct: 116  EVNLLKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLE 175

Query: 179  LETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILD 238
            LE + Q + +NDL  + E++R TQE+ LL+SNN WLEKEL SK+E++ SYRQ+ +  +  
Sbjct: 176  LENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQT 235

Query: 239  IRNELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSL 298
              +ELN +R++ ++ER+++  LK + N            +K L DS + EKQEF+ EM+L
Sbjct: 236  ALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTL 295

Query: 299  KQRLVDLLESQLNAVKEELNSIRE---LNTAKVIADDSK--KQTPENXXXXXXXXXXXXX 353
            KQRL+DLLE Q+ + K EL S R     N+  V A+  K  ++  E              
Sbjct: 296  KQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVK 355

Query: 354  XAQCEKECL-----RLSSITDEADEDNEN-LSAKSSSDFIFLKKQLIKERRTKEHLQNQI 407
              +   E L     R +  T +   D++N +  K   D   LKK+LI+ERR KE LQ Q+
Sbjct: 356  LEETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQV 415

Query: 408  ETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECE 467
            E F++ELEHKVP++NSFKERT+M              TS +K  K  EL +   K+ + E
Sbjct: 416  EAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYE 475

Query: 468  NDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQK 527
              + +L +QR DL  Q+Q+LLI  SV NDS GPL  EE  FI+ I+   +S + E D+Q+
Sbjct: 476  TQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPV-EQDAQR 534

Query: 528  VVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAII 587
            +++ERLV F+++++LQEKN ELL  +RNLAD                   TV EAKEAI+
Sbjct: 535  IISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAIL 594

Query: 588  TLKSEKMDLESRIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDL---ESQVQDLQ 644
            TL+     LES++             +   D   SN      +   R L   E ++++L+
Sbjct: 595  TLQEYNKSLESQLEIIAKERDAFK--ILASDKGTSNGPSNVNSSENRHLVLAEEKIKELE 652

Query: 645  TRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTK 704
              +S +T ES +N+ LLN+EI  LY +++D S+ L KE+SSRILAE+R KL+SNTL++TK
Sbjct: 653  NHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTK 712

Query: 705  AENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXX 764
             END+LRKRF  LQ  ILKQDSKT +T+   +SCKS+LS ++++L N + E+ L      
Sbjct: 713  MENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQE 772

Query: 765  XXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETS 824
                     S E++++RI++TQLQTLQ ERE LLEET+K+ Q K ++LE  LS+  ++  
Sbjct: 773  NLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLD 832

Query: 825  QKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIE 884
             K   I       +S  +WYQ K + L ++  +    + SK TDI+ L+ KV+SL  ++E
Sbjct: 833  AKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLE 892

Query: 885  EDKIRLHTYNVMD--ETIND--DSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQT 940
            E + R+  +N ++  E++    ++LR+ELEK++I L DAYSQ+++YK + +++ +S    
Sbjct: 893  ESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAI 952

Query: 941  NSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKR 1000
               L++S  ++T +I+ LT E+   +D++ +LK+Q+ NLNNEL+ QK   E + +D+ + 
Sbjct: 953  KDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRN 1012

Query: 1001 ISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISEL 1060
            +  L+    E++ +K+EYE K+SKIQ DL+QQT YANTAQ NYEQELQKHADVSK IS L
Sbjct: 1013 LEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLL 1072

Query: 1061 REQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLL 1120
            R +   YK + +TL  + +  + AL+++E SW  Q     ++L L++ RIEDL++Q+K+L
Sbjct: 1073 RAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKIL 1132

Query: 1121 YDQIQIYTAADKEVNNSTNGP---GLNNILITLRRERDILDTKVTVAERDAKMLRQKISL 1177
            YDQI  + +  K  ++    P      N+L +LRRE+DIL+TK+ V+ R+ K+LRQK+ L
Sbjct: 1133 YDQID-FLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKL 1191

Query: 1178 MDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXX 1237
            ++ +L+ +R +L   +     +S+ ++  ++IM +LNQLNLLRESNIT            
Sbjct: 1192 IESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERS 1251

Query: 1238 XXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLS 1297
               ++ELD L   V P+ES++T L+ S+               RWK+RSQDIL K+E++ 
Sbjct: 1252 RELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERID 1311

Query: 1298 SSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSL 1357
              ++                   +  E + +F RL++QA E+L  +K +Q +LT Q+N L
Sbjct: 1312 PEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDL 1371

Query: 1358 RDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASREL---QAKLEES 1414
            +  K  LEN L      ++ L++       N+      LQE  E +  +L   + KLE+ 
Sbjct: 1372 KATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQV 1431

Query: 1415 TTS---YESTINGXXXXXXXXXXXXXXXXXXXXXXXATSANEQNDL----SNIVESMXXX 1467
            T+S    E  +N                            ++ ++L    S IVE++   
Sbjct: 1432 TSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIE 1491

Query: 1468 XXXXXXXXXXXXTQEVNEK-------ILEAQE----------RLNQPSNINMEEIKKKWE 1510
                          E+ E+       ILEA+E          +L+ P  +N++EIKKKWE
Sbjct: 1492 FEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPP--VNIDEIKKKWE 1549

Query: 1511 SEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSG 1570
             E+EQ+ SQ+IRE+ E LKKRIRLPT                                  
Sbjct: 1550 EEYEQKTSQRIRESNEQLKKRIRLPTEEKINK---------------------------- 1581

Query: 1571 EIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIES---R 1627
               +V +K+LE +      E E    KK +E  K    S+  S +  +K + ++E+    
Sbjct: 1582 ---IVEKKRLELEA-----EFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQE 1633

Query: 1628 LREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQL-----------SETKQSA 1676
            ++++F+ ++  IKK++F+EGKQQA MK+T LE+K+AK+E+Q+           + +   A
Sbjct: 1634 MQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPA 1693

Query: 1677 ESPPKSVNNVQ-NPLLGLPRKIEENSNSPFNPXXXXXXXXXXXXXXXXXXFNPFTSPSP 1734
            ES P + +  Q  P+L     I      PFNP                   NPF S  P
Sbjct: 1694 ESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSFQ-NPFNSQPP 1751

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1776 (32%), Positives = 954/1776 (53%), Gaps = 184/1776 (10%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83
            +A+F      +V+  D  +V     K  +F+++K++N+++++S D LK +  +KI+  K 
Sbjct: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77

Query: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143
            ++E ++ +    ++E+  T  +   + NEK +LS E+  ++ ++++  +  +   S +Q 
Sbjct: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137

Query: 144  TLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQE 203
              K+L+E++ ++   + E++R  +  K+LR + +DLE   QGY + +L  ++E++R  QE
Sbjct: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197

Query: 204  LTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQK 263
            L L++SN DWL KEL SKNEQ  S+R+KT+  + +   ++N L++  +  R NN  LK K
Sbjct: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257

Query: 264  NNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIREL 323
                           K L+D LN+EK+EF+ EMSLKQRL+DLLESQ++++K +L +    
Sbjct: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLEN---- 313

Query: 324  NTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRL------------------- 364
              A   A+ +   TPE                  + E ++L                   
Sbjct: 314  --AYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371

Query: 365  -SSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINS 423
             S+++D + +   +   K   D   LKKQL++ERR KE LQNQ+E+F+VELEHK+PI+NS
Sbjct: 372  NSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNS 431

Query: 424  FKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQ 483
            FKERTDM              T+ +++ K  ELN    K+   E+ + +L  QR DL  Q
Sbjct: 432  FKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQ 491

Query: 484  IQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQ 543
            +QYLL+  SV +D+ GPL ++E++F++ I+  +D    +SD+Q +++ERLV+FK++I+LQ
Sbjct: 492  VQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA-PKSDTQGIISERLVQFKSVIELQ 550

Query: 544  EKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLES--RIX 601
             KNAELL  +R LAD                   TV EAKEAI++L+     LE   +I 
Sbjct: 551  SKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIV 610

Query: 602  XXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLL 661
                       S   +  S  + T +      + L+  + +L+ R+  +  +S +N+ LL
Sbjct: 611  SKERDAFKLANSANKQGDSAPSSTYQ-----SKKLDEHIMELEKRLKNLAEQSQDNIKLL 665

Query: 662  NKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTI 721
            N EI+ LY +KS++++ L +E+SS++LAEER KL+ +TL LTK EN +L KR D LQ  +
Sbjct: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725

Query: 722  LKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLR 781
            LKQD KT  T++E ++ KS+LS + ++L  L  E+                 + E  + +
Sbjct: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785

Query: 782  IMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNI 841
            I+V+QLQTLQ+ER+ LLEE + + +K I++LE  L E ++   ++    ++    + S  
Sbjct: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845

Query: 842  EWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVM----D 897
            +W+Q K+++L +  ++   ++  K   IE LQ   KSL  ++EE ++R  +Y+V+    D
Sbjct: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905

Query: 898  ETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKN 957
             T   ++LRK LEK+ INL DAYSQI++YK + + + QS  + +  L+ES  ++   I  
Sbjct: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIAL 965

Query: 958  LTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSE 1017
            L  E+ SL D+I+LL +Q+ +LN+ELD QK   + EK++  K++SILQ + + ++ +KSE
Sbjct: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025

Query: 1018 YESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLS 1077
            YE K+SK+Q DL QQ  YAN AQ NYEQELQKHADV+KTIS LRE+   YK +++    S
Sbjct: 1026 YEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085

Query: 1078 RDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIY---TAADKEV 1134
              + ++AL+ NE+SW  Q   L  QL L+  R E+L++QN+LLYDQ+++    T++D E 
Sbjct: 1086 ASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEA 1145

Query: 1135 NNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRV 1194
              S +      +++TLRRERDIL+TK+ V+ R+ K+LRQ++ L   EL++ R  L+ S+ 
Sbjct: 1146 AASMSAES-RELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVR--LEFSKT 1202

Query: 1195 EKENHSSII--QQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVA 1252
            +     SI   +  + IMEKLNQLNLLRESN+T               Q+E+ KL++ + 
Sbjct: 1203 QATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQ 1262

Query: 1253 PIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXX 1312
            P+ES+L +L  ++               RWK+RSQDIL K+E++   ++           
Sbjct: 1263 PLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELK 1322

Query: 1313 XXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLS--- 1369
                    +  E++E+F +LR+QA ERL   K ++  +  +  ++  AK  LE  L+   
Sbjct: 1323 NELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTL 1382

Query: 1370 -------------------EANARIEELQ--NAKVAQGNNQLEAIRKLQEDAEKASRELQ 1408
                               EA++  EEL+   A   + N   EA+  ++ +A  + ++L+
Sbjct: 1383 DKVSELESKLSSSANEKNGEADSLKEELEELRANFIEAN---EAVADIKAEAASSEKDLK 1439

Query: 1409 AKLEEST---TSYESTINGXXXXXXXXXXXXXXXXXXXXXXXATSANEQNDLSNIVESMX 1465
             +++E T    + ES I                         A ++N+  D + IVE+M 
Sbjct: 1440 NQIQELTEKIKTLESEI-------------------EHSELEAKNSNDSPDFAPIVENMK 1480

Query: 1466 XXXXXXXXXXXXXXTQEVNEKILEAQERL--------------------NQPSNINMEEI 1505
                           +E+  K+ E Q++                     N P  I+ E +
Sbjct: 1481 KKFEEEKQVLIQEKDEELRMKLEEIQKQYEEERERELSELKASLVESTPNAPL-IDEETL 1539

Query: 1506 KKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXS 1565
            K K E+E+E++  ++IREAEEALKKRIRLP                             S
Sbjct: 1540 KSKLEAEYEKKTLERIREAEEALKKRIRLP-----------------------------S 1570

Query: 1566 MEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQ----EELKDVPHSSHISD------- 1614
             E+  ++           ++ +Q+ L+ E+  +++    E  K+ P  S + D       
Sbjct: 1571 EERINQV-----------IERRQRALDQEFELRVRARALELFKENPE-SFVGDTAKLIKE 1618

Query: 1615 --DERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSET 1672
              +E DKL A        +F+ +L  ++KK+F+EGKQQ +MK  LLE K+AK+E Q ++ 
Sbjct: 1619 HQEEMDKLEA--------KFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKI 1670

Query: 1673 KQSAESP---PKSVNNVQNPLLGLPRKIEENSNSPF 1705
              +   P   P   NN  +P    P  I+    SPF
Sbjct: 1671 NLNNSVPSKIPIDNNNNSSPQGAQPIAIKP---SPF 1703

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/1785 (32%), Positives = 945/1785 (52%), Gaps = 119/1785 (6%)

Query: 19   ERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKI 78
            E L  I SF    +EQ+ + +  ++ +L  K+ QF EL+S++LK  VS +EL+ +S  +I
Sbjct: 11   EELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRI 70

Query: 79   DGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQ 138
            + L+T++E++I +N    +E+     +    + E  +LSS  + ++ +L ++ E+    Q
Sbjct: 71   NDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQ 130

Query: 139  SNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELE 198
               Q T+K+LD ++ + E+ +    +  ++ ++  +   DLE + Q    ND  + T + 
Sbjct: 131  KQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMN 190

Query: 199  RKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNND 258
            + +Q+L  +    + LE EL +K+++   Y       I  +R +++ L N+  + ++ ND
Sbjct: 191  KLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSEND 250

Query: 259  VLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELN 318
             LK++N             ++ L++  N+EK+E   E+SLKQ ++D+L++Q+  ++++  
Sbjct: 251  ALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYT 310

Query: 319  SIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSSITDEADEDNENL 378
             I  LNT + I  + +++   N               Q  KE     +IT + +  +  L
Sbjct: 311  RI--LNTKQPIVQNDEER---NLEVEELKQKLIETETQLNKELEERRNITMQTE--SSTL 363

Query: 379  SAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXX 438
            S +   D   +KK+LI+ER  KE LQNQ+E FIVELE KVP INSFK+RTDM        
Sbjct: 364  SNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDA 423

Query: 439  XXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSK 498
                 +   EKN    EL+A  Q     + + ++LTKQR DL  Q+QY+LI  SV NDS 
Sbjct: 424  TLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSN 483

Query: 499  GPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLAD 558
            GPL  EE++FIQ+I+ +++S    SDSQ+V++ERLV F+NI++LQ+KN +LLK VR LA 
Sbjct: 484  GPLSAEEVRFIQDIL-DNESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELAR 542

Query: 559  XXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPNED 618
                                ++EAKEAII+L+S    LE +I            S+P  D
Sbjct: 543  KLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYK-SLPKPD 601

Query: 619  ASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIK 678
                   ++ L E   DL   +++L+TR++    ES +  + LN EI D+  + S    +
Sbjct: 602  TKVETEHLR-LNEENTDL---IKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKE 657

Query: 679  LGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSC 738
               E++SR LAE+R KL+ N+L L+K EN+QL+KR + LQ+  LKQD +T ETL EYVSC
Sbjct: 658  CQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSC 717

Query: 739  KSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLL 798
            K  LS  + EL  ++ +  +               S E++ L+ +V+QLQ+LQ ERE + 
Sbjct: 718  KVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIF 777

Query: 799  EETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESV 858
              T+   Q ++D +E  L ++ ++   KD  IK+LE +  S IEWYQNKI+A+K+  ++ 
Sbjct: 778  NSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAY 837

Query: 859  ITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIND----DSLRKELEKSKI 914
               +  K  +I +L Y++K L+K+++  + R+  Y V++ + N     ++L+ ELEKSKI
Sbjct: 838  QDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKI 897

Query: 915  NLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKE 974
            NL++AY+++ +YK       + L+   + ++E+ K+F  +I+ L  ++  L D  S+L E
Sbjct: 898  NLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSE 957

Query: 975  QMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTI 1034
            Q+ +LNNELD Q K   +EK++  K+++ L   N  +E V ++YE KLS +QNDL+QQ  
Sbjct: 958  QITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQAS 1017

Query: 1035 YANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSS 1094
            YAN AQNNYEQELQKHA+++KTIS+LRE  HTY+ ++ ++  +    E  L++NEK W  
Sbjct: 1018 YANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEE 1077

Query: 1095 QKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRER 1154
            Q++S  +Q+     RIEDLSSQNKLL+DQ+ + + ++   N  ++     +++++LR +R
Sbjct: 1078 QRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDR 1137

Query: 1155 DILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLN 1214
            DIL T+++V E + K LR K+S ++ EL + R KL   R + EN    +++HD+IM +LN
Sbjct: 1138 DILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLN 1197

Query: 1215 QLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXX 1274
            QLNLLRESNIT               Q +L+ L++ V P+E+E   LK  +         
Sbjct: 1198 QLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNA 1257

Query: 1275 XXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRR 1334
                 +RWK+RSQDIL KH+++   ++                  ++  E  ++FNR+++
Sbjct: 1258 YKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKK 1317

Query: 1335 QAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLE--- 1391
            QA ERL +SK +Q +L +Q+  L D    +++ L      I+  +  K  Q N Q E   
Sbjct: 1318 QAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTE-EKFRQMNKQSEDVT 1376

Query: 1392 AIRKLQEDAEKASRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXXXXXXXXXXATSA 1451
            A+R   E+A  +S+E + K   S  S +  I+                        AT  
Sbjct: 1377 ALRSQLEEALLSSKEFENKFNASVKSSDE-ISSHLNDVIDSLNNELTHLKESKNNEATVT 1435

Query: 1452 NEQNDLSNIVESMXXXXXXXXXXXXXXXTQEVNEKI------LEAQERLNQPSNIN-MEE 1504
              Q DLSN+VE M               T E  EK+      +EAQ    Q  N+  +++
Sbjct: 1436 G-QPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQD 1494

Query: 1505 I---KKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXX 1561
            I   +++WE E+E+ V ++I +AEE LK+RIRLPT                         
Sbjct: 1495 ISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTE------------------------ 1530

Query: 1562 XXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHS----SHISDDER 1617
                            +++ + +Q+K+ ELE EY++K+ +  K++  S    + I D   
Sbjct: 1531 ----------------EKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIED--- 1571

Query: 1618 DKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAE 1677
              L+ +I+  L    + EL+  K K+F+EGKQQAMMKTT LE+K++K+ESQL  +  + E
Sbjct: 1572 --LKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANE 1629

Query: 1678 S---------PPKSVNNVQNPLLGLPRKIEENSNSPFNPXXXXXXXXXXXXXXXXXXFNP 1728
            +          P   NNV       P K EE  + P                      NP
Sbjct: 1630 NKNDVEVLLKTPSDENNV-------PSKQEETLSKP--------------QLSKIQIANP 1668

Query: 1729 FTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSF-------NIPA 1766
              S        N +    SL N +D        F       NIPA
Sbjct: 1669 LLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPA 1713

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1724 (32%), Positives = 929/1724 (53%), Gaps = 138/1724 (8%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83
            IA+F       V+S   ++   +  K  +F +L+S+NL+  V  +E KA+   K + LK 
Sbjct: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68

Query: 84   EMENVIRENDKIRKER---NDTFVKFESVENEKM----KLSSELEFVKRKLDDLTEEKKE 136
            E++ V+ +N K+R E    ++     E+ +N K+    +L +  E ++  +D   E  KE
Sbjct: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128

Query: 137  TQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTE 196
               +        DE++ E+E +R E     ++ K L   I++LE K Q Y +++LN ++E
Sbjct: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181

Query: 197  LERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTN 256
            LER  QE+ LL+ N +WLE+EL +KN+ ++ YR+KTD ++ D    + +L++D ++E+++
Sbjct: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSS 241

Query: 257  NDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEE 316
             ++L +K +             K L D L  EKQEF  E+S+K +L+ L E+Q+ +++  
Sbjct: 242  KEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301

Query: 317  LNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQ-----CEKECLRLSSITDE- 370
            L   ++  TA+           EN              A+      E++C+RL SI D  
Sbjct: 302  LQ--QKFKTAEA--------NEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHD 351

Query: 371  ---------------------------ADEDNENLS-AKSSSDFIFLKKQLIKERRTKEH 402
                                          D+ ++S ++   D   LK+QL++E+R KE 
Sbjct: 352  SNDVSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEK 411

Query: 403  LQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQK 462
            LQNQ+E+F++ELEHK+P+INSF+ERT +             H + E   K  EL +  +K
Sbjct: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471

Query: 463  LVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITE 522
            + +  + L+ L +QR DL  Q+QYLLI  S+ ND+   L ++EI+FI+N++  D+   T 
Sbjct: 472  ISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMAST- 530

Query: 523  SDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLA---DXXXXXXXXXXXXXXXXXXXTV 579
            +DSQKV++E L++FK+I QLQEKN EL+K VR LA   +                     
Sbjct: 531  NDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIF 590

Query: 580  NEAKEAIITLKSEKMDLES--RIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLE 637
             EAKEAI+TL+    +LE   +I            S   E    S+ ++ +  E K   E
Sbjct: 591  AEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNE 650

Query: 638  SQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLS 697
            + V+DL+ R++Q+T +S  +   L +E+  L+   S +++++ K +S++ LAEER K+  
Sbjct: 651  TVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQ 710

Query: 698  NTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQK 757
            N+++L   EN+QLR R   L++++L+QD +T +T + YV   SK S +ET + NL+ E  
Sbjct: 711  NSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVT 770

Query: 758  LRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALS 817
            L               + EK  LRIMVTQLQ+LQ ERE LLE  +   +K+I E+     
Sbjct: 771  LLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINE 830

Query: 818  ELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVK 877
            +L K+ S++ H I ++E++ N+  EWYQ KI+   +  + +   + +K  ++E+L  + K
Sbjct: 831  KLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNK 890

Query: 878  SLEKEIEEDKIRLHTYNVMDETIN--------DDSLRKELEKSKINLTDAYSQIKEYKDL 929
            +LEKE+E  +IR+HTY    ETIN        ++ + KELEK+KI L DAYSQ++E+K+L
Sbjct: 891  TLEKELEGAQIRIHTY----ETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNL 946

Query: 930  YETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKG 989
             + +  +L++ N+  +   +D+ + IK LT+EKT +E +  +LK+Q+ N+ NEL +Q + 
Sbjct: 947  SQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEE 1006

Query: 990  MEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQK 1049
             E E+    + I+ LQ   + +E VK  +E KL K++NDL++QT+YAN AQ NYEQELQ+
Sbjct: 1007 AESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQR 1066

Query: 1050 HADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSR 1109
            HADVSKTISELREQ    K   K+L      L++ + +NEK   S+++    Q+DL+  R
Sbjct: 1067 HADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQR 1126

Query: 1110 IEDLSSQNKLLYDQIQIYTAADKEVNNSTN--GPGLNNILITLRRERDILDTKVTVAERD 1167
            I+D++ QN+LLY+QI +   A+    NS++    G   ++++LRRERDILDTK+ V E +
Sbjct: 1127 IDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETE 1186

Query: 1168 AKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXX 1227
               L+QK+  +  EL++ +        E   HS +I  +  I   L QLNLLRESN+T  
Sbjct: 1187 KNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLR 1246

Query: 1228 XXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQ 1287
                           +L   +  + P++S L +    +               RWK R +
Sbjct: 1247 NELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLE 1306

Query: 1288 DILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQ 1347
            +++EKH++++  DY                  ++  E  ++FNRL++QA E+L TSK  Q
Sbjct: 1307 EMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQ 1366

Query: 1348 DSLTEQVNSLRDAKNVLENSL---SEANAR-IEELQNAKVAQGNNQLEAIRKLQEDAEKA 1403
             SL EQ+++L   K+ +   L   +E N+  + EL N +  Q  N LE +R+        
Sbjct: 1367 SSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQ--NDLETLREELNKEISK 1424

Query: 1404 SRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXXXXXXXXXXATSANEQNDLSNIVES 1463
            S EL+ KL+    S  S  +                        +T A+EQ + +  VE+
Sbjct: 1425 SEELEVKLQNEIES-SSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRN--VEA 1481

Query: 1464 MXXXXXXXXXXXXXXXTQEVNEKILEAQERLN-------QPS---NINMEEIKKKWESEH 1513
            +               T+E N++++E  E++        +P    N+++E ++K+WE + 
Sbjct: 1482 IKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDS 1541

Query: 1514 EQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEID 1573
            E+ + ++I EAE+ LKKRIRLP                             S E+  +I 
Sbjct: 1542 EELIQKRIAEAEDNLKKRIRLP-----------------------------SEEKINKI- 1571

Query: 1574 VVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFN 1633
                      +++++ ELE+E+++K++++ +D+  + H S++  ++L+  +E  L+E F 
Sbjct: 1572 ----------IEKRRSELESEFDQKIRDKARDLLMNDH-SNEFNNELKEALEKELKERFE 1620

Query: 1634 NELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAE 1677
            +ELQA +KK+F+EGKQQA MKTTLLERK+ K+ESQ+ E ++ +E
Sbjct: 1621 DELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSE 1664

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1417 (33%), Positives = 809/1417 (57%), Gaps = 35/1417 (2%)

Query: 22   NAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGL 81
            +A+ASF     E + +  G V   +  K+ +F +L++ENLK +V+ DEL++SS  K+   
Sbjct: 19   DAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78

Query: 82   KTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQ 141
            K ++ ++++E + +R E      +    + E+ +  ++ + ++ + + L ++K+  ++N+
Sbjct: 79   KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANK 138

Query: 142  QRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKT 201
                ++L+E++ +I  ++ E  R   E + LR   ++LE + + Y + +L  + +  + +
Sbjct: 139  NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLS 198

Query: 202  QELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLK 261
            Q+++LL +NN+WLE +L  KN ++ +YRQ+T   +  +   L     D Q        L+
Sbjct: 199  QKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLR 258

Query: 262  QKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIR 321
            ++N             +K L+D L S KQEF+ EMSLKQRLV+LLE Q++A+K EL    
Sbjct: 259  EQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSEL---- 314

Query: 322  ELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSSITDEADE----DNEN 377
            E   +   + D+   T E+               Q E+  L++  +    ++    D + 
Sbjct: 315  EFKNSPQASTDAA--TTESQSQIEDELVHKTQ--QLEESELKIQKLEQTVEQLLSADEKT 370

Query: 378  LSAKSS-----SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXX 432
            +S   S     +D   LKKQ+I ERR KE LQNQ+E F+VELE+KVP+++SFK+R D+  
Sbjct: 371  ISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLE 430

Query: 433  XXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNS 492
                         S +K+    +L     ++ + E+ +  LT+QR DL RQ+QYLLI  +
Sbjct: 431  KELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVT 490

Query: 493  VSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKV 552
            V  DS GPL  EE  F++ ++  ++ T  + D+Q +++ERLVEFKNI++LQ KNA+LL  
Sbjct: 491  VRGDSHGPLSAEETAFVKKVVNMEN-TQPDGDAQGIISERLVEFKNIVELQAKNADLLHT 549

Query: 553  VRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRI-----XXXXXXX 607
            VRNLA+                   T+ EAKEAI+TL+    +LE+RI            
Sbjct: 550  VRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKA 609

Query: 608  XXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQD 667
                TS    +    +V  K       DL  ++++L+  +S   RE+  N+ LL  E Q+
Sbjct: 610  IQSQTSHEGSNGGLRDVNAK--ASENSDL--KIRELEELLSAAKREAEANVKLLMTENQE 665

Query: 668  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSK 727
            L  SKS++ + + KEKSSR+LAEER K+  ++L LTK EN++L KR   L+N + KQD++
Sbjct: 666  LARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTR 725

Query: 728  THETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQL 787
            T ET++E + CKS+L+ +  EL N   ++ L               + E++ L I+VTQL
Sbjct: 726  TQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQL 785

Query: 788  QTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNK 847
            QTLQKER+ LL+++  + + KID LE  +S+L+   SQK   +      ++S   WYQ K
Sbjct: 786  QTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEK 845

Query: 848  IEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDET----INDD 903
            I+AL +  +S  + ++SK   I++LQ +   L  ++ + + +  +Y+V+++T       D
Sbjct: 846  IDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTD 905

Query: 904  SLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKT 963
            +LR ELEK++INL DA+SQ+ EYK LY +T ++L    + L+ S +D T +++ L  E+ 
Sbjct: 906  ALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERD 965

Query: 964  SLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLS 1023
            +L +  ++LK+Q+ NLN+ELD QK  +E  K +  K    +++N   + ++K +Y+ +LS
Sbjct: 966  ALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELS 1025

Query: 1024 KIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLEN 1083
            K+  DL+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   +K +V +L  S  +L+ 
Sbjct: 1026 KLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKK 1085

Query: 1084 ALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGL 1143
            +L+ENE  W++QK+    Q  LS+ RIEDLS+QN+LL+DQI +       +N+       
Sbjct: 1086 SLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEA- 1144

Query: 1144 NNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSII 1203
              ++ TL+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S+V  +  S +I
Sbjct: 1145 RELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMI 1204

Query: 1204 QQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKY 1263
            +++  I+E+LNQ+NLLRESNIT               +  +++L++ + P+E+++  L+ 
Sbjct: 1205 EENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQR 1264

Query: 1264 SMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGA 1323
            S+             V+RWK+RSQDIL K+E++   ++                  +Q +
Sbjct: 1265 SVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRS 1324

Query: 1324 EAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKV 1383
            E E++F RL++QA+ERL  ++ +Q++L  ++   R+++  LE++L +   +   LQ +  
Sbjct: 1325 ELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIK 1384

Query: 1384 AQGNNQLE---AIRKLQEDAEKASRELQAKLEESTTS 1417
            A   N++E   A R   +DA +   + QA++ E +T+
Sbjct: 1385 ATEENEIENSSATRDQLQDALQKLEDAQARINEMSTA 1421

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 81/164 (49%), Gaps = 38/164 (23%)

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXX 1560
            ++E +KK+WE E+EQ   ++I EA E L+KRIRLPT                        
Sbjct: 1522 DIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKR----------- 1570

Query: 1561 XXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVP--HSSHISDDERD 1618
                      E+D    ++ EAK+Q++  EL  E  K L     +V   H   +     +
Sbjct: 1571 ----------ELD----EEFEAKLQQRTSELAGE--KPLPATFTEVMKRHKQEV-----E 1609

Query: 1619 KLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKL 1662
            KL+A+    ++ E + E+   KKK+FDEGKQQA MK+  LE+K+
Sbjct: 1610 KLKAD----MKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1367 (34%), Positives = 779/1367 (56%), Gaps = 46/1367 (3%)

Query: 27   FFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKTEME 86
            F G    ++ + DG VV ++  K  +F +L++ENL+ +V+ DEL++SS +K+   K ++ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 87   NVIRENDKIRKERNDTFVKFESVE----NEKMKLSSELEFVKRKLDDLTEEKKETQSNQQ 142
             +++E + +R E      +FE ++    +EK +  ++ E ++ + + L ++K+  +S++ 
Sbjct: 82   LLLQELESLRGES----AQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKN 137

Query: 143  RTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQ 202
               ++L+E++ E+   + E +    E ++LR   +DLE++ +   + DL  + EL R +Q
Sbjct: 138  DVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQ 197

Query: 203  ELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQ 262
            EL+L +SN++WLE +L  KN ++ +YR  T   +  +  +L  L  + Q     N  L++
Sbjct: 198  ELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLRE 257

Query: 263  KNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIRE 322
             N             +K L+D+LNSEKQEF+ EMSLK+RLVDLLE Q+ ++K +L    E
Sbjct: 258  HNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDL----E 313

Query: 323  LNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLS----SITDEADEDNENL 378
            L +     DD     P N               Q E+   ++     ++ D    D E+ 
Sbjct: 314  LRSTAGEGDDGSFSNPLNALSEELAQKTQ----QLEESEFKVQKLEQTVQDLVSTDKESR 369

Query: 379  SAKSS-----------SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKER 427
               S+            D   LK+Q+I E+R KEHLQNQ+E F+VELE KVP+++SFK+R
Sbjct: 370  LKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDR 429

Query: 428  TDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYL 487
             DM               S +K +   +L     ++ + E  +  LT+QR DL RQ+QYL
Sbjct: 430  NDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYL 489

Query: 488  LITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNA 547
            LI  SV +DSKGPL  EEI F++ I+++ D ++ E D+QKV++ERLVEF++I++LQ KN+
Sbjct: 490  LIQASVRSDSKGPLTTEEIAFVRRILEQGDLSL-ERDTQKVISERLVEFRDIVELQSKNS 548

Query: 548  ELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXXXX 607
            +LL+ +RNLAD                    + EAKEAIITL+    +LESRI       
Sbjct: 549  DLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKER 608

Query: 608  XXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQD 667
                   P+ + + + +T   L  +K  + ++V DL+  +     E+ +NM +LN EIQ+
Sbjct: 609  DAYKAIQPSTN-NGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQE 667

Query: 668  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSK 727
            L   K+ ++I++ KE++S+ LAEER K+   +L LTK EN++L KR+  +Q+ +LKQD+K
Sbjct: 668  LLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTK 727

Query: 728  THETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQL 787
            T ETL+  + C+SKL+ +E+EL +   + +                + E+++L I+VTQL
Sbjct: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQL 787

Query: 788  QTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNK 847
            QTLQ ER+ LL ET KS ++K+D LE   S+L+ + S+KD       + N+S  +WYQ K
Sbjct: 788  QTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847

Query: 848  IEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDET----INDD 903
            I++L +  + V + ++S+      L+ + K LE  ++E + +  +Y+V+++T       +
Sbjct: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907

Query: 904  SLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQ----IKNLT 959
            +LR ELEKSKI L DAYSQI+E++  Y++  ++L    S +  +F+ F N+      N+ 
Sbjct: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEAL----SAITNAFERFKNEHSKDFGNMK 963

Query: 960  DEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYE 1019
             ++  L  ++  LK Q+ NLNNEL  QKK  + EK + + ++  LQ+  + + ++K  YE
Sbjct: 964  KKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYE 1023

Query: 1020 SKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRD 1079
             +L K+  DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   YK Q   L  S +
Sbjct: 1024 QQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIE 1083

Query: 1080 QLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTA-ADKEVNNST 1138
            QLE  L E++  W +QKE    QL   N RIEDL+ QN LL DQ+ +     + E+  S 
Sbjct: 1084 QLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSE 1143

Query: 1139 NGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKEN 1198
                +  ++ +LRRERDIL TK+ V++R   +  +K+  ++ EL  A+ +L + +     
Sbjct: 1144 PQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQ 1203

Query: 1199 HSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESEL 1258
            +S +  +H+ ++E+LNQLNLLRESNIT               + ++D L+Q++ P+ESEL
Sbjct: 1204 NSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESEL 1263

Query: 1259 TALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXX 1318
             +LK S+              +RWK+RSQDIL K E++   ++                 
Sbjct: 1264 ASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAK 1323

Query: 1319 XRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLE 1365
              Q +E E++F RL++QA+ERL  +K  Q++L+ ++   R+A++ +E
Sbjct: 1324 ADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNME 1370

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 96/193 (49%), Gaps = 47/193 (24%)

Query: 1500 INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXX 1559
            +++E +KK+WE ++EQ+  ++I E+ E L+KRIRLPT                       
Sbjct: 1524 VDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSE--------- 1574

Query: 1560 XXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISD----- 1614
                            L ++ EAK+Q++  EL NE            P  +  ++     
Sbjct: 1575 ----------------LEQEFEAKLQKRASELANEK-----------PQPASFTEVMKRH 1607

Query: 1615 -DERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQL-SET 1672
              E +KL+A+    L  E + E+  ++KK+FDEGKQQA MK+  LE+K+AK+E+Q+ +  
Sbjct: 1608 KQEMEKLKAD----LTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASG 1663

Query: 1673 KQSAESPPKSVNN 1685
             ++  S P S N+
Sbjct: 1664 TEAVPSAPTSKNS 1676

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1715 (31%), Positives = 894/1715 (52%), Gaps = 113/1715 (6%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83
            +ASF   S + V++ D  ++K LN++  +FN +++E +K++   +  K ++   I  LK 
Sbjct: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKN 83

Query: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143
            E+  +I   + + KE+ D + K    E +K+    ELE    ++  L E   E QS +Q 
Sbjct: 84   ELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSKKQE 143

Query: 144  TLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQE 203
             +K LD+R+ E+   R      N+E  K R+ I+ LE + Q    NDL+ RT+LER +QE
Sbjct: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203

Query: 204  LTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQK 263
            L  +     WLE+ L  K EQ+ SYR+K+     D++ +LN ++N+    ++ N VL+++
Sbjct: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263

Query: 264  NNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIREL 323
             +            +K +  S N++K     E++LKQ+L+ +L+SQLN ++ E  +   L
Sbjct: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323

Query: 324  NTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKEC-LR----LSSITDEADEDN-EN 377
              +   +   K                       E E  LR     +++++    D+  N
Sbjct: 324  TVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDLRN 383

Query: 378  LSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXX 437
              AK+  D   LKK+L  E+  +E+ +  +E F+ +LE ++P + +++ R          
Sbjct: 384  SLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELKE 443

Query: 438  XXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDS 497
                    + EK+    ELN    ++   E +++ + KQR DL  Q+Q+ L+ NSV+NDS
Sbjct: 444  ATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDS 503

Query: 498  KGPLRKEEIQFIQNIMQEDDSTI-TESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNL 556
             GPL  EE++FI+NI+QEDD     E+D+QKV++ERL +FK+II+LQ+KN ELLK  R L
Sbjct: 504  AGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTREL 563

Query: 557  ADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPN 616
            A                    T+ EAKEAI+TL++    L ++I                
Sbjct: 564  ATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSNT 623

Query: 617  EDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDIS 676
            ED+S      KQ  + + +    V++L+TRI+ I +ES EN ++LN +I  L +  + IS
Sbjct: 624  EDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHIS 683

Query: 677  IKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYV 736
            I+L +EKS++ LAEER KLL  ++D+T  EN++L+KR + L+N +++QD +THET+N  +
Sbjct: 684  IELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLI 743

Query: 737  SCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKERED 796
              +S+L+ VE +    + E KL               + EK+S++++VT+LQTLQ ERE 
Sbjct: 744  KTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREH 803

Query: 797  LLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYE 856
            LL  T+    K++++LE   ++L+K+       +K+ EE+  S +E    +   LK D+ 
Sbjct: 804  LLSTTQDKFNKELNDLEGTCNDLRKK-------LKEAEENYGSLME----ETTELKDDFR 852

Query: 857  SVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDET--------INDD----- 903
                S+  + +++EK   ++   E+E + +  RL T  + ++T         +DD     
Sbjct: 853  QKKKSLKEEMSNVEKRYSEIVEKERETKWENTRL-TKQLKEKTELIEKYKAASDDEGKLE 911

Query: 904  ---SLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960
               SL+KEL+  K  LT++YSQ + Y+   E  +QS+   N ++      F  +I  +  
Sbjct: 912  EISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVEL 971

Query: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020
             K ++ D  ++LK Q+ +LNNEL++QKK  E EK +F +  + L+   K +E  K +YE 
Sbjct: 972  AKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYED 1031

Query: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080
            KL  +  DL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   Y+ ++  L +S   
Sbjct: 1032 KLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATD 1091

Query: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140
             +  L EN+ SW  Q++   +Q++    RIE+ S QNK+L++Q ++ T A+ E N  ++G
Sbjct: 1092 AKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSG 1151

Query: 1141 ----PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEK 1196
                 G N ++++LR ERD+L  ++ V E + K+LR++++ ++ + +    +L   + E 
Sbjct: 1152 VNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEET 1211

Query: 1197 ENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIES 1256
             N+  +++QH  +M +L QL+LLRESNIT               Q+E++ L   + P+E+
Sbjct: 1212 HNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLET 1271

Query: 1257 ELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXX 1316
            EL  L   +               RWK+RSQDIL K++++   ++               
Sbjct: 1272 ELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLE 1331

Query: 1317 XXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSL-SEANARI 1375
               ++  E   +F +L++QA E+L  SK+SQ+SLT Q+N L   K  L + L +E   ++
Sbjct: 1332 EKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKL 1391

Query: 1376 EELQNAKVAQGNNQ-LEAIRKLQEDAEKASRELQAKL---EESTTSYESTINGXXXXXXX 1431
               +  +V   N+  + +I+   E+A   S++ + K     ES+   E  +N        
Sbjct: 1392 SLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIKKLQE 1451

Query: 1432 XXXXXXXXXXXXXXXXATS--ANEQND-----LSN-IVESMXXXXXXXXXXXXXXXTQEV 1483
                            +T+   N   D     +SN IVESM               T E 
Sbjct: 1452 ESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIEEQTTEF 1511

Query: 1484 NEKI------LEAQERLNQ--PSNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLP 1535
             +K+      L+A+    Q  P +I+   I+K+ E E+EQ  SQ+I+EAEE LK+RIRLP
Sbjct: 1512 KKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLP 1571

Query: 1536 TXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEY 1595
            T                                  +I+ V+ K        ++ +LENE+
Sbjct: 1572 TEE--------------------------------KINKVIDK--------RRTQLENEF 1591

Query: 1596 NKKLQEELKDVPHSSHISDDER----DKLRAEIESRLREEFNNELQAIKKKSFDEGKQQA 1651
              K++   K++     ++ DE+    D+++ EI+  L  ++  ELQ +KKK+FDEG+QQ 
Sbjct: 1592 QNKVEARAKEL-----LTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQV 1646

Query: 1652 MMKTTLLERKLAKMESQLSETKQSAESPPKSVNNV 1686
            +MKT+ LE+K+ K+ES L    Q+A+S   + +N 
Sbjct: 1647 LMKTSFLEKKITKLESDL----QNAKSNTGATDNT 1677

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  593 bits (1528), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 438/1411 (31%), Positives = 756/1411 (53%), Gaps = 95/1411 (6%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83
            +A F     + ++  + DV+  + +KL    + KSENL++T + D+LK+ S  K++  K 
Sbjct: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69

Query: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEE-------KKE 136
             +  + +  +  + ER    + FE    EK +L      V +++ +L +E       K+ 
Sbjct: 70   HISQLAKALEDGKDER----LHFE---EEKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122

Query: 137  TQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTE 196
              +++Q   + L+E+++E+   + + N +    K+LR  +++ ET+ Q     +L S++E
Sbjct: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182

Query: 197  LERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTN 256
            + R  QE+TLL+ NNDWL  +L +K  Q   +R+ T   + D + +++ + ++ ++ RT+
Sbjct: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTS 242

Query: 257  NDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEE 316
            N  LKQ  +             K + D  N  KQE + EMSLKQR++D LE  + ++K+E
Sbjct: 243  NQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKE 302

Query: 317  LNS------------------IRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCE 358
            +++                  I ELN  K   D S                        E
Sbjct: 303  MDATKNNMDSSYFTEKERDELIEELNAVKYRLDAS------------------------E 338

Query: 359  KECLRLSSITDEAD-----EDNE--NLSAKSS----------SDFIFLKKQLIKERRTKE 401
              C++L    DE       ED+E  N +A S            D   LKKQL+ E+R K+
Sbjct: 339  SNCIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKD 398

Query: 402  HLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQ 461
             L+ Q+E F+VELEHK+P++NSFKER++M              T  +++ K  +L+    
Sbjct: 399  ELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKA 458

Query: 462  KLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTIT 521
             +   E  + +L+KQR+DL  QIQYLL+  S+ ++  GPL  EE+QF++N+    + T T
Sbjct: 459  TVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKT 518

Query: 522  ESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNE 581
             SD+Q ++T+RLVEF+++++LQ+KN+ELL  +RNLAD                   TV E
Sbjct: 519  -SDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVRE 577

Query: 582  AKEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQ 641
            AKE I+TL     +LE+++               N  AS    T K +T    D + +V+
Sbjct: 578  AKETILTLHDHAQNLENQLVILSKERDAYKALSVN--ASSGTNTPKAITYPSPDNDDKVK 635

Query: 642  DLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLD 701
            DL+TR++ + +E+  N    + E  +L     +IS+    EK+SR LAE+R  LL +TL+
Sbjct: 636  DLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLE 695

Query: 702  LTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVH 761
            L+K + ++L+KR   LQ+ + KQD +T ET++  +  KS LS +++EL  LK E++    
Sbjct: 696  LSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAK 755

Query: 762  XXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKK 821
                        S E    ++++ QLQTLQ+ERE LL+ET+ S ++K+ +LE  LS   +
Sbjct: 756  VQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLE 815

Query: 822  ETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEK 881
               + + +   +  +      W+Q KI+ L  +     T+++ K+  ++K+Q  +     
Sbjct: 816  RLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSA 875

Query: 882  EIEEDKIRLHTYNVMDETIND-----DSLRKELEKSKINLTDAYSQIKEYKDLYETTSQS 936
            +++E + R  +Y ++   ++D     ++LR+ELEK  + L+D+YSQI+ +K L E + QS
Sbjct: 876  KLKEAEARAQSYTMLS-NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQS 934

Query: 937  LQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKAD 996
            + + +   +E+ K+    I  L +E+  L+  +++L +Q+ +LNNE+  QK   + E+  
Sbjct: 935  VNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNA 994

Query: 997  FKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKT 1056
              + IS LQ   + V+  K++YE K++ IQ DL+ QT YAN +Q +YE ELQKHADVSKT
Sbjct: 995  TMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKT 1054

Query: 1057 ISELREQLHTYKGQVKTLNL-SRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSS 1115
            I+ LR +  +YK  ++TL   S+  +EN LK +EK W+ QK    ++L +   R+++LS+
Sbjct: 1055 ITSLRTEAQSYKSDLETLKTQSQLAMEN-LKNSEKLWNEQKTEYEDKLSVLEQRVQELST 1113

Query: 1116 QNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKI 1175
            QNKLLYDQI++    +    +  N    +++LI+LRRERD+L+TK+ VA  +  +L+Q++
Sbjct: 1114 QNKLLYDQIELLNKTE----DRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRL 1169

Query: 1176 SLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXX 1235
             +   E++D  T+L   +      + +++Q ++IM++L+QL+LLRESN+T          
Sbjct: 1170 DIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKK 1229

Query: 1236 XXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQ 1295
                 +S+L +    +AP++S +++L+  +               RWK RSQDIL K+E+
Sbjct: 1230 ECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYER 1289

Query: 1296 LSSSDYXXXXXXX-------XXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQD 1348
            +   ++                          +  + E KF R+R QA++RL  SK  + 
Sbjct: 1290 IDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQ 1349

Query: 1349 SLTEQVNSLRDAKNVLENSLSEANARIEELQ 1379
            SL+ ++N + +AK+ +E  L +     +EL+
Sbjct: 1350 SLSSEINQINEAKSQVEADLGKCKTACKELE 1380

 Score = 71.6 bits (174), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 96/213 (45%), Gaps = 42/213 (19%)

Query: 1495 NQPS-NINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXX 1553
            +QP+ +I+++ +K +WE E+E++  +KI+ AEEALKKRIRLPT                 
Sbjct: 1541 SQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARK----- 1595

Query: 1554 XXXXXXXXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHIS 1613
                                 VL +  E KV EK ++L  E           + + +   
Sbjct: 1596 --------------------AVLEESFEEKVNEKAQKLAGE-----------IGNDAITL 1624

Query: 1614 DDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETK 1673
            +  R +L A ++  +R++F  +L  IK+KSF+EGKQQ  +K   LE K+  +E Q S  K
Sbjct: 1625 EKHRAELNA-LKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIK 1683

Query: 1674 QSAESPPKSVNNVQNPLLGLPRKIEENSNSPFN 1706
                         Q P+ G          SPF+
Sbjct: 1684 PVENDTSNMSAAFQAPVFGSHSTF----TSPFS 1712

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  553 bits (1425), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 413/1408 (29%), Positives = 737/1408 (52%), Gaps = 50/1408 (3%)

Query: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60
            MSDH   +ES    +  +   + +A+  G    QV+     +V+ L  +   F +L++EN
Sbjct: 1    MSDH---IESKAESKAEEVDYSRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAEN 57

Query: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120
             ++ VS    +++    ++ L+   + +  E    ++ +       E+    +    S  
Sbjct: 58   TRLKVSIGAAESACEHGVEALRERQQQLAAEAGAQQRGQG------EAGSAGRAGGPSVP 111

Query: 121  EFVKRKLDDLTEEKKETQSNQQRTL-KILDERLKEIELVRVENNRSNSECKKLRSTIMDL 179
            E V+++L++ TE +     + +R L ++L+E++ +++  + E  R     K+LR   M+L
Sbjct: 112  ERVQQQLEE-TERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMEL 170

Query: 180  ETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDI 239
            E   Q   +  L  + E++R  QEL L++SN +W   +L  KN+Q  SYR+KT+  I   
Sbjct: 171  EFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQST 230

Query: 240  RNELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLK 299
            + ELN ++N+ ++E  N   L+ KN              K L+DSL+SEKQEF+ EM+LK
Sbjct: 231  QVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALK 290

Query: 300  QRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQ--- 356
            QRL++LL  Q+  +K++L    ++     ++D  +++   +                   
Sbjct: 291  QRLIELLNGQVATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLE 350

Query: 357  -CEKECLRLSSITDEADEDNENLSAKSSS----------DFIFLKKQLIKERRTKEHLQN 405
               KE L   ++        E+ +  S S          D   L+KQL++ERR KE LQ 
Sbjct: 351  DTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQL 410

Query: 406  QIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVE 465
            Q+E+F+VELEHK+P++NSFK+R +               T+ E++ KV ++     K+ +
Sbjct: 411  QVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGD 470

Query: 466  CENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDS 525
             E  +  L +QR DL RQ+Q LLI  SV +DS GPL  EE++F++ +    DS  T SD+
Sbjct: 471  YETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSA-TGSDT 529

Query: 526  QKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEA 585
            Q +++ RLVEFK++++LQ+KNAELL  +R LA                    TVNEAKEA
Sbjct: 530  QAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEA 589

Query: 586  IITLKSEKMDLESRIXXXXXX--------XXXXXTSVPNEDASYSNVTIKQLTETKRDLE 637
            I++L+     LE ++                    S+PN         +       +++ 
Sbjct: 590  ILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPN--------PVGAAALQPQEVA 641

Query: 638  SQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLS 697
              +  L+ R+  +  ES ++  +LN+EI+ LY S S ++I+L +E+SSR LA+E+  L+ 
Sbjct: 642  DGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQ 701

Query: 698  NTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQK 757
             +L+L K EN  L+ R   LQ  +L+QD++   T+ E+VS KS+L  + ++L  L+ E+ 
Sbjct: 702  KSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERD 761

Query: 758  LRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALS 817
                            + + +  ++++ QL+T QKER+ L+EETRK  + +I+EL+  LS
Sbjct: 762  FLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELS 821

Query: 818  ELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVK 877
              K++  +K     +L   +++  +W+Q+K+++LK++  S   ++ +K ++++ L+ ++ 
Sbjct: 822  ATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLN 881

Query: 878  SLEKEIEEDKIRLHTYNVM---DETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTS 934
            S   ++E   +     +++   D      SL K+L+++   L+ AYS+I+ YK     T 
Sbjct: 882  SSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATE 941

Query: 935  QSLQQTNSKLDESFKDFTNQIK-NLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKE 993
            +     N+  D   KD + Q   +L  E T L   I++  +++  L +EL+ ++     E
Sbjct: 942  RPSLSYNAVQDN--KDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTE 999

Query: 994  KADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADV 1053
            +++ +++I+ L  + + +E  K++Y+ K++++Q DL++Q    N A+  Y+  LQK A++
Sbjct: 1000 RSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEI 1059

Query: 1054 SKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDL 1113
            S+ I  LR+   +YK ++     + ++    L+ NE++W  QK  +   LDL++ RIE+L
Sbjct: 1060 SENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEEL 1119

Query: 1114 SSQNKLLYDQI--QIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKML 1171
            S+QN+LLYDQI     + +     ++        +++TLRRERDIL+TK+ V++R+ KML
Sbjct: 1120 STQNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKML 1179

Query: 1172 RQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXX 1231
            RQ++ L   EL + R +L  S+      +   Q  +++ EKLNQLNLLRE N++      
Sbjct: 1180 RQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESE 1239

Query: 1232 XXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILE 1291
                     Q+E+  L++ V P+E ++ +L  ++               RWK+RSQDIL 
Sbjct: 1240 KVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILH 1299

Query: 1292 KHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLT 1351
            K+E++   +Y                   +  +++E+F +LR+QA ERL   K ++  + 
Sbjct: 1300 KYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVE 1359

Query: 1352 EQVNSLRDAKNVLENSLSEANARIEELQ 1379
             ++      K+ LE  LSEA  +I  L+
Sbjct: 1360 SELELALSGKSQLEAKLSEAREKITSLE 1387

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 93/178 (52%), Gaps = 52/178 (29%)

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXX 1560
            N+E +KKKWE E+EQ+  Q+IREAEEALKKRIRLP+                        
Sbjct: 1531 NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEER--------------------- 1569

Query: 1561 XXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEE----LKDVPHSSHISDDE 1616
                       I+ V        ++ KQK LE E+  K+       LK+ P S  I+ D+
Sbjct: 1570 -----------INQV--------IERKQKALEQEFTTKVNATALALLKENPDS--IASDK 1608

Query: 1617 RDKLR------AEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ 1668
             D ++       +++  L ++F  +L  +KKK+F+EG+QQ +MK  LLE K++K+ESQ
Sbjct: 1609 ADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ 1666

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  428 bits (1100), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 423/1418 (29%), Positives = 703/1418 (49%), Gaps = 107/1418 (7%)

Query: 2    SDHDTPMESIQNGENSDER-----LNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNEL 56
            S+ DT   S +N  NS+ R     L  I+S     LE++ + D D++  + DKL +    
Sbjct: 10   SEADTLDSSFKNS-NSENRHDSTILLQISSILDVPLEKLHTTDYDLILAVKDKLDELRNS 68

Query: 57   KSENLKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKL 116
            K ++  V+   +EL+  +  K+  L                       K  +VE EK +L
Sbjct: 69   KDQSNVVSNDINELQTLADNKLTSLGG---------------------KLATVETEKKEL 107

Query: 117  SSELEFVKRKLDDLTEEKKETQSNQQRTLKILDERLK------EIELVRVENNRSNSECK 170
              ++               ETQ N+   LKI +E L        IEL   +NN +N E +
Sbjct: 108  IDKVNGY------------ETQFNE---LKIKNEGLNLKVSNLNIELENWKNNSNNFETE 152

Query: 171  KLRSTIMDLETKQQGYITND--LNSR-TELERKTQELTLLQSNNDWLEKELRSKNEQYLS 227
            KL             Y+     L+ R +E++R  QE+T L  N   L       +EQ+L 
Sbjct: 153  KL------------NYVXXXXXLSIRESEIQRLKQEVTFLNENKSSL-------SEQWLK 193

Query: 228  YRQKTDKVILDIRNELNRLRNDFQMERTNN---------DVLKQKNNXXXXXXXXXXXXI 278
             +++ +K  L +   LN   +  ++E              VL  KNN            I
Sbjct: 194  EKEEFNKAKLLLEKNLNN--STIKLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEI 251

Query: 279  KGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTP 338
            K L D+L   K + + E+++K +L+DLL+ QL++ +EEL    ELN+      D + Q  
Sbjct: 252  KNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQ-- 309

Query: 339  ENXXXXXXXXXXXXXXAQCEKECLRLSSITDEADEDNENLSAKSS---------SDFIFL 389
             N               + + E   L+S+ ++   +  N +  SS         S    L
Sbjct: 310  -NETLKSDIQDLTLKIEELQNENFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLL 368

Query: 390  KKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEK 449
            KKQ+ +E+  K+HLQ QIE+FI+ELE+K+PII+SF+E+                 TSNEK
Sbjct: 369  KKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEK 428

Query: 450  NAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFI 509
            N    +LN  + KL+  +++++ L +QRLDL  Q+++LL+  +V NDS GPL +EEI+FI
Sbjct: 429  NTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFI 488

Query: 510  QNIMQ-EDDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXX 568
              I    +D   +E  SQ V++ERLV F NI +LQ KN ELL  +R+L++          
Sbjct: 489  NKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANS 548

Query: 569  XXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPNE---DASYSNVT 625
                     T+ +AKEAI+TL+     LES++             + N    D+S  N  
Sbjct: 549  HKEFQNK--TIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDD 606

Query: 626  IKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSS 685
            +   T  + + E  ++ LQT I ++  E  +N   L  +I      KS+++I L KEKSS
Sbjct: 607  LSSSTSPETN-EKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSS 665

Query: 686  RILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIV 745
              L  E+  L  +  D+ K EN +L KRF+ LQN I+KQ+SK  + +N+Y++ ++++S +
Sbjct: 666  NTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNL 725

Query: 746  ETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSC 805
            +T+L   K E+   V             S EK+ LRIM++QLQ+LQ ER  LL++T+K  
Sbjct: 726  KTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKF 785

Query: 806  QKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSK 865
              KI ELE+   +L K    K   I++L   N S   WYQN I+ LKK   ++ T + SK
Sbjct: 786  MSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSK 845

Query: 866  QTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDS-LRKELEKSKINLTDAYSQIK 924
             + I  L  K++ LE +       + T      + ND S + K+L+ +K++L++AY+Q++
Sbjct: 846  NSLISDLNTKIELLESQ----SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVE 901

Query: 925  EYKDLYETTSQSLQQTNSKLDESFKDFT-NQIKNLTDEKTSLEDKISLLKEQMFNLNNEL 983
            EYK LY +T +SL+   S   ES K+   ++I  L  E  +L+       +++  L+ +L
Sbjct: 902  EYKQLYTSTEESLKTLESNF-ESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDL 960

Query: 984  DLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNY 1043
              +K    +E A    +I+ L    K+     SEYE K+SK+Q+ L+ +  +A+ AQ  Y
Sbjct: 961  KNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKY 1020

Query: 1044 EQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQL 1103
            E  L K     ++I E +EQ+     ++  +    ++  + L ENE  W  ++++ +  L
Sbjct: 1021 ESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDL 1080

Query: 1104 DLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTV 1163
            + S  +I++L++QNKL  DQ+++       +++S       ++   LR +RD+L+TK+++
Sbjct: 1081 EESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSI 1140

Query: 1164 AERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESN 1223
            AERD+K    K+  +  EL + + KL +S  +   HS +I+ H+ I+ +LNQ+ L +ESN
Sbjct: 1141 AERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESN 1200

Query: 1224 ITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRWK 1283
             T               Q++L++    ++ +  EL ++K S+              ++W+
Sbjct: 1201 ETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWR 1260

Query: 1284 KRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTS 1343
             R++++  + +++                       +Q AE EE+FN L++QA ERL  S
Sbjct: 1261 LRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNAS 1320

Query: 1344 KLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNA 1381
            K  Q SL +Q+N L+ +   +E +LS    +  +LQN 
Sbjct: 1321 KEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNT 1358

 Score = 82.8 bits (203), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 92/170 (54%), Gaps = 49/170 (28%)

Query: 1519 QKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEIDVVLRK 1578
            ++I EA+E LKKRIRLP+                                  +I+ V+ K
Sbjct: 1507 ERIEEAKETLKKRIRLPSET--------------------------------KINRVIEK 1534

Query: 1579 QLEAKVQEKQKELENEYNKKLQEELKDV-PHSSHISDDERDKLRAEIESRLREE----FN 1633
                    ++ ELENEY  KLQE+L ++  + + I   +  KLR EI+  ++ +    F 
Sbjct: 1535 --------RKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFE 1586

Query: 1634 NELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSET----KQSAESP 1679
            N+L   KKKSF+EGKQQ+ MKTTLLERK++K+ESQLSE     KQS ++P
Sbjct: 1587 NDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDKNP 1636

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  337 bits (863), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 425/1560 (27%), Positives = 726/1560 (46%), Gaps = 146/1560 (9%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83
            I+ +     + ++  +  +++ L  ++ +F   + E  ++ V  DE+K+    +I  L  
Sbjct: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLNE 64

Query: 84   EMENVIRENDKIRKE--RNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQ 141
             +     E +  +KE  R    +K     NE+ K +       RK+D L    K+  +++
Sbjct: 65   LLGESSEEKNVSKKELSRLHNLLK-----NERSKCA-------RKIDALN---KQLNASK 109

Query: 142  QRTLKILDERL--KEIELVRVE--NN---RS--NSECKKLRSTIMDLETKQQGYITNDLN 192
                K+ DER   +E E+++ E  NN   RS    E K LR  ++++E   Q   +N L+
Sbjct: 110  NTITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLS 169

Query: 193  SRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQM 252
             + + +   QE  L+  N  W+E++L  ++E+ L         + ++  +LNR +ND++ 
Sbjct: 170  LKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYES 229

Query: 253  ERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNA 312
              TNN  L  +N             IK L D++N EK +FS EM+L++ + DLL SQL +
Sbjct: 230  VSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS 289

Query: 313  VKEELN-SIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEK---ECLRLSSIT 368
             ++  + S RE +      DD  K    N               Q EK   EC RL +I 
Sbjct: 290  FEKNYSLSAREKDN-----DDPCK----NSQHANVVDKLIDTKLQLEKSKDECQRLQNIV 340

Query: 369  ------DEADEDN-ENLSA---KSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKV 418
                  DEA  DN  N+     K  SD   LK+QLIKER  K  LQNQ+E+FI ELE K 
Sbjct: 341  ADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKT 400

Query: 419  PIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRL 478
            P + SFKERT+                S  K    KEL +  QK+  CE ++ +L KQRL
Sbjct: 401  PELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRL 460

Query: 479  DLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKN 538
            DL RQ++ LL+  S       PL  +E+  ++ +++  D    E DSQ ++TERLVEF N
Sbjct: 461  DLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGD-VPNEKDSQIIITERLVEFNN 519

Query: 539  IIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLES 598
              +LQEKN ELL  VR LAD                   T+ EAK+AII L+     LES
Sbjct: 520  TNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLES 579

Query: 599  RIXX-XXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTEN 657
            RI             +  N +  Y++   K    T+     ++++L++ +S    E++  
Sbjct: 580  RIDILSRERDSYKLLASANGNKIYADAANK----TEAANLKKIKELESELSLTKVENSAV 635

Query: 658  MSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYL 717
            +  LNKE+     S+S+  I L +  + ++LA E+  LL   +D  K    +L K+    
Sbjct: 636  VQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKT---KLEKQRSSA 692

Query: 718  QNTILKQDSKTHETLNEYVSCKSKLSIVETELLNL-KEEQKLRVHXXXXXXXXXXXXSPE 776
             ++I          L++Y   K+K   +  E+ NL K+   LR                E
Sbjct: 693  PSSIHGSIGSEETELSQY---KNKTKSLMCEISNLSKKNTDLRC-MKESLTRDLERCCKE 748

Query: 777  KDSLRIMVTQLQTLQKEREDLLEETRKSCQ--KKIDELEDALSELKKETSQKDHHIKQLE 834
            K  L++ +T+ +T   E++  L+   K  Q   KI  LE    EL      K   I+ L+
Sbjct: 749  KMQLQMKLTESETSHNEQK--LKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQ 806

Query: 835  EDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTY- 893
               NS ++W QN I+  +K+ +S+ T +  K+T I KL  ++K LE E+++ K++     
Sbjct: 807  TSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLN 866

Query: 894  NVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTN 953
            N  D    + +L+KELE+S+I+L DA+SQI+ Y+++  T   +L++ N +L ++ ++   
Sbjct: 867  NSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKV 926

Query: 954  QIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRI----SILQNNNK 1009
            + ++L +E  + E++IS L+        ELD + +G++ +  +   R+      L N  +
Sbjct: 927  KSQSLDEENNAKEEEISFLRR-------ELD-EIRGLQPKLKEGALRLVQQSEKLGNQTQ 978

Query: 1010 EVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKG 1069
             ++A+  + +   + ++       ++     + Y+ +L+ + D+S  +  L  ++  Y+ 
Sbjct: 979  RIQAMNEKIDKMTTIVE-------LHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQT 1031

Query: 1070 QVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTA 1129
            ++K    S    +  L ++E+ W  +K     +L  +  + E L  +N  L ++I   T 
Sbjct: 1032 ELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKIDDGTG 1091

Query: 1130 ADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKL 1189
               E N       L ++  +LR ER+ L+TK+T  +RD  + +QK + ++  + D +   
Sbjct: 1092 ---ENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTH 1148

Query: 1190 DNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQ 1249
              SR + +  + II + +DIM+++ Q+N+L+E+N                   E   L+ 
Sbjct: 1149 LVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQY 1208

Query: 1250 NVAPIESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXX 1309
             ++ ++ +L   K  +             + +WK+R  ++ ++ ++    +         
Sbjct: 1209 EISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEIS 1268

Query: 1310 XXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLS 1369
                         A+  +KFNRL++QA E+L  SK  Q +LT +V+ L+D KN LE SL 
Sbjct: 1269 DLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEESLH 1328

Query: 1370 EANARIEELQNAKVAQGNNQLEAIRK---------LQEDAEKASRELQAKLEESTTSYES 1420
               +++ EL+ AK+ +   Q E + K         L E+ E   RELQ            
Sbjct: 1329 SEESKVLELE-AKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQV----------- 1376

Query: 1421 TINGXXXXXXXXXXXXXXXXXXXXXXXATSANEQNDLSNIVESMXXXXXXXXXXXXXXXT 1480
                                            E +D S+ +E M               T
Sbjct: 1377 ------------------------------FKETSDSSDTIEKMKEIMEAEKNKIIEEKT 1406

Query: 1481 QEVNEKILEAQERLNQPSNI----NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT 1536
             E   K+ EA  + N  + I    NMEE+KK+W  ++E+E  ++I+EAEE LKKRIRLP+
Sbjct: 1407 TEFERKLEEATGK-NTGATIENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPS 1465

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  313 bits (803), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 369/1422 (25%), Positives = 681/1422 (47%), Gaps = 87/1422 (6%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGL-- 81
            I+ F     E ++      +K L  K+ +F   + E  K+ V  DE+K+    +I  L  
Sbjct: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64

Query: 82   ---KTEMENVI------RENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTE 132
               ++  E VI      R  D++++ER+    K +++ N+++  S E     +KL+D  E
Sbjct: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDAL-NKQLNASHE---TIKKLED-EE 119

Query: 133  EKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLN 192
              KE  S+ Q  L+  D+  K +          + E K L+  ++++E   Q   +N ++
Sbjct: 120  GAKEEASSWQDGLRN-DDSTKHV---------LDKENKLLQRKLLEMENILQVCKSNAVS 169

Query: 193  SRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQM 252
             + + +  +QE  L   N  W E+ L S N++ L         + ++  +LN+ + + + 
Sbjct: 170  LQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENES 229

Query: 253  ERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNA 312
              T N  L  +N             IK L D+ N+EK EFS EM+L++++ DLL SQL +
Sbjct: 230  VSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTS 289

Query: 313  VKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSSITDEAD 372
              E  +S+R     K   DD   + PE+               + ++EC  L +I  +  
Sbjct: 290  F-ERGHSLR----PKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCI 344

Query: 373  EDNE-----NLSA----KSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINS 423
            E+N      N +A    K  S+   LK+QL+KER  K  +QNQ++ F++ELEHK P + S
Sbjct: 345  EENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVS 404

Query: 424  FKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQ 483
            FKERT++               S  K    K+L +  QK+   E ++ +L +QRLDL RQ
Sbjct: 405  FKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQ 464

Query: 484  IQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQ 543
            ++ LL   S    +  PL  +E+  ++ ++ E ++T+ E DSQ ++TE+LVEFKNI +LQ
Sbjct: 465  VKILLSNISAIQTTTSPLSNDELMSLRKLL-ESENTVNERDSQIIITEKLVEFKNIDELQ 523

Query: 544  EKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKS--EKMDLESRIX 601
            EKN ELL  +R LAD                   T+ EAKEAII ++S   K+ L   I 
Sbjct: 524  EKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNIL 583

Query: 602  XXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLL 661
                       S  N++ ++++   + +TE     E ++++LQ+++S    ES+  +  L
Sbjct: 584  TRERDSYKLLASA-NDNKTHADT--EGITEA--TYEKKIRELQSKLSSTRVESSAIIQNL 638

Query: 662  NKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTI 721
            N ++     S++D  I L + ++ ++L  E+  +L   ++  K + ++ R     L    
Sbjct: 639  NGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAAP 693

Query: 722  LKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLR 781
              QD K +  L +    ++K+  ++ E+ NLK+E    +               EK  L 
Sbjct: 694  PVQDYK-YSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLH 752

Query: 782  IMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNI 841
            + +++ +T   E+  +          +I  LE  L EL      K+  IK L+   NS +
Sbjct: 753  VKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQL 812

Query: 842  EWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRL-HTYNVMDETI 900
            +W QN I+  +K+ +SV   + +K+T I +L  ++++L  E+   K++     N  D   
Sbjct: 813  KWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNT 872

Query: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960
             + +LRKEL++++I L DA+SQIK Y+++  T    L++ N +L ++ +D   +I+    
Sbjct: 873  LEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENK 932

Query: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020
            EK + E+++S L++++  +     LQ K   +E A +     +LQ+     E V  + + 
Sbjct: 933  EKGAKEEELSHLRKELDEIRC---LQPKL--REGASY----LVLQS-----EKVGDQAQ- 977

Query: 1021 KLSKIQNDLDQQT----IYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNL 1076
            ++ +++N +D+       Y     + Y+ EL+ + D+S+ +  L ++   Y+ ++K    
Sbjct: 978  RIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKK 1037

Query: 1077 SRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNN 1136
            S    +  L  +EK W  +K     +L  +  + E L  +N +L ++I     A +  N+
Sbjct: 1038 SLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKID---GATEGSNS 1094

Query: 1137 STNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEK 1196
            +     L ++   LR ER  L+TK+T  +RD  +LRQK + ++  + D +      R + 
Sbjct: 1095 NEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKV 1154

Query: 1197 ENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIES 1256
            +  + II +++ I++++ Q+N+LRE+N                   EL  +++ ++ ++ 
Sbjct: 1155 QCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQG 1214

Query: 1257 ELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXX 1316
             L   K  +             + + K+R QD+ ++ +    ++                
Sbjct: 1215 HLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLL 1274

Query: 1317 XXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARI- 1375
                  A+ E KFNRL++QA E+L  SK  Q +LT ++N L++ K+ LE +L    +++ 
Sbjct: 1275 NVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVV 1334

Query: 1376 --------EELQNAKVAQGNNQLEAIRKLQEDAEKASRELQA 1409
                      LQ  +V++ ++ + A +   E+ E   +ELQ 
Sbjct: 1335 DLELKLKEHGLQVGEVSKDHDSI-AFKPFVEEIESLKKELQV 1375

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 30/36 (83%)

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT 1536
            ++E +KK+W  E+E+E  ++I+EAEE LKKRIRLP+
Sbjct: 1431 HIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPS 1466

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  299 bits (766), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 354/1384 (25%), Positives = 652/1384 (47%), Gaps = 81/1384 (5%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLK- 82
            I+ F     E ++  +  V++ L  K+  F   + E  ++ V  DE+K+    +I  L  
Sbjct: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKLSK 64

Query: 83   -----TEMENVIRE-----NDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTE 132
                 +E +N+  +      D++ ++R     K +++  +   L S  + +KR L+D  +
Sbjct: 65   LLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQ---LDSSRDAIKR-LNDEKD 120

Query: 133  EKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLN 192
             K+E+   Q +            + V    N  + E K LR  +M++E   Q   +N ++
Sbjct: 121  AKEESMIRQSKH-----------QNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVS 169

Query: 193  SRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQM 252
             + + +   QE  L+  N  W E++L S N + L+        I ++  +L + + D + 
Sbjct: 170  LQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRES 229

Query: 253  ERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNA 312
              + + +L  +N             IK L D+   EK EFS EM+L++ + DLL SQL +
Sbjct: 230  ALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLAS 289

Query: 313  VKEELNSIRELNTAKVIADDSK-KQTPENXXXXXXXXXXXXXXAQCEKECLRLSSIT--- 368
             +      R+ ++ ++  DD    + P++               + + EC RL +I    
Sbjct: 290  FE------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDF 343

Query: 369  ---DEADEDNENLS---AKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIIN 422
               D+A  D    S    K  SD   L+KQLIKER  K  LQNQ+E FI+ELEHK P + 
Sbjct: 344  VQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELV 403

Query: 423  SFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCR 482
            SFKERT                 S  K    +EL +  QK+  CE ++  L KQRLDL R
Sbjct: 404  SFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLAR 463

Query: 483  QIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQL 542
            Q++ LL+  S    +  PL K+++  ++ I+ E  S + E+D+Q +++ERLVEF NI +L
Sbjct: 464  QVKVLLLNTSAIQKTTLPLSKDDLISLRKIL-ESGSDVNENDAQAIISERLVEFNNINEL 522

Query: 543  QEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXX 602
            QEKN ELL  +R LAD                   T+ EAK+AII L++  M +ESRI  
Sbjct: 523  QEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINI 582

Query: 603  XXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLN 662
                         +++ +  NV  K  TE     E ++++L+  +S    ES+  +  L 
Sbjct: 583  LLRERDSYKLLASSKENNV-NVNAKNFTEISH--EKKIKELEAELSSTKVESSAVIQNLR 639

Query: 663  KEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTIL 722
            KE+        D  I     ++ ++LA+E+  +L   ++  K + ++ +     L     
Sbjct: 640  KELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTDLEKQK-----LSVPSF 694

Query: 723  KQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRI 782
             QD+K  ++  E +  ++K  I+  E+ +LK+E    +               EK     
Sbjct: 695  VQDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEK----- 748

Query: 783  MVTQLQTLQKEREDLLEETRKSCQKK-------IDELEDALSELKKETSQKDHHIKQLEE 835
               QLQ   KE E  L E + +   K       I +LE++L  L+ E   K   IK L+ 
Sbjct: 749  --IQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQS 806

Query: 836  DNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTY-N 894
              +S ++W QN I+  ++  +SV+T +  K+  +  L  K+++L+ E+ E+K++     N
Sbjct: 807  SKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNN 866

Query: 895  VMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQ 954
              D +    +LRKELE++++ L DA+SQ++ Y+++  T  ++L++ NS+L    +D+  +
Sbjct: 867  TSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDAR 926

Query: 955  IKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAV 1014
            I+    EK + E+++SLL+ ++  + +   LQ K +++      K+   L+N  ++++ +
Sbjct: 927  IELECKEKLANEEELSLLRRELDEIRS---LQPK-LKEGTVCLVKQSEKLRNQAEKIQEM 982

Query: 1015 KSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTL 1074
            K++ +     +Q       +Y     + ++  ++ + ++S+ ++ L ++    + ++K L
Sbjct: 983  KAKIDKMNWNVQ-------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKL 1035

Query: 1075 NLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEV 1134
              S  + ++ L  +EK W  +K     +L  +  + E L  +N +L ++I   T      
Sbjct: 1036 KSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGS--- 1092

Query: 1135 NNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRV 1194
            + + +   L +    LR ER+ L+TK+T  +RD  +++QK + ++  + D +     S+ 
Sbjct: 1093 DGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQT 1152

Query: 1195 EKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPI 1254
            E +  + II + +DI +++ Q+NLL+E+N                   EL   ++ V+ +
Sbjct: 1153 ELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQL 1212

Query: 1255 ESELTALKYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXX 1314
            +S+L   K  +             + + K+R  D+  +  ++                  
Sbjct: 1213 KSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAK 1272

Query: 1315 XXXXXRQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANAR 1374
                     E E KFNRL++QA E+L  SK  Q +LT ++  L+  ++ LE  L+  N +
Sbjct: 1273 LLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFK 1332

Query: 1375 IEEL 1378
              +L
Sbjct: 1333 TVDL 1336

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%)

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT 1536
            N+E +KK+W  E+E+E  ++IREAEE LKKRIRLP+
Sbjct: 1431 NIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPS 1466

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  290 bits (741), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 351/1416 (24%), Positives = 674/1416 (47%), Gaps = 78/1416 (5%)

Query: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83
            I+ F     E ++     V++ L  K+ +F   + E  K+ V  DE+K+    +I  LK 
Sbjct: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64

Query: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143
             ++    + +  ++E N            K +L+ E    +R++D L   KK+   + + 
Sbjct: 65   LLDESSEQKNTAKEELNGL----------KDQLNEERSRYRREIDAL---KKQLHVSHEA 111

Query: 144  TLKILDE-RLKE---IELVRVENNRS-----NSECKKLRSTIMDLETKQQGYITNDLNSR 194
              ++ DE R+KE   I   R + N S     N E K LR  +M++E   Q   +N ++ +
Sbjct: 112  MREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQ 171

Query: 195  TELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMER 254
             + +   QE  L+  +   +E++L S +++ L+        + ++  +L +++++++   
Sbjct: 172  LKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVF 231

Query: 255  TNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVK 314
            T N  L  +N             +K L D+ + EK EFS EM+L++ + DLL SQL +++
Sbjct: 232  TYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLE 291

Query: 315  EELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSSITDEADED 374
            ++  S+R +       DD+  + PE+               + + EC RL +I  +  ++
Sbjct: 292  KDC-SLRAIEK----NDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKE 346

Query: 375  NENLSAKSS---------SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFK 425
             E     S+         SD   LK+QLIKER  K  LQNQ+E FI+ELEHK P + SFK
Sbjct: 347  EEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFK 406

Query: 426  ERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQ 485
            ERT                 S  K  + +E+ +  QK+  CE ++ +L KQRLDL RQ++
Sbjct: 407  ERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVK 466

Query: 486  YLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEK 545
             LL+  S   ++  PL ++E+  ++ I+ E  + + E+DSQ ++TERLVEF N+ +LQEK
Sbjct: 467  LLLLNTSAIQETASPLSQDELISLRKIL-ESSNIVNENDSQAIITERLVEFSNVNELQEK 525

Query: 546  NAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXX 605
            N ELL  +R LAD                   T+ EAK+AII L++    +E+RI     
Sbjct: 526  NVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLR 585

Query: 606  XXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEI 665
                       E+   +  ++  +   +   E ++++L+  +S    E++  +  L KE+
Sbjct: 586  ERDSYKLLASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKEL 642

Query: 666  QDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQD 725
                 S+      L   ++ + LA+E+ ++L   +D  KAE   L K+  ++ + I  + 
Sbjct: 643  LIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEK 699

Query: 726  SKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVT 785
             +    L++    + K+  +E E+  LK+E    +               EK  L++ + 
Sbjct: 700  ERASTELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLK 756

Query: 786  QLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQ 845
            + +    E +          + KI ELE+ L  L+ +   K   I+ +    +S ++W Q
Sbjct: 757  ESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQ 816

Query: 846  NKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIN---- 901
            N I+  +   +S++T + +K+T IEKL  ++++L+KE+ + K +   Y  +D+  +    
Sbjct: 817  NTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTL 873

Query: 902  DDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDE 961
            + +LRKELE+ ++ L DA SQI+ Y+++  +   +L +  ++L ++ +++  +I+    E
Sbjct: 874  EPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKE 933

Query: 962  KTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESK 1021
            K + E+ +S L+ ++     E+   +  +++    F ++   L+N   EVE ++   E K
Sbjct: 934  KWAREEDLSRLRGEL----GEIRALQPKLKEGALHFVQQSEKLRN---EVERIQKMIE-K 985

Query: 1022 LSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQL 1081
            + K+   +    +      + Y+  ++++ D+S+ +  L +     + ++     S    
Sbjct: 986  IEKMSTIVQ---LCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSA 1042

Query: 1082 ENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGP 1141
            ++ L ++E+ W  +K     +L  +  + E L  +N +L +++   TAA+   N   +  
Sbjct: 1043 QDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAAN---NGDKDHL 1098

Query: 1142 GLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSS 1201
             L ++   LR ER+ L+TK+T  +R+   ++QK   ++  + D +     S  E +  + 
Sbjct: 1099 KLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAV 1158

Query: 1202 IIQQHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTAL 1261
            II +  DI +++ Q+N+L+E+N                   +L+  ++ ++ ++ +L   
Sbjct: 1159 IIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQT 1218

Query: 1262 KYSMXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQ 1321
            K  +             + + K+R QD+ ++ +     D                     
Sbjct: 1219 KEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENA 1278

Query: 1322 GAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARI------ 1375
             A+ E KFNRL++QA E+L  SK  Q +LT ++N L+  K+ LE  L   NA++      
Sbjct: 1279 NADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTK 1338

Query: 1376 ---EELQNAKVAQGNNQLEAIRKLQEDAEKASRELQ 1408
                ELQ+  V++ + + +  R L E+ E   +ELQ
Sbjct: 1339 LKAHELQSEDVSRDHEK-DTYRTLMEEIESLKKELQ 1373

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 29/36 (80%)

Query: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT 1536
            ++E +KK+W  E+E E  ++I+EAEE LKKRIRLP+
Sbjct: 1428 DIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPS 1463

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  250 bits (639), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 303/1235 (24%), Positives = 583/1235 (47%), Gaps = 97/1235 (7%)

Query: 216  KELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQKNNXXXXXXXXXX 275
            KEL   + ++ + +  +   + + ++ L+ L   +++    N   K++NN          
Sbjct: 202  KELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDEL 261

Query: 276  XXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKK 335
               K L + LN  K+ F+ EM+L Q   DLL+  +  +K         NT K     +  
Sbjct: 262  FKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLK---------NTTKETTGGT-- 310

Query: 336  QTPENXXXXXXXXXXXXXXAQCEKECLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIK 395
             T E                + E E + L+   ++   +NE   + S ++ + LK+QLIK
Sbjct: 311  STLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTENE--ESTSDNELVLLKEQLIK 368

Query: 396  ERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKE 455
            E+R K++LQ Q+E F++ELE+++P +NS K+R                 T  E + ++KE
Sbjct: 369  EKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKE 428

Query: 456  LNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQE 515
            L  +N++L E   ++  L  QR+DL  Q+Q+LL+   +    +  L  +EI F++ I++ 
Sbjct: 429  LTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKS 488

Query: 516  DDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXX 575
             +S   +SDSQK+++ERLV+F +I  LQ++N ELL   RNLA+                 
Sbjct: 489  RNSQ-NDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAE------QLESSDTKSVQ 541

Query: 576  XXTVNEAKEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTE--TK 633
              T NE+KE I  L+     L S++             +  E  +Y  ++++   E    
Sbjct: 542  KITRNESKEKIAKLQESINGLTSKLEK-----------LQKEKDAYKLLSLQNTGEQTPT 590

Query: 634  RDLESQVQDLQTRISQITREST-------ENMSLLNKEIQDLYDSKSDISIKLGKEKSSR 686
             +L SQ+Q  + +++++ R S+       E   +LN+ I  L   K D++  + KE S R
Sbjct: 591  EELRSQLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQR 650

Query: 687  ILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVE 746
             +AE++ K+L ++L+L   + D   K++++ +  +   +++  +   E  + ++K+SI++
Sbjct: 651  AIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQ 710

Query: 747  TELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQ 806
             E+ + K+                   + EK++L   ++ ++   +++ +L++E R++  
Sbjct: 711  KEIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQE-RETYY 769

Query: 807  KKIDELEDALSELKKETSQ---KDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVD 863
            K+ D + + L  LKK   Q   K   +K  E   NS I WYQ ++++L    + +   ++
Sbjct: 770  KEHDSISERL--LKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELN 827

Query: 864  SKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQI 923
             + T I   + K+  LEK + ++     +   +D+         + EK K  L +   +I
Sbjct: 828  KELTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQ---------DFEKLKNELKEKQLEI 878

Query: 924  KEYKDLY---ETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLN 980
             +Y+DL    E T   LQ          KD   Q + + D   ++E K   L +Q+  L 
Sbjct: 879  NQYRDLLNLAEETKNRLQ----------KDLNKQRQIVDD---AMEGK-EQLDQQLAELT 924

Query: 981  NELDLQKKGMEKEKADFKKRISILQNNNKEVEAVK---SEYESKLSKIQNDLDQQTIYAN 1037
             E       ++K+KA  +    I+Q+   E E +K   S  E+K++ ++N++ ++T    
Sbjct: 925  QECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFE 984

Query: 1038 TAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKE 1097
              +N Y+++L K ++ S  I ++  +   YK        S D L+  +   E + S+ ++
Sbjct: 985  EKENTYKEQLHKLSESSTLIEKMEAENKAYKT-------SLDGLKANIAAYEDAISAYRQ 1037

Query: 1098 SLLE-------QLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNN----- 1145
             LL+       Q+D     I++L+ Q  +   +    T+     +N T+   +N+     
Sbjct: 1038 KLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKN 1097

Query: 1146 -ILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQ 1204
             +++ LRRERD LD K+ +++R+   LR+++  +   L + R        E     +  +
Sbjct: 1098 ELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTE 1157

Query: 1205 QHDDIMEKLNQLNLLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYS 1264
            QH + +++LN+LN L+E+N                  ++L+ LK  + P++ ++  LK S
Sbjct: 1158 QHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNS 1217

Query: 1265 MXXXXXXXXXXXXXVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAE 1324
            +               RWK RS++IL K +Q+   ++                  +   +
Sbjct: 1218 IMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNED 1277

Query: 1325 AEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVA 1384
              ++FNRL++QA E+L  +K    SLT ++  L DAK+ LE  L E   RI+E+++    
Sbjct: 1278 LNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQ 1337

Query: 1385 QGNNQ--LEAIRKLQEDAEKASRELQAKLEESTTS 1417
            + +N   + A+ K   D+ + S++++  L+E+  S
Sbjct: 1338 KPDNPDVITALEKELSDSVENSKKIEENLQETVNS 1372

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 44/54 (81%)

Query: 1620 LRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETK 1673
            LR E+E  LR +F+NEL  +KKK+F EGKQQ+ MKTTLLERKL+K+ESQ S ++
Sbjct: 1541 LRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSR 1594

 Score = 43.5 bits (101), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 30/37 (81%)

Query: 1500 INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT 1536
            I++E++K +WE + E+ + Q+I +AEE LKKRIRLP+
Sbjct: 1467 IDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPS 1503

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  229 bits (584), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 238/1007 (23%), Positives = 485/1007 (48%), Gaps = 59/1007 (5%)

Query: 388  FLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSN 447
             L  +L +E  +K+ L+ Q+  F+ ELE   PII SFK++++              H + 
Sbjct: 294  ILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTK 353

Query: 448  EKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQ 507
            +K    +E+    ++L +     + L ++R DL RQ+QYLL+ N    DS  PL   E  
Sbjct: 354  DKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFS 412

Query: 508  FIQNIMQED--DSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXX 565
            +I+ I+  D  +   + +DSQ ++++R+++FK+I++LQ++N  LL  VR L+D       
Sbjct: 413  YIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER 472

Query: 566  XXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPNEDASYSNVT 625
                         +NEAK+ ++ L+     LE+++                 D  + N  
Sbjct: 473  KLESGDSIE---AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSD 529

Query: 626  IKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSS 685
            +           + +Q L+ +   +  ES+E +  L  +I +L  SKSD++ +     +S
Sbjct: 530  LSD--------GNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINS 581

Query: 686  RILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIV 745
            + L E+R K+  + LDL+K EN  LR R       + +++ +T +T+ +Y+ C +KL ++
Sbjct: 582  KHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVI 641

Query: 746  ETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSC 805
            + +L N   E+ +  +              E+++ + ++ QL+ LQK +++ L++ + S 
Sbjct: 642  QRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSL 701

Query: 806  QKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSK 865
            Q KID+LE   +EL+ +   K+        +  + +EWYQ K ++L    +++   +   
Sbjct: 702  QNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIEC 761

Query: 866  QTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIND-----DSLRKELEKSKINLTDAY 920
             + IE L  K ++L+  ++E   +        ET++D      +L  EL  S+  LTD  
Sbjct: 762  ASTIETLTVKTQTLDILLQEANSKNKLLEAR-ETVDDVNKLTGALETELATSRTRLTDTS 820

Query: 921  SQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLN 980
             ++       E +S +++Q           + ++IK L + ++ LE++   L++++  L 
Sbjct: 821  REL-------EISSNTIRQ-----------YQSEIKVLNERQSELENENKHLRDEIAILR 862

Query: 981  NELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQ 1040
            +EL       E+EK    K++S L+    E+  ++ +Y +++ K++ DLD+Q +     +
Sbjct: 863  DELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIK 922

Query: 1041 NNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLL 1100
              +++E++   +V    +E      TY+ +++ + + + ++     E EK   S+ + L 
Sbjct: 923  LAHDEEVR---EVQNRNTE------TYRNELELVEIRQTKV---FVEKEKELESRIKILN 970

Query: 1101 EQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG---PGLNNILITLRRERDIL 1157
            EQ++L   R++  S +  LL +Q+++   AD++ ++  +    P   +++  L  E+  L
Sbjct: 971  EQIELDKERMKQFSDEESLLREQVKLL--ADEKASDLVDAGVSPEYTDLVRKLSDEKKNL 1028

Query: 1158 DTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLN 1217
            ++K+  ++ +   LR++++  + E+  A   ++  + +KE  + +  +     E + QL 
Sbjct: 1029 ESKLFASQSEKNRLREQLTKTESEI--AVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLE 1086

Query: 1218 LLRESNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXX 1277
             L+ESN++                +EL++LK     +ES+L   +  +            
Sbjct: 1087 SLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQT 1146

Query: 1278 XVHRWKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQG-AEAEEKFNRLRRQA 1336
               R K  S D+ +   + SSS+                   +    E E++F RL+RQA
Sbjct: 1147 ECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQA 1206

Query: 1337 QERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKV 1383
            +ERL  SK++ +SL + V +L   K  L++ +  +   + EL+ AK+
Sbjct: 1207 RERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELR-AKI 1252

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 60/122 (49%), Gaps = 19/122 (15%)

Query: 1616 ERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQS 1675
            E + L+ EIE + +    + L A+KK++F+EGKQQA MK ++LERK+AK+E++   TK  
Sbjct: 1448 ELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSG 1507

Query: 1676 -----AESPPKSVNNVQNPLLGLPRKIEENSNSPFNPXXXXXXXXXXXXXXXXXXFNPFT 1730
                 +E  P+ V    N +        + +N PF                     NPFT
Sbjct: 1508 SDMSVSEDAPRFVTPNNNKV--------QQANQPF------LATAGSGFSVQSSESNPFT 1553

Query: 1731 SP 1732
            +P
Sbjct: 1554 TP 1555

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  226 bits (575), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 285/1127 (25%), Positives = 529/1127 (46%), Gaps = 87/1127 (7%)

Query: 130  LTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITN 189
            L +EK  +Q  +   LK+L+ER+ +I+ ++ + N+   E K L      L  + +     
Sbjct: 63   LQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDE 122

Query: 190  DLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRND 249
             L  RT+L++ T  L+L        E E  SK + + SY+ + +    ++   L  + N+
Sbjct: 123  KLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNE 182

Query: 250  FQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQ 309
             +M    N  L ++N             IK L +SL +   +F +E  L+ +L++ L++Q
Sbjct: 183  LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQ 242

Query: 310  LNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSSITD 369
            +  ++E+L S   L+  K   DD   Q  +                  E+E L L    +
Sbjct: 243  IKTLQEQLES---LSDEKF--DDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSME 297

Query: 370  E----------------ADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVE 413
            E                +  +N  LS   S D   L+K  +KER+ K  L+ Q+   + E
Sbjct: 298  EFQNIPEEESSSVSSHASGRNNSALSL--SGDVNILRKHFLKERQQKRQLEEQMRQILQE 355

Query: 414  LEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTL 473
            LE  +P ++S+KER+               H   E   K  EL  K  +     + + +L
Sbjct: 356  LERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSL 415

Query: 474  TKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERL 533
              QR  L RQ++YLL+    +      L +++++ +   +  + +    SDS+K++ ERL
Sbjct: 416  AFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAM-SDSEKILLERL 474

Query: 534  VEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEK 593
             +FKN+ +LQ +N +LL+V R LA                    T+N+AKEAI+ L+   
Sbjct: 475  AQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYS 534

Query: 594  MDLESRIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRE 653
              LES+I                +++      I  +++ + D  S   DL  ++S   + 
Sbjct: 535  QKLESQIKELSDELAVQKKEKTEKES------ISAMSKIEDDASSHTIDLGKQLSANLKH 588

Query: 654  STENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKR 713
            S + +  LN EI++L+ + +D++I L KEKS+R LAE+R+ LL   + L K+E ++L++ 
Sbjct: 589  SKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEE 648

Query: 714  FDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXX 773
             + LQ  IL ++ +   +  +Y+SCKSKLS  E E+ +L+ E +L +             
Sbjct: 649  VNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEAL 708

Query: 774  SPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIK-- 831
              E+++LR+ VTQ+ +L  E + LL+ET+     K+      +S LK   +Q ++ ++  
Sbjct: 709  LNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKL-----KISALK--CTQTNNQLQLV 761

Query: 832  -----QLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEED 886
                 +L+  N+S I+WY+  I+ LK +   +   +  K+  IE+    +++++ E    
Sbjct: 762  QQRMSELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNE---- 817

Query: 887  KIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDE 946
               L   N  D +    +L KEL + K  L  +  ++KEY+++  T+ +S +  + + ++
Sbjct: 818  ---LTLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYED 874

Query: 947  SFKDFTNQIKNLTDEKTSLEDKISLLKEQMF----------NLNNELDLQKKGMEKEKAD 996
              K   +++ +   E+T+L++ +S L+ +M           N  +EL +    +  E+  
Sbjct: 875  RIKALASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKT 934

Query: 997  FKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKT 1056
            FK + + L++    V AVK+     LSK                 +YE+ +Q+++++SK 
Sbjct: 935  FKDKEAELRS----VIAVKTGNYDSLSK-----------------SYERIMQENSELSKV 973

Query: 1057 ISELREQL--HTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLS 1114
            +  LRE++   T  G+ K  +L  +  E+ +K+ +  W  +K+    Q+   N R+ +L 
Sbjct: 974  VELLREEVKNRTSNGE-KEGDL--EDTESIIKKGQDVWDEEKKVFEVQITNLNERLSELL 1030

Query: 1115 SQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQK 1174
             +N+ L  +++     +   +  TN  G    L  LR ER  L  K+T A+++ + +R K
Sbjct: 1031 EENESLLARLESQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHK 1090

Query: 1175 ISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRE 1221
            +   +  L +   +L   + +    SS+ Q   DI+  L  L   RE
Sbjct: 1091 LRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQRE 1137

 Score = 69.7 bits (169), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 82/160 (51%), Gaps = 46/160 (28%)

Query: 1513 HEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEI 1572
            +E+E+ +K+ +AEE LKKRIRLPT                                    
Sbjct: 1224 YEEEIQKKVSQAEENLKKRIRLPTE----------------------------------- 1248

Query: 1573 DVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLRE-- 1630
                 +++   +++++ ELE+ + +K++EE K +    H  DD+  K+  EIE   RE  
Sbjct: 1249 -----EKINGIIEKRKSELESSFEQKIKEEAKSLLL--HSDDDKIKKIYKEIEESGRETL 1301

Query: 1631 --EFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ 1668
              EF+ +L  ++KK+F+EGKQ  +MK+  LERK++ +E Q
Sbjct: 1302 QQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  178 bits (452), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 145/470 (30%), Positives = 238/470 (50%), Gaps = 27/470 (5%)

Query: 403 LQNQIETFIVELEHKVPIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQK 462
           L++ I+ ++ ELE ++P+I +FK   +                 N+K   +K +++  + 
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 463 LVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITE 522
           + E  + ++ L  QR DL  Q+QYLLI +S+ ND+ GPL K EI F+QN++ +D   ++ 
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS- 332

Query: 523 SDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEA 582
           SD Q V+++RL++FK+I+ LQEKN EL K +RNLA                    T+NEA
Sbjct: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392

Query: 583 KEAIITLKSEKMDLESRIXXXXXXXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQD 642
           KE I++L+     L+  I           +S+PN   S      KQ      +L   V+D
Sbjct: 393 KETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESE-----KQHFNYHSNL---VKD 444

Query: 643 LQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDL 702
           L++++S+++  S   +  LNK+IQ+LY+ ++DI I L KEKSS ILA E+  LL N+ DL
Sbjct: 445 LESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDL 504

Query: 703 TKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHX 762
              EN++L  +   L+  + +++   +  LN+Y+ CK+ L +  T  L L    KL +  
Sbjct: 505 LTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNL-LDFTNRLTLLNNNKLGLEE 563

Query: 763 XXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSE---- 818
                      + E+      +  L +  K  E  LE        K+ ELE  +S+    
Sbjct: 564 ENNSLKQEIKSNYEQ------IKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQ 617

Query: 819 ---LKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSK 865
              L+++   K+  I  L   N   I WYQ K++     YE  I +++S+
Sbjct: 618 KLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQ----YEKTIKTLESR 663

 Score =  121 bits (304), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 142/577 (24%), Positives = 262/577 (45%), Gaps = 127/577 (22%)

Query: 1109 RIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDA 1168
            R+++L++QN+LL ++++   +A+ EV++         I ++LR ERD L  +V   E+D 
Sbjct: 734  RVQNLATQNRLLLEKLE--RSANLEVDD---------IFVSLRYERDTLSDQVVNYEKDM 782

Query: 1169 KMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQH-------DDIMEKLNQLNLLRE 1221
            +++   +  +  EL  A +++ N     EN  +++Q H       + ++EKL +L+ L+E
Sbjct: 783  QVILADLESVQSELNAANSQILNF----ENQRAMVQDHKKGNVNEETLIEKLTELDELKE 838

Query: 1222 SNITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHR 1281
             N+                + +L++  + + P+E++++ L   +                
Sbjct: 839  RNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAEN 898

Query: 1282 WKKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLK 1341
            WK R         +L+ S                    ++  E  ++FNRL++QA ERL 
Sbjct: 899  WKTR-------FNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLH 951

Query: 1342 TSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAE 1401
             SK++Q++LTEQ N L+     LE +LSE   R +EL+N+ ++  + +L +I  L+E   
Sbjct: 952  ASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENS-ISLKDQELGSIGDLKEQLA 1010

Query: 1402 KA---SRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXXXXXXXXXXATSANEQNDLS 1458
             A   S++ + +L ++ +  ES +                                +DL 
Sbjct: 1011 NALDKSKKFEEELIKTVSESESLV--------------------------------SDLK 1038

Query: 1459 NIVESMXXXXXXXXXXXXXXXTQEVNEK---ILEAQERLNQPS---NINMEEIKKKWESE 1512
            N +ES+               ++  N K   I E +E+LN+     ++  +E  K  ++E
Sbjct: 1039 NEIESLNEKLKSKESSVGLQESEIENAKKILIAELEEKLNKTKSELDLKHKEELKVLKTE 1098

Query: 1513 HEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEI 1572
            +E ++ +++ EAEEALK++IRLP+                                    
Sbjct: 1099 YEGDIQKRVAEAEEALKRKIRLPS------------------------------------ 1122

Query: 1573 DVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEF 1632
                 +++   ++ K  +LE +Y KKL+        S+  +D E          ++++EF
Sbjct: 1123 ----EEKINTIIESKVADLEEDYKKKLE------TVSAESTDIE----------KIKQEF 1162

Query: 1633 NNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQL 1669
             + L   KKK+F+EGKQQA MKT  LE K+AK+ESQL
Sbjct: 1163 EDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQL 1199

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  143 bits (360), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 151/555 (27%), Positives = 275/555 (49%), Gaps = 53/555 (9%)

Query: 21  LNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDG 80
           ++ I+SFF       +S D   ++ +  K     +L  EN  V+ + D++K     KI+ 
Sbjct: 14  IDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAIDDIKHVYEGKINT 70

Query: 81  LKTEMENVIRENDKIRKERNDTFVKFESVENEKMK-------LSSELEFVKRKLDDLTEE 133
           +  +  N+  EN K++++ +   V  E + +EK K       L+SE+  +K  L+ +  +
Sbjct: 71  ISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRD 130

Query: 134 KKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETK-----QQGYIT 188
               ++ +++T  +L++        ++E   S +E   L+  I   E K     Q+ ++ 
Sbjct: 131 HTTLEARERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLA 183

Query: 189 NDLNSRTELERKTQELTLLQSNNDWLEKELR--SKNEQYLSYRQKTDKVILDIRNELNRL 246
           N  N + +   K     LL+ NN +LE + +   KN++  S  +   +    ++++L  +
Sbjct: 184 NTENKKLQTGMK-----LLRENNLYLEIKCKETDKNKKLYSSAEDASR----LQDQLQIV 234

Query: 247 RNDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLL 306
            ++    ++    LK  N             IK L D+LNS KQEF+ E++LKQR+ +LL
Sbjct: 235 SSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELL 294

Query: 307 ESQLNAVKEELNSIRELNTAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKECLRLSS 366
            +++ + K+++  +   N           +TPE                  EKEC  L S
Sbjct: 295 HNEIASYKKQIERLTSKNL----------ETPE-KKIIQELVDLKEKLVNSEKECNELKS 343

Query: 367 ITDE-ADEDNENLSAKSSSD---FIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIIN 422
             D+  + D + L +K  +       L++QL+KE+R K+ LQ Q+E+F+VELE K+P+I+
Sbjct: 344 TVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMID 403

Query: 423 SFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCR 482
           SFKER                 T+ E++ K +EL    +K+   E     L +QR DL  
Sbjct: 404 SFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAH 463

Query: 483 QIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQL 542
           Q+QYLL+      D+K P  ++E   ++ I+  +++T  ++DS K++++RL+ F+N+ +L
Sbjct: 464 QVQYLLL----CIDNKSPFTEKEATLVKKIVS-NENTENDTDSHKIISKRLLHFQNVKEL 518

Query: 543 QEKNAELLKVVRNLA 557
           Q+KN ELL+  R L 
Sbjct: 519 QQKNMELLRTTRQLV 533

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 98/184 (53%), Gaps = 53/184 (28%)

Query: 1517 VSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEIDVVL 1576
            + ++I EAEE LKKR+RLP+                                        
Sbjct: 1362 ILKRITEAEENLKKRMRLPSE--------------------------------------- 1382

Query: 1577 RKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNEL 1636
             +++ A +++++K LE E+  KL+E   +   +  ++D      RA+IE  LRE+FN EL
Sbjct: 1383 -EKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDT-----RAQIEKELREKFNLEL 1436

Query: 1637 QAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ-LSETKQ--SAES-PPKSVN----NVQN 1688
              IKKK+F+EGKQQ+MMK+TLLERKL+K+ESQ LS TK   S E+  P  +N    N  +
Sbjct: 1437 AEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSS 1496

Query: 1689 PLLG 1692
            P LG
Sbjct: 1497 PPLG 1500

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 120/278 (43%), Gaps = 22/278 (7%)

Query: 1169 KMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQH------DDIMEKLNQLNLLRES 1222
            KML   ++  +  L+ AR +  N R +  +   I QQ       +++ME   +L  L ES
Sbjct: 1016 KMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEES 1075

Query: 1223 NITXXXXXXXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVHRW 1282
            N                  S+L  ++  + P+E E+  LK  +             + RW
Sbjct: 1076 NAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERW 1135

Query: 1283 KKRSQDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKT 1342
            K RSQ IL++ + +    +                   + A+  ++F+RL++QA E+L  
Sbjct: 1136 KLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDA 1195

Query: 1343 SKLSQDSLTEQVNSLRDAKNVLENSLSE--------ANARIEELQ-----NAKVAQGNNQ 1389
            +K  Q +LT Q+N L + K  LE SL +         N   +E +      A++ + NN 
Sbjct: 1196 AKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNF 1255

Query: 1390 LEAIRKLQEDAEKASRELQAKLEE--STTSYE-STING 1424
               + K  EDA+K   E+++   E  S  +YE ST+N 
Sbjct: 1256 SNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNS 1293

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 224/900 (24%), Positives = 403/900 (44%), Gaps = 160/900 (17%)

Query: 826  KDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEE 885
            K+  +KQ  E +   I+WYQ  I+ L +  ++       K   I +L  K++ L     E
Sbjct: 704  KEEEVKQFIEKSEKQIKWYQQNIDELSEQNKN-------KSNKIIELNDKLRLLS----E 752

Query: 886  DKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKD-------LYETTSQSLQ 938
              +    Y V  E      L+ EL   K  L  + SQ   YKD        Y  ++ S Q
Sbjct: 753  KSLSNKPYPVGTEL---KELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQ 809

Query: 939  QTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFK 998
             T S+L    +  + Q + L ++ T  E++   ++ +   + + L  +K  +E+      
Sbjct: 810  NTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEE------ 863

Query: 999  KRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTIS 1058
             +++ L ++ +++  +K EY++++ KI+++L  Q+      + N+E  L      SK   
Sbjct: 864  -KLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQS----DTRLNFESAL-----TSK--- 910

Query: 1059 ELREQLHTYKGQVKTLNLSRDQLENALK------ENEKSWSSQKESLLEQLDLSNSRIED 1112
               ++L +Y  Q++ LN    +L + +       E  K+   +++SL ++L L+N RIE 
Sbjct: 911  --EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELKLANQRIES 968

Query: 1113 LSSQNKLLYDQIQI--YTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKM 1170
            L++QN +LYD      +  AD E N       L N++I LR ERD+  ++ T A+RD K+
Sbjct: 969  LAAQNSILYDTFSGMRHVDADAEPNED-----LRNLVINLRIERDMHQSQETTAQRDVKL 1023

Query: 1171 LRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITXXXXX 1230
            L++ +  +  +L     ++D     +++  S+   H+ IM +L  L   +E N+      
Sbjct: 1024 LKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESI 1083

Query: 1231 XXXXXXXXXXQSELDKLKQNVAPIESELTALKYSMXXXXXXXXXXXXXVH----RWKKRS 1286
                      Q E+ +L+      ESE  A K S                    +WK   
Sbjct: 1084 KSLNEDKRTLQEEVSRLR------ESEELAKKNSSAISEQEWQQKIETYQQESEKWKLMC 1137

Query: 1287 QDILEKHEQLSSSDYXXXXXXXXXXXXXXXXXXRQGAEAEEKFNRLRRQAQERLKTSKLS 1346
            Q + E     ++++                   ++  +  ++F RL++QA E+L  SK +
Sbjct: 1138 QQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKAT 1193

Query: 1347 QDSLTEQVNSLRDAKNVLENSLS--EANARIEELQNAKVAQ---GNNQLEAIR-KLQEDA 1400
             DSL  +++ L+   + L+  L+  E N+   E   A + Q    N Q +++  +L+   
Sbjct: 1194 SDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSV 1253

Query: 1401 EKASRELQAKLEESTTSYESTINGXXXXXXXXXXXXXXXXXXXXXXXATSANEQNDLSNI 1460
            + + + +    +E TT  E+ I G                         S N + D ++ 
Sbjct: 1254 DSSEKLIADMTKELTTLKENPIQG-------------------------SVNVE-DYTHR 1287

Query: 1461 VESMXXXXXXXXXXXXXXXTQEVNEKI-LEAQERLNQPSNINMEEIKKKWESEHEQEVSQ 1519
            +E +               T E+ E+   E +E +N  +N N+EE++K  E E E++  Q
Sbjct: 1288 LEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMN--NNANLEELRKPLEEEWERKTLQ 1345

Query: 1520 KIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMEQSGEIDVVLRKQ 1579
            +I EA+E LKK IRLPT                                         ++
Sbjct: 1346 RIEEAKENLKKHIRLPTE----------------------------------------EK 1365

Query: 1580 LEAKVQEKQKELENEYNKKLQEE---LKDVPHSSHISDDERDKLRAEIESRLREEFNNEL 1636
            +E  + +++ +LE ++  K+ E+   LK    S+  +D+   ++R EI++RL E+F    
Sbjct: 1366 IERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDF---- 1421

Query: 1637 QAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPPKSVN-----NVQNPLL 1691
            + +KKK+F+EG+QQA MKTTLLERK+AK+E++L    Q    P KS N     N+ +PL+
Sbjct: 1422 ELLKKKAFEEGRQQASMKTTLLERKIAKLEARL----QGGTGPLKSANGLNKINIDSPLM 1477

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  126 bits (317), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 171/644 (26%), Positives = 310/644 (48%), Gaps = 73/644 (11%)

Query: 191 LNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR---NELNRLR 247
           L S++E ER  ++  L++ +N WLE+ L    E+ ++ +Q     IL +     E++ LR
Sbjct: 118 LISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQS----ILKMEEKDQEIDNLR 173

Query: 248 NDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLKQRLVDLLE 307
           ++  + + NND+L  KN             IK  SD  ++++QEF  E+ LK R+   LE
Sbjct: 174 HEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLE 233

Query: 308 SQLNAVKEELNSIRELNTAKVIAD-------DSKKQTPENXXXXXXXXXXXXXXAQCEKE 360
           +QL  +++E +   E NT++  +        D++KQ  ++                   E
Sbjct: 234 TQLKEIQQEKSIQNEDNTSRAESQKIMEQLIDTRKQLKDSRN-----------------E 276

Query: 361 CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420
           C RL S  +E   D   ++ + SS    LKK+L+K +  K++L+ Q+E FI ELE KVP+
Sbjct: 277 CTRLKSYVNEFIND---VNGEYSSSSSLLKKELLKVKEQKDYLETQVENFITELEIKVPV 333

Query: 421 INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480
           I+S +++                  S E+ +  KE  +  +K    +  +QTLT QR DL
Sbjct: 334 IDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDL 393

Query: 481 CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540
             QIQ+LL+       +   L K+E  FI+ +  E+D+    +DSQ +++ERL++F +I 
Sbjct: 394 AHQIQFLLLILGEQATTNALLSKDETDFIRRLT-ENDTYARNNDSQSIISERLLKFADIT 452

Query: 541 QLQEKNAELLKVVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRI 600
           +LQ++N ++L  VR+LA                    T+ EAK+A++ L+     LE ++
Sbjct: 453 ELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKL 512

Query: 601 XXXXXXXXX----XXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTE 656
                             P+ +       I + T  K  L++++Q  QTR   +T+E  E
Sbjct: 513 ETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGK--LQNELQ--QTR-EYLTKE-IE 566

Query: 657 NMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDY 716
            ++  NK   D+ + K ++   + K +S++  AE + +L+ N L + +     + ++ D+
Sbjct: 567 KLTRTNK---DILNKKKELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDH 623

Query: 717 LQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPE 776
           LQ  + ++++K  E   +     S+ ++++    + +                      +
Sbjct: 624 LQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQ---------------------SQ 662

Query: 777 KDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELK 820
            +SLR   TQ QT QKE  +++EE + + + KI ELE + +E K
Sbjct: 663 SNSLR---TQHQTTQKELFEVVEE-KNALKVKIHELEISRNECK 702

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 137/285 (48%), Gaps = 68/285 (23%)

Query: 1495 NQPSNINM--EEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXX 1552
            N  SN++   +E++K WE    ++  Q+I EA+E LK+ IRLP+                
Sbjct: 1364 NTGSNVDKLKQELRKDWE----EQTLQRIEEAKENLKRHIRLPSE--------------- 1404

Query: 1553 XXXXXXXXXXXXSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEE--LKDVPHSS 1610
                                     ++++  +++++ ELE++++K+++E+  L  +   +
Sbjct: 1405 -------------------------EKIQRIIEKRRAELESDFDKRVEEKANLIALADKA 1439

Query: 1611 HISDDE-RDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQL 1669
             +S DE + K+R E+E  + ++   +L+ I+ K+F+EGK+QA MKTTLLERKL+K+ESQ+
Sbjct: 1440 DMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQV 1499

Query: 1670 SETKQSAESPPKSVNNVQNPLLGLPRKIEENSNS------PFNPXXXXXXXXXXXXXXXX 1723
            ++  +S     KS++ +    +  P+  ++N+ +         P                
Sbjct: 1500 AKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDS-- 1557

Query: 1724 XXFNPFTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASR 1768
               NPFTSP+  + L   N      +    P  H+ P+F+    +
Sbjct: 1558 ---NPFTSPT--QELSKSN------SPAALPIVHMAPTFSFTPGK 1591

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  120 bits (301), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 115/482 (23%), Positives = 233/482 (48%), Gaps = 16/482 (3%)

Query: 378 LSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMXXXXXXX 437
           +S     DFI LKK++ K    ++ LQ ++E  I ELE+  P +N+  ++ +        
Sbjct: 290 VSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIN----ELEL 345

Query: 438 XXXXXXHTSNEKNAKVKELNAKNQKLVE----CENDLQTLTKQRLDLCRQIQYLLITNSV 493
                 +TS      +KE+  + + ++      ++ ++TL ++  DL  QIQ++LI+NS+
Sbjct: 346 LLSKEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSI 405

Query: 494 SNDSKGPLRKEEIQFIQNIMQEDDSTITE--SDSQKVVTERLVEFKNIIQLQEKNAELLK 551
            ND  G L + EI+FI+ + ++   T      +SQ ++++RL+ F+++I LQ+KN EL+K
Sbjct: 406 QNDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIK 465

Query: 552 VVRNLADXXXXXXXXXXXXXXXXXXXTVNEAKEAIITLKSEKMDLESRIXXXXXXXXXXX 611
            +R +                      +NEAKE I+ + SE   L+ +I           
Sbjct: 466 TLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANR 525

Query: 612 TSVPNEDASYSNVTI--KQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLY 669
             V +E   + +V    K  TE  R +   + +L+  I + T++++  +S+   ++  LY
Sbjct: 526 -PVSHEKNGHESVLAENKLYTEGDRLI---LDELKNNIPEFTKQASNIISMNFDQLTSLY 581

Query: 670 DSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTH 729
           +   +++    K   SR + +++  LL +  D     N++L++  + +++TI ++D   +
Sbjct: 582 NKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLN 641

Query: 730 ETLNEYVSCKSKLSIVETELLNLKEEQKLRVHXXXXXXXXXXXXSPEKDSLRIMVTQLQT 789
            T+  +V CK+ L  V  ++ +L  +     +              E++ L++ +  ++T
Sbjct: 642 STIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKT 701

Query: 790 LQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIE 849
           +Q + +    E + S   KI++LE   S L K+   K+  ++      N  ++WYQ K +
Sbjct: 702 VQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761

Query: 850 AL 851
             
Sbjct: 762 IF 763

 Score = 37.0 bits (84), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 26/32 (81%)

Query: 1327 EKFNRLRRQAQERLKTSKLSQDSLTEQVNSLR 1358
            ++FNRL++QA  RL +SK  Q++L EQ++SL+
Sbjct: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 160/667 (23%), Positives = 287/667 (43%), Gaps = 128/667 (19%)

Query: 382  SSSDFIF-------LKKQLIKERRTKEHLQNQIETFIVELEHKVPII--NSFKERTDMXX 432
            S++DF F       +K +LIKE+  K  L+ +   F+ ++E K+P +  NS +  T+   
Sbjct: 272  SNNDFEFDINNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETN-NG 330

Query: 433  XXXXXXXXXXXHTSNEKNAKVKELNAKNQ----KLVECENDLQTLTKQRLDLCRQIQYLL 488
                       H S         L  +NQ    KL + E+ ++TL +QR DL  QI YLL
Sbjct: 331  NKIEEQKIIHEHDS---------LKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLL 381

Query: 489  ITNSVSN-DSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNA 547
            IT S  N D+   L + E+ FI+N++ +  +T + +++Q +++ERL++F N+  L  KN 
Sbjct: 382  ITQSYLNEDNNKILTENELNFIRNLVAQPTNTWS-TETQNIISERLLKFSNVSDLTAKNI 440

Query: 548  ELLKVVRNLADXXXXXXXXXXXXXX--XXXXXTVNEAKEAIITLKSEKMDLESRIXXXXX 605
            +L+ +VR L +                     +++EAK+ +I LK E             
Sbjct: 441  KLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEE------------- 487

Query: 606  XXXXXXTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQ------ITRESTENMS 659
                   +V N+D       I Q+   K+ LE ++  L + +++      I RE T    
Sbjct: 488  -------NVKNKD------IINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNL 534

Query: 660  LLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFD-YLQ 718
             L K  Q L +  + +SI++    +   + +E+F LL  +      E  +L+     Y +
Sbjct: 535  ELQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLLIKSY----TELKELKSEISTYTK 590

Query: 719  NTILKQDSKTHETLNEYVS----CK----------SKLSIVETELLNLKEEQK---LRVH 761
            ++++ +D      ++E V     CK          SK   +E E  N+K+E K      +
Sbjct: 591  SSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYN 650

Query: 762  XXXXXXXXXXXXSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKK 821
                        +  K+S+ I     + L KE  + ++   KS + KI            
Sbjct: 651  TFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKI------------ 698

Query: 822  ETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEK 881
                +++ IK L E   S I+WYQ+KI+ +    E  I+++ S                 
Sbjct: 699  --KLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSA--------------- 741

Query: 882  EIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTN 941
               E    L   N +DE      L+K++E     LT++  +    K   +      + T 
Sbjct: 742  ---ESAAMLKNKNEIDE------LKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTE 792

Query: 942  SKLDESFKDF--------TNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKE 993
            +KL E + D            +   + EK SL+++I  +K+++   NNELD  ++  E+ 
Sbjct: 793  NKLREDYCDLEKSKNELEQRLLLLESSEK-SLQEEIVKMKDELMTSNNELDNNQRSQEEL 851

Query: 994  KADFKKR 1000
            + +++K+
Sbjct: 852  RNEYEKQ 858

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 46.6 bits (109), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 46/86 (53%), Gaps = 7/86 (8%)

Query: 1324 EAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKV 1383
            EA +KF+RL+RQA ERL  SK +Q  L++ V SL D +   +  +S+    I  L NA V
Sbjct: 666  EANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALV 725

Query: 1384 AQGNNQLEAIRKLQEDAEKASRELQA 1409
                   EA +KL E+  K   E Q 
Sbjct: 726  -------EAEKKLSEENLKYETERQT 744

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 132/303 (43%), Gaps = 34/303 (11%)

Query: 194 RTELERKTQELTLLQSNNDWLEKELRSKNEQYL------SYRQKTDKVILDIRNELNRLR 247
           + E++R + +  LL++N  WL + L    + YL       Y  K D  + +  N+L  L+
Sbjct: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80

Query: 248 NDFQMERTNNDVLKQKNNXXXXXXXXXXXXIKGLSDSLNSEKQEFSAEMSLK---QRLVD 304
            +F +  ++N+ L  + N            +  + D+LN+EK     E  L    +R   
Sbjct: 81  KEFLI--SHNEKLSDRLNENSIEFNDKFNSV--VIDNLNNEKNLILFEKKLNLLNERYSI 136

Query: 305 LLESQLNAVKEELNSIRELN----TAKVIADDSKKQTPENXXXXXXXXXXXXXXAQCEKE 360
           +++ Q + +  ++N+ + L       K+I  +S  ++ E               ++ EK 
Sbjct: 137 IIKDQKDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSME---------------SKIEKL 181

Query: 361 CLRLSSITDEADEDNENLSAKSS--SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKV 418
              + +  D  + DNEN +  S   +D   LKK L+ E+ +   LQ ++ + ++EL  K+
Sbjct: 182 NAIIHNFIDINEFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKL 241

Query: 419 PIINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRL 478
           P + S KE+                    + ++   ++ + N K+V+ E  L+ L  QR 
Sbjct: 242 PSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQRT 301

Query: 479 DLC 481
           +L 
Sbjct: 302 NLI 304

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 40.0 bits (92), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 51/95 (53%), Gaps = 7/95 (7%)

Query: 161  ENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRS 220
            EN   NS+ +K +  I DL +       ND+NSR +L  K +    ++S N  LEKEL  
Sbjct: 1663 ENAELNSQLEKHKEEIADLNSS-----LNDINSRLDL--KIKNFDSIESKNSDLEKELLK 1715

Query: 221  KNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERT 255
             NE+    ++ + K IL + +++  L  +F+ ERT
Sbjct: 1716 VNEELAHLKESSSKTILSLNDKITSLSEEFEKERT 1750

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 39.7 bits (91), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 99/396 (25%), Positives = 177/396 (44%), Gaps = 83/396 (20%)

Query: 729  HETLNE-YVSCKSKLSIVETELLNLK----EEQKLRVHXXXXXXXXXXXXSPEKDSLRIM 783
            ++ LN  + S K   SI+ETEL N++    E  +LR                 K ++   
Sbjct: 778  YQILNSSHSSLKENFSILETELKNVRDSLDEMTQLRDVLETKDKENQTALLEYKSTIHKQ 837

Query: 784  VTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLE-EDNNSNIE 842
               ++TL+K  E +L + +K  +  I+++   L  L +E    + + K L+ E + SN+ 
Sbjct: 838  EDSIKTLEKGLETILSQ-KKKAEDGINKMGKDLFALSREMQAVEENCKNLQKEKDKSNVN 896

Query: 843  WYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIND 902
             +Q + ++LK+D  + IT + +   ++E+++ +  +L KE E                  
Sbjct: 897  -HQKETKSLKEDIAAKITEIKAINENLEEMKIQCNNLSKEKEH----------------- 938

Query: 903  DSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEK 962
              + KEL               EYK  +    QS     +KL E  K   N  K++  E 
Sbjct: 939  --ISKEL--------------VEYKSRF----QSHDNLVAKLTEKLKSLANNYKDMQAEN 978

Query: 963  TSLEDKISLLKE-------QMFNLNNELD----------LQKKGMEKEKADFKKRISILQ 1005
             SL   I  ++E       Q+ NL N++D          +++  +EK     KK IS L+
Sbjct: 979  ESL---IKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQLKKTISDLE 1035

Query: 1006 NNNKEV----EAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELR 1061
               +E+    ++ K EYES++S ++  L+       TA    ++ + K ++++KT  EL 
Sbjct: 1036 QTKEEIISKSDSSKDEYESQISLLKEKLE-------TATTANDENVNKISELTKTREELE 1088

Query: 1062 EQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKE 1097
             +L  YK      NL +++LE  L+ +EK+    KE
Sbjct: 1089 AELAAYK------NL-KNELETKLETSEKALKEVKE 1117

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 38.1 bits (87), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 138/290 (47%), Gaps = 45/290 (15%)

Query: 809  IDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTD 868
             +EL+   + LKKE  Q +   K L +D N+       K+++L  +Y+SV  + +  + D
Sbjct: 714  FEELQGRCANLKKELVQLELDNKALSDDLNA-------KLDSLSTEYKSVSGNYERLKND 766

Query: 869  IEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKD 928
             E L+ K K +EK +E    RL                 E+ K K NLT A  +I E   
Sbjct: 767  YEFLEGKHKKVEKSLENVSTRLI----------------EITKDKENLTAANKKITET-- 808

Query: 929  LYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNL-NNELDLQ- 986
             + +  + ++   SK++       ++++++T +K   E+ I+ +  ++FNL  N+ D++ 
Sbjct: 809  -FASNKKKIEAYESKIN----TLESKLRDITSKKEQAEEGINKMSRELFNLEKNKEDIES 863

Query: 987  -KKGMEKE--------KADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYAN 1037
             KK +EKE        K + KK  + L    KE++++  E + KL K+Q+ L+     + 
Sbjct: 864  AKKKVEKELNKELENMKNENKKLDNTLAKKEKELQSLDEELQ-KLRKMQSLLETDKDQSA 922

Query: 1038 TAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKE 1087
                 ++ + Q H ++   ++ L ++L +     K +   RD L+  L E
Sbjct: 923  RELTEWKSKFQGHDEL---VTRLTDKLKSLANSFKNIQSERDTLQKHLME 969

>Skud_7.196 Chr7 (350356..352593) [2238 bp, 745 aa] {ON} YGL086W
            (REAL)
          Length = 745

 Score = 37.0 bits (84), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 24/127 (18%)

Query: 1004 LQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1063
            LQNN+ E++A+K +Y+SKLSK+ N             N+++ E    AD S+++      
Sbjct: 152  LQNNDLEMDALKQQYDSKLSKLTNQC-----------NHFKLE----ADSSRSL------ 190

Query: 1064 LHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLL--EQLDLSNSRIEDLSSQNKLLY 1121
            L  Y+ +VK  ++    L++ + E +   SS K S +     + S     +L+  NK+++
Sbjct: 191  LLKYENEVKRQSVDIKDLQHQVMEKDDDLSSLKASKMMNSHPNYSTEEFNELTEMNKMIH 250

Query: 1122 DQIQIYT 1128
            DQ+Q YT
Sbjct: 251  DQVQ-YT 256

>NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {ON}
            Anc_4.46 YLR309C
          Length = 960

 Score = 37.0 bits (84), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 81/213 (38%), Gaps = 63/213 (29%)

Query: 838  NSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMD 897
            N  I  +  ++E LK + E +I+   +KQ+++EK                          
Sbjct: 475  NEEIARWTAQVENLKNENEKIISENKTKQSELEK-------------------------- 508

Query: 898  ETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFT----- 952
               N  +L  E+EK K    DA  ++K+ +         +Q  N++L    +D+      
Sbjct: 509  ---NTAALTDEIEKLKTKYMDASKRLKDNEARMNEALSKIQNENNRLSNQMRDYNSVKTN 565

Query: 953  ------------NQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKK------------ 988
                        NQIK  T+EK   E  I +LK +   L N LDL KK            
Sbjct: 566  VLQKEKTISYLENQIKGYTEEKIKTEKSIDMLKRENGILTNRLDLLKKENQTLHDNVKKN 625

Query: 989  -----GMEKEKADFKKRISILQNNNKEVEAVKS 1016
                    KE     +R+SILQ+    ++ +KS
Sbjct: 626  SNSYENYLKENGKLSERLSILQDKYDALQNIKS 658

>TDEL0B07090 Chr2 complement(1249326..1251647) [2322 bp, 773 aa] {ON}
            Anc_2.616 YKL072W
          Length = 773

 Score = 36.6 bits (83), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 71/153 (46%), Gaps = 18/153 (11%)

Query: 944  LDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISI 1003
            L   ++D T+++  L D+K  +E K +LLK +M  LN+   L  K        F+  + +
Sbjct: 621  LQGVYQDCTSRVGELDDKKQEVETKRTLLKGEMRELNS---LSSK--------FQYDMRV 669

Query: 1004 LQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1063
            ++   ++VE   + +E+KL  +Q  L +  +    A ++    L   A   + ISEL   
Sbjct: 670  IEGRMRDVEDSVNHFEAKLEAVQKSLIENGLGIGMAVDS----LSDKAAFDRCISELVHA 725

Query: 1064 LHT-YKGQVKTLNLSRDQLENALKENEKSWSSQ 1095
             +T Y+G    L +   +    +KE+   W S 
Sbjct: 726  RNTKYEGV--CLKMFSKRFVRDIKEDVSKWGSW 756

>NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {ON}
           Anc_1.162 YKL179C
          Length = 684

 Score = 36.2 bits (82), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 21/91 (23%)

Query: 45  HLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFV 104
           HL+ K L+ N+L+SEN+ ++ SF E + S L KI   K E+++ I+E             
Sbjct: 278 HLHAKELKINQLESENVLLSASF-ERERSELSKI---KDELQDQIKE------------- 320

Query: 105 KFESVENEKMKLSSELEFVKRKLDDLTEEKK 135
               V+NE + + SELE V+RKL++ ++  K
Sbjct: 321 ----VKNESISVKSELETVRRKLNNYSDYNK 347

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score = 35.8 bits (81), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 927 KDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLE---DKISLLKEQMFN--LNN 981
           K++  T    + +++SKL E+ KDF +  K + D     E   ++I+ +K   FN  LNN
Sbjct: 19  KNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78

Query: 982 EL 983
           +L
Sbjct: 79  QL 80

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1755

 Score = 35.4 bits (80), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 93/183 (50%), Gaps = 25/183 (13%)

Query: 932  TTSQSLQQTNSKLDESFKDFTNQIKNLTD--EKTSLEDKISLLKEQMF---NLNNELDLQ 986
            T++ +L +  +KL +S  D   + KN+ D  E   L  ++S  +E +     LN E D  
Sbjct: 1507 TSTSALLEEQTKLKKSISDL--EAKNIKDCGEMEILRKELSKCQESLKVSQRLNEEKDEA 1564

Query: 987  KKGMEKEKADFKKRISILQ----NNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNN 1042
             K  E +    +K I+ L+      N E+   +++ +  ++K++   + +T+  ++AQ  
Sbjct: 1565 NKRTETDIVSLQKEINTLKEELRTKNDEISCFEADKKEMIAKLKELEESKTLLVHSAQEK 1624

Query: 1043 YEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQ 1102
              Q +Q++  +++ I EL+ Q++T+  ++ T              +E+ WSS+K  L++Q
Sbjct: 1625 NAQMIQENTSLAEEIKELKLQVNTWTEKLVT--------------SEQLWSSEKTELIKQ 1670

Query: 1103 LDL 1105
            +D+
Sbjct: 1671 MDI 1673

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
            YMR284W
          Length = 648

 Score = 34.7 bits (78), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 963  TSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKL 1022
            T LED  ++++EQ  N ++        +   K    K++ +  NN+K +E+  +E   KL
Sbjct: 140  TKLEDIFNVVQEQFLNFDS--------LHHSKGFNIKKVFLFTNNDKPIESENNETRKKL 191

Query: 1023 SKIQNDLDQQTIYANT 1038
             ++ NDL++  I+ +T
Sbjct: 192  RRMVNDLNESEIFFST 207

>NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] {ON}
            Anc_4.46 YLR309C
          Length = 920

 Score = 34.3 bits (77), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 122/250 (48%), Gaps = 32/250 (12%)

Query: 777  KDSLRIMVTQLQTLQKEREDL---LEETRKSCQKK---IDELEDALSELKKETSQKDHHI 830
            KDS + ++ ++Q L+ E E +   L +++K+ + K   ++E+ D L ++  E  +    +
Sbjct: 369  KDS-KSLLEEMQALKNEHEKIQAELLDSKKALKSKSVEVEEVRDMLRDVGNELVEAKDQL 427

Query: 831  KQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTD----IEKLQYKVKSLEKEIEED 886
            K   + +   +   +N+IE LKKD E+V+++   K  +    I+ L  ++   +   +E 
Sbjct: 428  KDSSKIDKEELTNARNEIEKLKKDNEAVVSTYRMKHVELTNKIDYLNNELTKFKASSDEQ 487

Query: 887  KIRLH-TYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLD 945
            K +L  + N  ++ IN         K KI  ++  SQ ++Y +L   T Q  ++T + L+
Sbjct: 488  KKQLQESVNNANDIIN---------KLKIENSNITSQFRDYNNLKNATIQK-EKTIAYLE 537

Query: 946  ESFKDFTNQIKNLT-------DEKTSLEDKISLLKEQMFNLNNELDLQKKGME---KEKA 995
            +  K++T     L         E   L +++ LLK++  NL++      +  E   KE  
Sbjct: 538  KQIKEYTEAKDKLNKEIDIQKKENIQLTNRLGLLKKENQNLHDNESKNSQSFENYLKENG 597

Query: 996  DFKKRISILQ 1005
               +R+SILQ
Sbjct: 598  KLSERLSILQ 607

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 33.9 bits (76), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (71%), Gaps = 2/39 (5%)

Query: 447 NEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQ 485
           NEKNAK+ E N  N+KL + E +L+ L  +RL+L R+++
Sbjct: 436 NEKNAKITEKNTINEKLTQVEPELEAL--KRLELERKVE 472

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
            YNL250W
          Length = 1306

 Score = 33.9 bits (76), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 76/164 (46%), Gaps = 32/164 (19%)

Query: 925  EYKDLYETTSQSLQQTNSKLDES---FKDFTNQIKNLTDEKTSL---------------- 965
            E   L +  S +LQQ  SKLD++        NQ++N   EK  L                
Sbjct: 301  ELSSLLDNFSLTLQQQESKLDQTQYEINQLKNQLQNAYIEKDDLIRKEAELTSKRHDYEQ 360

Query: 966  --EDKISLLKE--QMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESK 1021
               D+++L++E  Q F L+   D   + +   + D+KK +        + + VK+E ESK
Sbjct: 361  LKHDRLTLIEEFKQKFPLDLSSDYPTECLRLLR-DYKKTLE------SDAQMVKAEGESK 413

Query: 1022 LSKIQNDLDQQTIYANTAQNN-YEQELQKHADVSKTISELREQL 1064
            L+KI+N + +Q +Y  T QN   E  ++   D+ K I  L  +L
Sbjct: 414  LAKIENHVAEQ-VYEETVQNQKLEYCIRDKTDLKKRIDWLETEL 456

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
            similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 718

 Score = 33.5 bits (75), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 70/313 (22%), Positives = 142/313 (45%), Gaps = 70/313 (22%)

Query: 776  EKDSLRIMVTQLQTLQKEREDLLEE-------TRKSCQKKIDELEDALSELKKETSQKDH 828
            E + L++ V++ QTL  E+   +EE       +  + QK   ELE  +++L   T +K+ 
Sbjct: 367  ENEDLKLSVSKAQTLLAEKTKFIEELQANLRASHDTKQKSTIELEQRINDL---TLEKNE 423

Query: 829  HIKQLEEDNN--SNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEED 886
             +++LE+ +   S IE  +N+I+++K + +    ++   + +  +L+   +SLE E++  
Sbjct: 424  LVRELEDMSTLRSKIEESENEIQSVKTELDRTQVALQHLKEEHSELREHCRSLEAELKTS 483

Query: 887  KIRLHTYN-----VMDETINDDSLRKELEKSKINLTDAY----SQIKEYKDLYETTS--- 934
              +L T N        E +      KEL + K +L D+     + I E+   YE      
Sbjct: 484  HQKLETANDQLAIKSAEVVELGHDVKELRQGKSHLEDSLKLRDASISEWNSKYEEKCAEN 543

Query: 935  -------------------------QSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKI 969
                                     + L Q  + L E+ K  + +IK LT+E +SL+D++
Sbjct: 544  NKLSIEIESFQFKNGNLETEHLVELEQLHQQMTSLQETLKSNSERIKELTEENSSLKDQL 603

Query: 970  SLLK------------EQMFNLNNELDLQKKGMEKEKADFKKRISIL---------QNNN 1008
             + +            EQ+  L+ ++   ++ + +++A+  KR+ +L           + 
Sbjct: 604  EVRELPQPQQGPLVDPEQVEELHAKIQSLEQQLREKEAEAGKRLQLLAEDLYIQYSSKHE 663

Query: 1009 KEVEAVKSEYESK 1021
            ++V+ +K  YESK
Sbjct: 664  QKVKMLKKGYESK 676

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 91/192 (47%), Gaps = 14/192 (7%)

Query: 792 KEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEAL 851
           K  +DL  + R+ C+++I++ +  +S+L+ E  +    +++   D  + +E  + +I++L
Sbjct: 745 KRNDDLTRQIRE-CEEEIEQKQSYMSQLQDEIRKIQDDMEEFNNDKGTKLEKLKKEIDSL 803

Query: 852 KKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRL-HTYNVMDETIND-DSLRKEL 909
            K+   + +  D K    + LQ + + L  EI  D+  L H    +D   N   SL  EL
Sbjct: 804 TKEIGKLDSITDKKYDLYQNLQLETEQLTSEISSDEDALEHMNTSLDNFQNQKKSLIAEL 863

Query: 910 EKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKI 969
           E ++  L D +S++ E K           +    +DE  K+    I    ++K+SLE ++
Sbjct: 864 EHAEHTLADVHSEVDEEK-----------KRLVDIDEELKELNGLIHAKAEKKSSLELEL 912

Query: 970 SLLKEQMFNLNN 981
             LK  +    N
Sbjct: 913 QQLKNDITKFQN 924

>Smik_5.50 Chr5 (72674..75550) [2877 bp, 958 aa] {ON} YEL043W (REAL)
          Length = 958

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 76  KKIDGLKTEMENVIRENDKI---RKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTE 132
           KKI+  + E+  +   N K+   RK    + V   +V+NEK  +S EL  V RKL+D T 
Sbjct: 349 KKIESSQNEISKIEENNKKLNAARKSLITSIVVNANVDNEKPVVSGELSAVLRKLNDFTL 408

Query: 133 EKKETQSN 140
           EK    SN
Sbjct: 409 EKNGFLSN 416

>ZYRO0B08778g Chr2 complement(685232..690220) [4989 bp, 1662 aa] {ON}
            similar to uniprot|P47171 Saccharomyces cerevisiae
            YJR140C HIR3 Transcriptional corepressor
          Length = 1662

 Score = 33.5 bits (75), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 1803 SEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEV 1836
            S ++T   KE EPV   EA E  T +NKRPID+V
Sbjct: 318  SLDNTNDVKEQEPVAEKEAQELDTSTNKRPIDQV 351

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
            YOR195W
          Length = 781

 Score = 33.1 bits (74), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (45%), Gaps = 34/172 (19%)

Query: 944  LDESFKDFTNQIKNLTDEKTSLED-------KISLLKEQMFNLNNELD-LQK-------- 987
            LDE  K+ + Q+ ++T   T LED       +IS LKE++   N EL+ LQK        
Sbjct: 399  LDEELKNVSTQLHDVTTRNTMLEDHNEKLREEISDLKERLTTKNGELERLQKQLDETISA 458

Query: 988  -KGMEKEK-ADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQ 1045
             KG   E  A+  + I+   N   E+EA++   E+  +K+++ L +    +N       Q
Sbjct: 459  GKGANDEVLAELNEVIAQRANLEAELEALRVASEADGNKLRDQLHEAVTRSNLMVLEV-Q 517

Query: 1046 ELQKHAD---------------VSKTISELREQLHTYKGQVKTLNLSRDQLE 1082
            EL+ H+D               +SK I EL +     K ++K L   + +LE
Sbjct: 518  ELKDHSDGLQAGLNARVSEIEQMSKKIEELNDDAEIGKAEIKELQEDKLELE 569

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
            similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 33.1 bits (74), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 93/398 (23%), Positives = 171/398 (42%), Gaps = 75/398 (18%)

Query: 818  ELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVK 877
            EL+++ S    H++ L+  ++  IE  +NK+E LK +  S+  + +    DI   + K  
Sbjct: 696  ELQQQFSAVTKHLESLQTSSSETIEGLENKLEVLKDELRSLKVAKEEYTKDISLSEEKYS 755

Query: 878  SLEKEIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSL 937
             L  +++E   R+    + D+    D L+K   KS   + +  S++ E+KD   +  +SL
Sbjct: 756  ELSNQLDEANKRIR--ELSDKNAKLDDLKKNHLKS---IENNKSRLAEFKDRIISLEKSL 810

Query: 938  QQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADF 997
                               ++T+EK   E+ I+ +  ++F+L+ E  L    M+K K+  
Sbjct: 811  H------------------SITEEKKKAEEGINKMSRELFSLSKEKSLLSTEMDKLKSAS 852

Query: 998  KKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTI 1057
             K  S L     E EA  ++ +++L+ I N  +Q  I               +  +SK +
Sbjct: 853  DKEKSKLSQVVGEREAHIAKMKTELADIFNQKNQLEI--------------SNESLSKEL 898

Query: 1058 SELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQN 1117
            S+++ +  +++  +  L      L    KE E   +S K+ L E    S+  I  L S+ 
Sbjct: 899  SDIKPRFSSHEMLIPKLTEKLKSLATNCKELEIKNNSLKKQLDEARSTSSLEIASLKSE- 957

Query: 1118 KLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISL 1177
                                         + TL  E+ ILD K    E     +++++ L
Sbjct: 958  -----------------------------IETLVAEKSILDQKSNNLEVQLGKIQRELEL 988

Query: 1178 MDVELQDARTKL--DNSRVE------KENHSSIIQQHD 1207
              VE++D++TKL  +NSR+       K+  SSI  + D
Sbjct: 989  AKVEVEDSKTKLSDENSRLHENLKNLKDQLSSITSERD 1026

>ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON}
           similar to uniprot|P39723 Saccharomyces cerevisiae
           YAL047C SPC72 Component of the cytoplasmic Tub4p (gamma-
           tubulin) complex binds spindle pole bodies and links
           them to microtubules has roles in astral microtubule
           formation and stabilization
          Length = 713

 Score = 33.1 bits (74), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 19/89 (21%)

Query: 925 EYKDLYETTSQSLQQTNSKLDESFKDFT--------------NQIKNLTDEKTSLEDKIS 970
           E +DL E   Q L++ NSKLDE+ +                 N+I+ +TDE   L+D+ S
Sbjct: 491 EKQDLLEENDQ-LRRENSKLDEALEKIAQKTEAYQEQRHQLNNKIRTMTDELVGLKDENS 549

Query: 971 LLKEQMFNLNNELDLQKKGMEKEKADFKK 999
            L + +FN+ N      K + K+K++F K
Sbjct: 550 ALHKLVFNVEN----INKTIHKQKSEFTK 574

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.314 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 178,216,836
Number of extensions: 8179134
Number of successful extensions: 74238
Number of sequences better than 10.0: 3398
Number of HSP's gapped: 65345
Number of HSP's successfully gapped: 7581
Length of query: 1875
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1751
Effective length of database: 39,262,815
Effective search space: 68749189065
Effective search space used: 68749189065
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)