Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YKR093W (PTR2)5.698ON60160129240.0
Smik_11.3565.698ON60260128350.0
Suva_11.3295.698ON60160128050.0
NCAS0A032205.698ON61158820570.0
CAGL0G02453g5.698ON59756220470.0
Kpol_529.285.698ON61053520370.0
NDAI0E050205.698ON61959920270.0
KNAG0C065705.698ON59054920230.0
Skud_11.3315.698ON39939719580.0
TPHA0N01960singletonON59149619430.0
ZYRO0G06688g5.698ON61354019240.0
TPHA0O02000singletonON62061219110.0
KAFR0H002405.698ON59153319070.0
TBLA0A091205.698ON63353419100.0
SAKL0E14828g5.698ON59249618950.0
KLLA0E12915g5.698ON65456518840.0
TDEL0B022305.698ON57453718640.0
KAFR0H00230singletonON59659818500.0
TBLA0E01140singletonON61158918360.0
TBLA0B04710singletonON61549217250.0
Kwal_47.16930na 1ON6115035571e-62
KLTH0D16544gna 1ON6265195511e-61
AGL365Cna 2ON5995665394e-60
Ecym_2823na 2ON6135274904e-53
AFR228WsingletonON5764984561e-48
KNAG0K016203.227ON407228742.2
ADL156Cna 3ON483166705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR093W
         (601 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...  1130   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...  1096   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...  1085   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   796   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   793   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   789   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   785   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   783   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   758   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   753   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   745   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   740   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   739   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   740   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   734   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   730   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   722   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      717   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   711   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            669   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   219   1e-62
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   216   1e-61
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   212   4e-60
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   193   4e-53
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   180   1e-48
KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON}              33   2.2  
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    32   5.9  

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/601 (92%), Positives = 555/601 (92%)

Query: 1   MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXX 60
           MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPS      
Sbjct: 1   MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDF 60

Query: 61  XXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120
                  MQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS
Sbjct: 61  EGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240
           GNRDS                   KANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL
Sbjct: 181 GNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360
           GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTTK 600
           CFISGCLFWLCFRKYNDT              FDLNPISAPKANDIEILEPMESLRSTTK
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/601 (88%), Positives = 545/601 (90%)

Query: 1   MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXX 60
           MLNHPS+ SD+ QDEKQGDFPVIEEEKT AVTLKDSYVSDDVANSTE+YNLS S      
Sbjct: 1   MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDF 60

Query: 61  XXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120
                   +TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 
Sbjct: 61  EAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240
           GNRDS                   KAN+SVLIADQLPKRKP IKVLKSGERVIVDSNITL
Sbjct: 181 GNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360
           GDKV+AKSF+VCWILTKNKFDFNAAKPSVHPE+NYPWNDKFVDEIKRALAACKVF+FYPI
Sbjct: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI+FIPIFEKFVYPFIRRYTPLKP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNH+HVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTTK 600
           CFISGCLFWLCFRKYNDT              FDLN ISAPKANDIEILEP ESLRST K
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score = 1085 bits (2805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/601 (87%), Positives = 542/601 (90%)

Query: 1   MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXX 60
           MLNH SQGSDD QDEKQG+FPV+EEEK Q VTLKDSYVSDD ANSTER+NLSPS      
Sbjct: 1   MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF 60

Query: 61  XXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120
                  +++LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPND+PKG+LS
Sbjct: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNS GATGLSYFFQFWCYVTPVFGGY+ADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240
           GNRDS                   KANLSVLIADQLPKRKP IKVLKSGERVI D NITL
Sbjct: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFW+AVVTL+FGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360
           GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEK+YPWNDKFVDEIKRALAACKVF+FYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKF YPFIRRYTP KP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY+EPLGHNTPNHVHVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPA+MKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTTK 600
           CFISGCLFWLCFRKYNDT              FDLNPIS PKANDIEILEPM SL+STTK
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKSTTK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/588 (64%), Positives = 449/588 (76%), Gaps = 4/588 (0%)

Query: 3   NHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSY-VSDDVANSTERYNLSPSXXXXXXX 61
            H   G+D   +++  D     +EKTQ +TLK++   S++V +  E Y++          
Sbjct: 6   EHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGY 65

Query: 62  XX-XXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120
                  M+TLRHV GKIP+RCWLIA+VEL+ERFSYYGLSAPFQNYME GPND+P GVL 
Sbjct: 66  EIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLE 125

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNS GATGLSYFFQFWCYVTPVFGG++ADT+WGKYNTIC GT IY+AGIFILFITSIPS+
Sbjct: 126 LNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSI 185

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240
            ++D+                   KANLSVLIADQLPKRKP +K LKSGERV+ D NITL
Sbjct: 186 ASKDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITL 245

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFM+FY M+NVGSLS++ATTELE HK FWAA+LLPFCFFWIAVV L+ G+ QY++   
Sbjct: 246 QNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGK 305

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360
            +K I KSFK+ WI++KNKFD  +AKPS HPEKNYPW DKFVDE  RAL+ACKVF+FYPI
Sbjct: 306 REKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPI 365

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420
           YW  YGTMIS+F+TQ SMMELHG+PND  QA DS ALIIFIPI E+F+YPFIRR+TP KP
Sbjct: 366 YWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKP 425

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMF + AM W+ VLQSF+YKAGP+Y+ PL    PN +HV WQ+PAYVLI+FSE
Sbjct: 426 ITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSE 485

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           I ASITGLEYAYSKAP SMKSFIMS+FL +NA GS +G ALSPV+VDPKFTWLF GL VA
Sbjct: 486 ILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVA 545

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEI 588
           CFI GC+FW+ FRKYNDT               DL  + +  AND+E+
Sbjct: 546 CFIGGCIFWIIFRKYNDTEEEMNAMDYEDEE--DLREMESAGANDLEL 591

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/562 (67%), Positives = 444/562 (79%), Gaps = 8/562 (1%)

Query: 1   MLNHPSQGSDDAQD-EKQGDFPVIEEEKTQAV-TLKDS---YVSDDVANSTERYNLSPSX 55
           MLN  S+ +D+    E Q D   I++  ++ V  ++D    ++  D +N+   + L    
Sbjct: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDD 60

Query: 56  XXXXXXXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSP 115
                       ++TLRHV G IP+RCWLIAIVELSERFSYYGLSAPFQNYM+ GPND+P
Sbjct: 61  DFEAPTEEE---LKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNP 117

Query: 116 KGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175
           KG+L L SQGATGLSYFFQFWCYVTPVFGG+V+DT+WGKYNTIC GT IY+ GIFILFIT
Sbjct: 118 KGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFIT 177

Query: 176 SIPSVGNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVD 235
           SIP V N D                    K+NLSVLIADQLP +KP + + K GERVI D
Sbjct: 178 SIPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIED 237

Query: 236 SNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQY 295
            N+TLQNVFMFFYF INVGSLS+MATTELEYHKGFWAAYLLPFCFFW+AV  L+FG+ QY
Sbjct: 238 PNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQY 297

Query: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVF 355
           I+ P+GDKVI+KSFKV +IL+KNKF+  AAKPS +P+KN+PW+DKFVDEIKRAL ACKVF
Sbjct: 298 IKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVF 357

Query: 356 IFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRY 415
           +FYP+YW  YGTM+++F+TQ   MELH +PNDFLQAFDSIALIIFIPIFE+FVYPFIRRY
Sbjct: 358 VFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY 417

Query: 416 TPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVL 475
           TPL+PITKIFFGFM GS AM WAAVLQ F+Y  GPWY+ PL H+TPNH+HV WQIPAYVL
Sbjct: 418 TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVL 477

Query: 476 ISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFT 535
           I+ SEIFASITGLEYAYSKAP SMKSFIMSIFLLTNAFGSAIGCALSPV+VDPKF W +T
Sbjct: 478 IAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYT 537

Query: 536 GLAVACFISGCLFWLCFRKYND 557
           GLA ACFI+G +FW  +   ND
Sbjct: 538 GLACACFIAGWVFWFIYSGLND 559

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/535 (68%), Positives = 433/535 (80%), Gaps = 6/535 (1%)

Query: 68  MQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGAT 127
           M+TL+HV GKIPMRCWLIA+VELSERFSYYGL+APFQNYM  GPND+PKGVL L++QGA+
Sbjct: 73  MKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGAS 132

Query: 128 GLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXX 187
            LSYFFQFWCY+TP+FGGY+ADT+WGKYNTIC GT IY+ GIF+LFITS+PS+  R++  
Sbjct: 133 ALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETAL 192

Query: 188 XXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFF 247
                            KAN+SVLIA+Q+P+ KP +   K G+RVI D NIT QNVFMFF
Sbjct: 193 GGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFF 252

Query: 248 YFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAK 307
           Y MINVGSLSLMATTELE HKGFWAAYLLPFCFFWIAVV L+ G+ QYI  P+GDK+I+K
Sbjct: 253 YMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISK 312

Query: 308 SFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGT 367
           SFKV WIL KNK +F+AAKPS++PEKNYPWNDKFV+EI+RAL ACKVF+FYPIYW  YG 
Sbjct: 313 SFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQ 372

Query: 368 MISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFG 427
           MI++F+TQA  MELH +PNDFLQAFDSIA+I+FIPIFE+F+YPF+RR+TP +PITKIF+G
Sbjct: 373 MINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWG 432

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHVCWQIPAYVLISFSEIF 482
           FMFGS AM WAAVLQSF+YKAGP YN P+       NTPN VHV WQ+PAYVLI+ SEI 
Sbjct: 433 FMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEIL 492

Query: 483 ASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACF 542
           AS+TGLEYAYS APASMKSFIMSIFL+TNAFGSAIG A+SP   DPK+TW FTGLAVACF
Sbjct: 493 ASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACF 552

Query: 543 ISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRS 597
           I+GCLFW+CFR YN+T                + P +  K + IE++EP+ S RS
Sbjct: 553 IAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTS-IEVMEPITSFRS 606

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/599 (63%), Positives = 442/599 (73%), Gaps = 16/599 (2%)

Query: 2   LNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXX- 60
           +N P       +DEK  +    ++E     +  +  + D      E YNLS S       
Sbjct: 8   INTPEIRDIVLKDEKIEEITTTKKETNATTSSTEEKLHD-----VETYNLSNSANDSTND 62

Query: 61  ----------XXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYG 110
                            + TL+ VGGKIP+RCWLI +VEL+ERFSYYGLSAPFQNYM+ G
Sbjct: 63  FDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNG 122

Query: 111 PNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIF 170
           PNDSPKGVL LNS GATGLSYFFQFWCYVTPVFGG+VADT+WGKYN+I  GT  YI GIF
Sbjct: 123 PNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIF 182

Query: 171 ILFITSIPSVGNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGE 230
           ILFIT+IPS+ ++++                   KANLSVLIADQLPKRKP +K+LKSGE
Sbjct: 183 ILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGE 242

Query: 231 RVIVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIF 290
           RVI D NITLQNVFM FY MIN+GS+S+MATTELE HKGFWAAYLLPFCFFWIAVV L+F
Sbjct: 243 RVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVF 302

Query: 291 GKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALA 350
           G+K Y++  +GD V+ KSFKVCWI+ KNK D+NAAKPS HPE+NYPWND+FVDE+KR +A
Sbjct: 303 GRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIA 362

Query: 351 ACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYP 410
           ACKVF+FYPIYW QYG+MIS+F+TQ S MELHGIPNDFLQ FDSIALIIFIPIFE FVYP
Sbjct: 363 ACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYP 422

Query: 411 FIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQI 470
           FIRR+TP++PITKI  GF  G  AMTWAAVLQ F+Y  GP Y+ PL  +TPN +HV WQI
Sbjct: 423 FIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQI 482

Query: 471 PAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKF 530
           PAYVLI+FSEIFASITGLEYAYSKAP SMKSF+MSIFLLTNAFGS +G ALS VTVDPKF
Sbjct: 483 PAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKF 542

Query: 531 TWLFTGLAVACFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEIL 589
            WLF GLAV+C ++G LFWLCFR  N T                     +  A+D+EIL
Sbjct: 543 VWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEIL 601

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/549 (67%), Positives = 440/549 (80%), Gaps = 8/549 (1%)

Query: 9   SDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXXXXXXXXXM 68
           S+D   +K+ D  V+ +E +  +  +DS + DD+A+  E                    +
Sbjct: 10  SEDDSLDKKNDL-VLTKENSHTIE-EDSRIVDDLASQYE------DDIPEGYEVPTEEEL 61

Query: 69  QTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATG 128
           +TL+HVGG IPMRCWLIA+VELSERFSYYGLSAPFQNYM  GP+D P G+L LNS GATG
Sbjct: 62  RTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATG 121

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           LSYFFQFWCYVTP+FGGY+ADT WGKYNTI  GT IYI GIFILF+TSIPS+  +++   
Sbjct: 122 LSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLG 181

Query: 189 XXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFY 248
                           K+NLSVLIADQLPKRKP +K  K+GERVI D+N+TLQNVFMFFY
Sbjct: 182 GFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFY 241

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKS 308
            MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFWIAVV L+ GK QY++ PIGDKVI+K 
Sbjct: 242 LMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKC 301

Query: 309 FKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTM 368
           FKV WILTKN+F+F+A KPS++P KNYPW+DKFVDEI+RAL ACKVF+FYPIYWT YG M
Sbjct: 302 FKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQM 361

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
           +S F+TQ SMMELHG+PNDF Q  DSIA+I+FIP+ E  +YPFIR+YTP +PITKI+FGF
Sbjct: 362 MSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGF 421

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGL 488
           MF S  M WAAVLQS++YKAGP Y  PL H+ PN +HV  Q+PAYVL++FSEIFASITGL
Sbjct: 422 MFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGL 481

Query: 489 EYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548
           EYAYSKAPASMKSFIMSIFL+TNAFGSAIGCALSPV+ DP +TWL+TGLAVACFISGCLF
Sbjct: 482 EYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLF 541

Query: 549 WLCFRKYND 557
           W+CFRKYND
Sbjct: 542 WVCFRKYND 550

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/397 (92%), Positives = 375/397 (94%)

Query: 205 KANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTEL 264
           KANLSVLIADQLPKRKPSIKVLKSGERV++D NITLQNVFMFFYFMINVGSLSLMATTEL
Sbjct: 3   KANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTEL 62

Query: 265 EYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNA 324
           EYHKGFWAAYLLPFCFFWIAVVTLI GKKQYIQRPIGDKVIAKSF+VCWIL KNKFDFNA
Sbjct: 63  EYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFNA 122

Query: 325 AKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 384
           AKPS+HPE++YPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI
Sbjct: 123 AKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 182

Query: 385 PNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSF 444
           PNDFLQAFDSIALIIFIPIFEKF+YPFIRRYTP KPITKIFFGFMFGSFAMTWAAVLQSF
Sbjct: 183 PNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 242

Query: 445 VYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM 504
           +YKAGPWY+EPLGHNTPN VHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM
Sbjct: 243 IYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM 302

Query: 505 SIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTXXXXXX 564
           SIFLLT AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW CFRKYNDT      
Sbjct: 303 SIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMNA 362

Query: 565 XXXXXXXXFDLNPISAPKANDIEILEPMESLRSTTKY 601
                   FDLNPISAPKANDIEILEPMESLRST KY
Sbjct: 363 MDYEEEDEFDLNPISAPKANDIEILEPMESLRSTAKY 399

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/496 (69%), Positives = 413/496 (83%), Gaps = 5/496 (1%)

Query: 68  MQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGAT 127
           ++TLRHV G IP+RCWLIAIVEL+ERFSYYGLSAPFQNYM  GPND+PKG+L LNS GAT
Sbjct: 62  LKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLNSSGAT 121

Query: 128 GLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXX 187
            +SYFFQFWCYVTP+FGGY+ADT WGKYNTIC GT IY++GIFILF+TSI S+  +++  
Sbjct: 122 AISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITTQNAAR 181

Query: 188 XXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFF 247
                            K+N+SVLIA+Q+PKRK  +     GERVI D  +T+QN+FMFF
Sbjct: 182 GGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQNIFMFF 241

Query: 248 YFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAK 307
           Y MIN+GSLS++ATTELE HKGFWAAYLLPFCFFWIAVV LI GKKQY+++P+GDKVI+K
Sbjct: 242 YLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGDKVISK 301

Query: 308 SFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGT 367
            F + WI  KNK DF++AKPS HPE NYPW DKFV+E++RA+ ACKVF+FYPIYW  YG 
Sbjct: 302 CFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYWCVYGQ 361

Query: 368 MISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFG 427
           M+++F+TQA  MELHG+PNDFLQA DSIA+I+FIPI EKF+YPFIR++TP + ITKIF+G
Sbjct: 362 MLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSITKIFWG 421

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHVCWQIPAYVLISFSEIF 482
           FMFGS AM WAAVLQSF+YKAGP +++PL       +TPN VH+ WQ+PAYVLI+FSEIF
Sbjct: 422 FMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIAFSEIF 481

Query: 483 ASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACF 542
           ASITGLEYAYS AP SMKSFIMSIFLLT AFGSA+G A+SP +VDPKFTW FTGLAV+CF
Sbjct: 482 ASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGLAVSCF 541

Query: 543 ISGCLFWLCFRKYNDT 558
           I+GCLFW+CFRKYN+T
Sbjct: 542 IAGCLFWICFRKYNNT 557

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/540 (66%), Positives = 420/540 (77%), Gaps = 4/540 (0%)

Query: 21  PVIEEEKTQAVTLKDSYVSDDVANSTERYNLS-PSXXXXXXXXXXXXXMQTLRHVGGKIP 79
           P I   +   V ++D   S +V+ S ER  L                 +++LRHVGG IP
Sbjct: 6   PSITGPEKNKVIIEDK--SLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIP 63

Query: 80  MRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYV 139
            RCWLIAIVELSERFSYYGLSAPFQNYM+ G +D+P GVL L SQGATGL+YFFQFWCYV
Sbjct: 64  FRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYV 123

Query: 140 TPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXXXXXXXXXXXX 199
           TPVFGG++ADT+WGKY TIC GT +Y+ GIFILFITS+PSV ++++              
Sbjct: 124 TPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGI 183

Query: 200 XXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLM 259
                KANLSVLIADQ PKRKP IK  K GERVI D NIT+QNVFMFFY MIN+GSLS++
Sbjct: 184 ATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVI 243

Query: 260 ATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNK 319
           ATTELE HKGFWAAYLLPFCFFWIAV+ L  G+K Y++ P+GDKVIAKSF+V   L K++
Sbjct: 244 ATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHR 303

Query: 320 FDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMM 379
           FD+ A KPSVHPE++YPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++    M
Sbjct: 304 FDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEM 363

Query: 380 ELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAA 439
           +LHG+PNDF QA DSIALI+FIPI E ++YPFIRRYTP KPITKIFFGFM+ S +M WAA
Sbjct: 364 QLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAA 423

Query: 440 VLQSFVYKAGPWYNEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPAS 498
           VLQ F+YK GP Y+ P+   N PN++H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP S
Sbjct: 424 VLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTS 483

Query: 499 MKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDT 558
           MKSFIMSIFLLTNAFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFWL F   NDT
Sbjct: 484 MKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDT 543

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/612 (59%), Positives = 440/612 (71%), Gaps = 27/612 (4%)

Query: 3   NHPSQGSDDA--QDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLS-------- 52
           +HPS+   DA    EK+ D        +  VT     + D V N T    L         
Sbjct: 15  SHPSEYKYDAIYSGEKELD-------SSHDVTFN---IDDKVENDTNEEELDEFAVDDEA 64

Query: 53  -PSXXXXXXXXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGP 111
            P              M TL+HV G IP RCWLIA+VELSERFSYYGLSAPFQNYM  GP
Sbjct: 65  DPYNDEWGYVEPTEEEMATLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGP 124

Query: 112 NDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFI 171
           ND+PKG+L LN+ GATGLSYFFQFWCY+TP+FGGY+ADT+W KYNTI  GT IYI GIFI
Sbjct: 125 NDTPKGILQLNTNGATGLSYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFI 184

Query: 172 LFITSIPSVGNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGER 231
           LFIT+IPS+  +++                   KANLSVL+A+Q+PKRK  +   K GER
Sbjct: 185 LFITAIPSIATKETATGGFVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGER 244

Query: 232 VIVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFG 291
           VI D +IT+QNVFMFFY MIN+G+LS++ATTELE HKGFWAAYLLPFCFFWIAVV L+ G
Sbjct: 245 VIEDPDITMQNVFMFFYLMINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMG 304

Query: 292 KKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAA 351
           +  YI +P+GDKVI+K FKV +I+ KNKF+F++AKPS++PE  YPW+DKFVDEI R++ A
Sbjct: 305 RNSYIIKPVGDKVISKCFKVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKA 364

Query: 352 CKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPF 411
           CKVFIFYPIYW  YG MI++FITQA  MELH IPNDFLQ FDSI +I+FIPIFE+FVYP 
Sbjct: 365 CKVFIFYPIYWCVYGQMINNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPT 424

Query: 412 IRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHV 466
           IRR+TPLKPITKIF GFM GS AM WAAVLQSF+YKAGP Y+ P+       N PN VHV
Sbjct: 425 IRRFTPLKPITKIFLGFMCGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHV 484

Query: 467 CWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTV 526
            WQIPAYV+I++SEIFAS+TGLE+AYS AP SMK+FIMSIFL TNA G+A+G A+SP +V
Sbjct: 485 AWQIPAYVIIAWSEIFASVTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSV 544

Query: 527 DPKFTWLFTGLAVACFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLN-PISAPKAND 585
           DPK+TW+FTGLAV+CF++GCLFW+CF  YND                + +  +    ++ 
Sbjct: 545 DPKYTWVFTGLAVSCFVAGCLFWICFHHYNDIDADMKAIDFVEDDMINASGDVEKTASSG 604

Query: 586 IEILEPMESLRS 597
              +EP+ S+RS
Sbjct: 605 FSTVEPIISMRS 616

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/533 (65%), Positives = 416/533 (78%), Gaps = 11/533 (2%)

Query: 24  EEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXXXXXXXXXMQTLRHVGGKIPMRCW 83
           E + T+A TL+D  +  D  +  E     P+             M+TLR VGG+IP RC+
Sbjct: 36  EHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDE----------MKTLRRVGGRIPFRCF 85

Query: 84  LIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVF 143
           L+A+VEL+ERFSYYGLSAPFQNYM+ GP DSP GVL LNS GATGLSYFFQFWCY+TP+F
Sbjct: 86  LVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIF 145

Query: 144 GGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXXXXXXXXXXXXXXXX 203
           GGY+ADT WG+YNTI  GT IYI GIFILFITS  +V  RD                   
Sbjct: 146 GGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFATGL 205

Query: 204 XKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTE 263
            K+NLSVLIADQ+P ++P +K LKSGERVI D ++T+QNVFMFFY MIN+GSLS++ATTE
Sbjct: 206 IKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTE 265

Query: 264 LEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFN 323
           LE + GFWAAYLLPFCFFWIAV+ ++ GK+QYI +P GD+VIAKSFKVCWIL KNKFD  
Sbjct: 266 LELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDIT 325

Query: 324 AAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 383
           +AKPS HPE  +PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+LHG
Sbjct: 326 SAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHG 385

Query: 384 IPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQS 443
           +PND  QA +SI+LIIFIPI EKF+YPFIRR+TPL+P+T+IF GF+F + AM W+ VLQ 
Sbjct: 386 LPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQH 445

Query: 444 FVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 503
           F+Y  GP YN PL     N +HV WQ+PAYV I+FSEIFASITGLEYAYSKAPA+MKSFI
Sbjct: 446 FIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFI 504

Query: 504 MSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYN 556
           M++FL  NAFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FWLCFRKYN
Sbjct: 505 MALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYN 557

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/534 (64%), Positives = 423/534 (79%), Gaps = 5/534 (0%)

Query: 68  MQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGAT 127
           ++TL+HVGGKIP+RCWL+A++EL+ERFSYYGLSAPFQNYM+ GPNDSP G LSL+S GAT
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 128 GLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXX 187
           GLSYFFQFWCY+TPVF GY+ADT+WGK+ TIC GT IYI GIFILFITS+PS+ + ++  
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 188 XXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFF 247
                            KANLSV+IA+Q+PKRK  +   K+G RVI D +IT+QNVFM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 248 YFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAK 307
           YFMIN+GSLS++ATTELE HKGFWAAYLLPFCFFW+AV+ LI G K YI+ P+GDKVI+K
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 308 SFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGT 367
            FKV  IL +N+F+ ++AKP+ +P+KNYPW+DKFVDEI RAL ACKVF+FYPIYW  YG 
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 368 MISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFG 427
           M+++F++Q   MELHG+PNDF QA DSIALI+FIPI E+FVYPFIR+YTP KPITKIF+G
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASIT 486
           F FG+ +MTWA VLQ F+YKA P Y+ P    N PNH+HV  Q+PAY L++ SEIFASIT
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASIT 507

Query: 487 GLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGC 546
           GLEYAYSKAPASMK+FIMSIFL+TNAFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GC
Sbjct: 508 GLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGC 567

Query: 547 LFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTTK 600
           LFW+ F+KYND                  + +    A DIE+++P+ S RS+ K
Sbjct: 568 LFWIIFKKYNDMEEELNNLDFEEGD----DMLETKHAGDIEMIQPISSRRSSLK 617

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/496 (69%), Positives = 417/496 (84%), Gaps = 5/496 (1%)

Query: 68  MQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGAT 127
           M+TLRHV  +IP+RCWL+A+VEL+ERFSYYGLSAPFQNYM+ GPND+PKG+L+L +QGAT
Sbjct: 59  MKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGAT 118

Query: 128 GLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXX 187
            LSYFFQFWCYV+P+ GG+VADT+WGKY TIC GT IY+ GIFILFITS+PS+    +  
Sbjct: 119 ALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASL 178

Query: 188 XXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFF 247
                            KAN+SVLIADQ+PK +P++KVLKSGERVI D NIT+QN+FMFF
Sbjct: 179 GGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFF 238

Query: 248 YFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAK 307
           Y MIN+GSLS++ATTE+E H GFWAAYLLPFCFF++AV  LI G+ QY++ P+GDKVI+K
Sbjct: 239 YLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISK 298

Query: 308 SFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGT 367
           SFKVCWI+ +NKF F+AA+PS++PE  YPW+DKF+DEIKRA+AACKVF+FYPIYW  YG 
Sbjct: 299 SFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQ 358

Query: 368 MISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFG 427
           M+S+F++QA MMELHG+PNDFLQA DSIALI+FIPI E+F+YPFIRR+TP +PITKIF+G
Sbjct: 359 MLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYG 418

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHVCWQIPAYVLISFSEIF 482
           F+FG+ AM WAAVLQ F+YKAGP Y  P+       NTPN +H+ WQ+PAYVLI+FSEIF
Sbjct: 419 FIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIF 478

Query: 483 ASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACF 542
           ASITGLEYAYSKAP SM+SFIMSIFLLT AFGSA+G ALS V+V+PKF W F+GLAV+CF
Sbjct: 479 ASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCF 538

Query: 543 ISGCLFWLCFRKYNDT 558
           I+GCLFW  F KYNDT
Sbjct: 539 IAGCLFWAFFHKYNDT 554

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/565 (62%), Positives = 423/565 (74%), Gaps = 15/565 (2%)

Query: 2   LNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNL-----SPSXX 56
           LN  S  S D  DE  G+    ++EK +  T    Y+S D   S+++ +           
Sbjct: 36  LNVDSTVSSD--DEFTGE---KKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQ 90

Query: 57  XXXXXXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPK 116
                      + TLRHV  +IP  CWLIAIVEL+ERFSYYGLSAPFQNYM+ GPND+PK
Sbjct: 91  NENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPK 150

Query: 117 GVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITS 176
           GVL L SQGAT LSYFFQFWCYVTP+ GGY+ADTFWGKYNTIC G + Y+ GI ILF+T+
Sbjct: 151 GVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTA 210

Query: 177 IPSVGNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDS 236
           IPS+ +++S                   KANLSVLIADQ+PK +P IKVLK+GE+VI D 
Sbjct: 211 IPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDP 270

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYI 296
           N+T+QNVFMFFY MIN+GSLS+MATT LE   GFWAAYLL FCFFW+ +V L+FG+K+Y+
Sbjct: 271 NVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYV 330

Query: 297 QRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFI 356
           +RPIGD VIA+ FK+CWI   N F+ N A PS++PEK YPWND F+DEI+RA  ACKVF 
Sbjct: 331 RRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFA 390

Query: 357 FYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYT 416
           FYPIYW  YG M+++F+TQA  MELHG+PNDFLQA +SIALI+FIPI E+F+YPFIRR+T
Sbjct: 391 FYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFT 450

Query: 417 PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHVCWQIP 471
           P +P+TKIF GF FGS AM +AAVLQ F+YKAGP Y+ P+       NTPN VH+ WQ+P
Sbjct: 451 PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVP 510

Query: 472 AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFT 531
           AYVLIS SEIFASITGLEYAYSKAPA+MK+FIMSIFL+TNA GSA+G ALSP   +PK+ 
Sbjct: 511 AYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYV 570

Query: 532 WLFTGLAVACFISGCLFWLCFRKYN 556
           W F+GLAVACFI+GCLFWLCF  YN
Sbjct: 571 WTFSGLAVACFIAGCLFWLCFHHYN 595

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/537 (62%), Positives = 415/537 (77%), Gaps = 14/537 (2%)

Query: 26  EKTQAVTLKDSYVSDDVAN----STERYNLSPSXXXXXXXXXXXXXMQTLRHVGGKIPMR 81
           EK +AV + D  + + +++      E Y+  P+             M+TL+HV G IP R
Sbjct: 16  EKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEE----------MKTLKHVAGTIPFR 65

Query: 82  CWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTP 141
           CWLIA+VELSERF+YYGLS PFQNYM+ GP+D+P G+L+L SQGATGLSYFFQFWCYVTP
Sbjct: 66  CWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTP 125

Query: 142 VFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXXXXXXXXXXXXXX 201
           +FGG+++DT+ GKYNTIC GT +Y+ GI ILF+TSIPS+  +++                
Sbjct: 126 IFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIILIGIAT 185

Query: 202 XXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMAT 261
              K+N+SVLIADQ PK++  +   K G RVI D NITLQNVFM FY MIN+GSLS++AT
Sbjct: 186 GMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIAT 245

Query: 262 TELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFD 321
           TELE H GFWAAYLLPFCFFWIAV+ L  GK  Y++ P+GDKVI+K FKV  I  KNKF+
Sbjct: 246 TELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFN 305

Query: 322 FNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMEL 381
           F AAKPSV P++ +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MEL
Sbjct: 306 FEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMEL 365

Query: 382 HGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVL 441
           HG+PNDF QA DSIALI+FIPI E F+YP+IR++TP +PITKIF+GFMFG+ AM WAAVL
Sbjct: 366 HGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVL 425

Query: 442 QSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 501
           Q F+YK+GPWY  P+  NTPNH+H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKS
Sbjct: 426 QHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKS 485

Query: 502 FIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDT 558
           FIM+IFLLTNAFGSAIGCALSPVT DP + WL+ GL VACF +G LFW CF+ YNDT
Sbjct: 486 FIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDT 542

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/598 (58%), Positives = 420/598 (70%), Gaps = 16/598 (2%)

Query: 9   SDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLS---------PSXXXXX 59
           S     E+     VI +EK      K +  S+D    TE Y L          P      
Sbjct: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61

Query: 60  XXXXXXXXMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119
                   ++TLRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+DSP GVL
Sbjct: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121

Query: 120 SLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179
            LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181

Query: 180 VGNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNIT 239
           +  ++                    KANLSVLIADQ+P ++P +K LKSGERVI D +IT
Sbjct: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241

Query: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299
           +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L+ G++ Y  +P
Sbjct: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301

Query: 300 IGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYP 359
             D+VI KSFK CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361

Query: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLK 419
           IYWT YG M ++F+T  SM++LHG+PND  QA DSIALI+FIPI EKF YPFIRR+TP +
Sbjct: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421

Query: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFS 479
           PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN+VHV WQ+PAYVLI+FS
Sbjct: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 480

Query: 480 EIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539
           EIFASITGLEYAYSKAPASMKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540

Query: 540 ACFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRS 597
             FI+GC FW CFR YND               ++   I      DIE++ P+ +  S
Sbjct: 541 TAFITGCAFWFCFRHYNDI------EDEMNALNYEDEDIITENNQDIEMVHPLSAYTS 592

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/589 (60%), Positives = 425/589 (72%), Gaps = 14/589 (2%)

Query: 11  DAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXXXXX-XXXXMQ 69
           D +D+K  +F   +E  + A T+ +        ++ E YN S                M+
Sbjct: 24  DNKDDKNYNFITEDEPNSIASTIIEG------NSNEENYNRSTDDDDDEDFIEPTEEEMR 77

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGL 129
           TL+ VGG IP RCWL+A++ELSERFSYYGLSAPFQNYM+ GP D+P G LSLN+QGATGL
Sbjct: 78  TLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGL 137

Query: 130 SYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXX 189
           SYFFQFWCY+TP+FGGY+ADT+WGKYNTI  G   YI GIFILF+TS+P + +  +    
Sbjct: 138 SYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGG 197

Query: 190 XXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYF 249
                          KANLSV+IA+Q+PKRK  I   K G RVI D +ITLQNVFM FYF
Sbjct: 198 FIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYF 257

Query: 250 MINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSF 309
           MINVGSLS+MATTELE  KGFWAAYLLPFCFFW+AVV L+ G K++I+ PIGDK I+KSF
Sbjct: 258 MINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSF 317

Query: 310 KVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMI 369
           KV  IL KNKF++ +AKPS+HPE NYPW DKFV+EI+RA+ AC VF FYPIYW  YG M+
Sbjct: 318 KVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQML 377

Query: 370 SSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFM 429
           ++F+TQ   MELH +PNDFLQ  DSIALI+FIPI E+ +YPF+RR+TPL+PITKI  GF 
Sbjct: 378 NNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFF 437

Query: 430 FGSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGL 488
           FGSF+M WAAVLQ FVY+  P Y  P    N PNH+HVCWQ+PAY LI+ SEIFASITGL
Sbjct: 438 FGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGL 497

Query: 489 EYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548
           EYAYSKAPASMKSFIMSIFL T A GSA+G ALSPV++DPKFTW + GLAV+CFI+G  F
Sbjct: 498 EYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAF 557

Query: 549 WLCFRKYNDTXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRS 597
           WLCF +YND                D+  IS+   ND   LE   S+RS
Sbjct: 558 WLCFSRYNDEEDELNNIDDQP----DVIQISSENEND--DLEAKNSIRS 600

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 396/492 (80%), Gaps = 2/492 (0%)

Query: 68  MQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGAT 127
           ++TL    G IP  CWL+AI+EL+ERFSYYGLSAPFQNYM+  P+D+P G LSLNS GAT
Sbjct: 72  LKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGAT 131

Query: 128 GLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXX 187
           GLSYFFQFWCYVTP+F G++ADT+WGK+NT+C GT IYI GIFILFITS+P++ + ++  
Sbjct: 132 GLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTAL 191

Query: 188 XXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLK-SGERVIVDSNITLQNVFMF 246
                            KANLSV+IADQLPK+K  +   K SG+RVI D  +T+QNVFM 
Sbjct: 192 GGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMA 251

Query: 247 FYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIA 306
           FYFMINVGSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L FG ++++++PIGD+VI+
Sbjct: 252 FYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVIS 311

Query: 307 KSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYG 366
           K F +  IL KN F+F  AKP+ +PEKNYPW+DKFVDEI+R+L ACKVF+FYPIYW  YG
Sbjct: 312 KCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYG 371

Query: 367 TMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFF 426
            M+++F+TQ S M+LHG+PNDF QA +SIALI+FIPI EKFVYPFIR++TPLKPITK+  
Sbjct: 372 QMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTI 431

Query: 427 GFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASI 485
           GF+FGS AM WAAVLQ F+Y+AGP Y+ P+   N PNHVHV WQ+PAY LIS SEIFASI
Sbjct: 432 GFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASI 491

Query: 486 TGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISG 545
           TGLE AYSKAP SMKSFIMS+FL+TNAFG+AIGCALS V+ DPK+ WL+TGLAV CF +G
Sbjct: 492 TGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAG 551

Query: 546 CLFWLCFRKYND 557
             FW  F+ YND
Sbjct: 552 IAFWFTFKHYND 563

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  219 bits (557), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 149/503 (29%), Positives = 234/503 (46%), Gaps = 36/503 (7%)

Query: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYME-------------YGPNDSPKG 117
           LR V G      + I ++E SER SYYG      N+++                +++  G
Sbjct: 40  LRRVLGHPKWYVYFICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAG 99

Query: 118 VLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            L +  Q AT L+    F  Y  P+  GYVAD +WG+   +  G  + I    +  I S+
Sbjct: 100 ALGMGLQVATALNLLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSL 159

Query: 178 PSV-GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDS 236
           P V G+  +                   K  L   +  Q P     +K L SGERVI+D 
Sbjct: 160 PVVLGHGSAALAPCIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDR 219

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYI 296
           + +LQ + M FY+ INVGS   +AT+      G+W A+L+P   F I    L+   ++YI
Sbjct: 220 DASLQRMTMTFYWSINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAVLLV-LRRYI 278

Query: 297 QR--PIGDKVIA---KSFKVC-----WILTKNKFDFNAAKPS-VHPEKNYPWN------- 338
           +   P G  +IA   K  KVC     W   +    ++ AKPS +       W        
Sbjct: 279 KDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFY 338

Query: 339 -DKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIAL 397
            +  V + +  ++AC +F++Y IY    G + S   +Q + +   G+PND +  F+ + +
Sbjct: 339 PESLVQDARVTISACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCI 398

Query: 398 IIFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPL 456
           I+F+PI ++ VYP +R+     +P+ +IF GFM  + A    A++Q  +Y+  P  N   
Sbjct: 399 IVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYAT 458

Query: 457 GHNTPNHVHVCWQIP-AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGS 515
                      W +   Y L  FSE  A  TG E A+ ++P  MK+F+M++FL  +A  +
Sbjct: 459 ECEKGVSPISMWVVAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSA 518

Query: 516 AIGCALSPVTVDPKFTWLFTGLA 538
           A+G  ++P  VDP     F  LA
Sbjct: 519 ALGEIVTPSLVDPHLVIPFGVLA 541

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  216 bits (551), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 148/519 (28%), Positives = 236/519 (45%), Gaps = 39/519 (7%)

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYME----------------YGPND 113
           TLR V        + I ++E SER SYYG      N+++                   + 
Sbjct: 44  TLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDS 103

Query: 114 SPKGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILF 173
           +  G L +  Q AT L+    F  Y  P+  GY+AD +W +   +  G  + I    I  
Sbjct: 104 ATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFI 163

Query: 174 ITSIPSV-GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERV 232
           I ++P V GN  +                   K  L   +  Q P     ++ L SGERV
Sbjct: 164 IGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERV 223

Query: 233 IVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIA-VVTLIFG 291
           +VD + +LQ + M FY+ IN+GS   +AT+      G+W A+L+P   + I   V L+ G
Sbjct: 224 LVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLG 283

Query: 292 KKQYIQRPIGDKVIA---KSFKVC----WILTKNKFDF-NAAKPS-VHPEKNYPWNDK-- 340
           +    + P G  ++A   K  +VC    W       DF N A+PS +       W  K  
Sbjct: 284 RYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGA 343

Query: 341 -------FVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFD 393
                   V + +  L+A  +F++Y IY    G + S   +Q + +  +G+PND +  F+
Sbjct: 344 GGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFN 403

Query: 394 SIALIIFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY 452
            + +I+F+P+ +  +YP +R+     KP+ +IF GFM  + A    A++Q+ +Y   P  
Sbjct: 404 PLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCG 463

Query: 453 NEPLGHNTPNHVHVCWQIPA-YVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTN 511
                 +        W +   Y L   SE  A  TG E A+ ++PA MKSF+M++FL T+
Sbjct: 464 RYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTS 523

Query: 512 AFGSAIGCALSPVTVDPKFTWLFTGLA-VACFISGCLFW 549
           A  +A+G  ++P  VDP     F  LA +  F++    W
Sbjct: 524 ALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVFLW 562

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  212 bits (539), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 161/566 (28%), Positives = 247/566 (43%), Gaps = 64/566 (11%)

Query: 69  QTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY-----------GPNDSPKG 117
           + LRHV        ++I ++EL+ER SYYG      N+ +Y           GP+D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 118 VLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            L    Q AT L+   +F  Y  P+  GYVAD + G+   +  G    +    I  I ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 178 PSVGNRDSXXXXXXXXXXXXXXXXXX-XKANLSVLIADQLPKRKPSIKVLKSGERVIVDS 236
           P+V   ++                    K  L  ++  Q P     +K L +GERVI++ 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYI 296
           + +LQ + M FY+ INVGS   +AT       G+W ++L+P   F I    L+  K   +
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 297 QRPIGDKVIA---KSFKVC----WILTKNKFDF-NAAKPSV---------HPEKNYPWND 339
             P+G+ + A   K  KVC    W        F   AKPS             K   + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 340 KFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALII 399
             V++ +  LAAC +F++Y IY      + S    QA  M   G+PND +  F+ +A+II
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 400 FIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGH 458
            +PI +  + P +RR     KP+ +IFFGFM    A    A++Q+ +Y        P G 
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYN-----TSPCGK 458

Query: 459 NTPNHVHVCWQIP---------AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLL 509
           +         Q+           YVL   SE FA  TG E A+ ++P  MK+F+MS+FL+
Sbjct: 459 HASTCSETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLV 518

Query: 510 TNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTXXXXXXXXXXX 569
           T A  S +    + +  DP     F   AV     G LF + F                 
Sbjct: 519 TTALSSILTQIFNGIMTDPYLVIPFILFAVL----GTLFAILF----------------L 558

Query: 570 XXXFDLNPISAPKANDIEILEPMESL 595
              ++L+ +   +  +  IL+P+E L
Sbjct: 559 YRYWNLDKVMEAERRERAILDPLEIL 584

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  193 bits (490), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 235/527 (44%), Gaps = 42/527 (7%)

Query: 69  QTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY----GPN---------DSP 115
           +TLR +        +LI  +EL+ER SYYG      NY  Y    G N         ++ 
Sbjct: 50  RTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEAN 109

Query: 116 KGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175
            G L      AT L    +F  Y  P+  GY+ D + G   T+  G    +A   I  ++
Sbjct: 110 SGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILS 169

Query: 176 SIPSV-GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIV 234
           ++P V  + D+                   K  L  L+  Q P     +K L++GERVI+
Sbjct: 170 ALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVII 229

Query: 235 DSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQ 294
           D + +LQ + M FY+ IN+G+   +AT+      GFW A+L+P   +    V     +  
Sbjct: 230 DRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQPH 289

Query: 295 YIQR-PIGDKVIAKSFKVCWIL--------TKNKFDFNAAKPSVHPE-------KNYP-W 337
              R P G  ++A   KV ++          K    ++ A PS   +       K  P +
Sbjct: 290 IKDRAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFY 349

Query: 338 NDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIAL 397
            +  V + K  L+AC +F +Y IY      + +   +Q   M  +G+PND +  F+ +++
Sbjct: 350 KESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSI 409

Query: 398 IIFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQ-------SFVYKAG 449
           I+ IPI +  +YP +RR     KP+ +IF GFM    +    A++Q       S  Y A 
Sbjct: 410 IVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHAT 469

Query: 450 PWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLL 509
               + LG +  +   V  +   Y L   SE  A  T  E AY ++P  MKSF++++FL 
Sbjct: 470 TCSEKGLGVSPLSSWIVAVE---YTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLF 526

Query: 510 TNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYN 556
           T+A  +AI   ++P+  DP     F   A   FISGC F   FR  +
Sbjct: 527 TSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHFLWKFRNLD 573

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 140/498 (28%), Positives = 226/498 (45%), Gaps = 42/498 (8%)

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY------------GPNDSPKG 117
           TLR +     +  + I ++E +ER S+YG      N+ +Y            GP +   G
Sbjct: 38  TLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPG 97

Query: 118 VLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            L      AT +    +F  Y   +  GY++D + G+   +  G  + +    +  I ++
Sbjct: 98  ALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAAL 157

Query: 178 PSV-GNRDSXXXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPSIKVLKSGERVIVDS 236
           PSV  + +                    K  L  L+  Q P +   +K L SGERVIVD 
Sbjct: 158 PSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDR 217

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTL-IFGKKQY 295
           + +LQ + M FY+ INVG+   +AT       G+W A+ +P   + +  + L    +   
Sbjct: 218 DASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIK 277

Query: 296 IQRPIGDKVIAKSFKVC-------WILTKNKFDF-NAAKPSV---------HPEKNYPWN 338
              P  + V+A+S KV        WI       F + AKP+            +K   ++
Sbjct: 278 TNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYD 337

Query: 339 DKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI 398
           +K+V + K  ++AC +F++Y IY   +  +     +QA  ME  G+PND    F+ I++I
Sbjct: 338 EKYVYDTKLTISACTIFLYYVIY-QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISII 396

Query: 399 IFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG 457
           + +PI +  +YP +RRY    KP+ +IF GFM G    T  A++Q  VY   P     +G
Sbjct: 397 VVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSP--CGYMG 454

Query: 458 HNTPNHVH------VCWQIP-AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLT 510
             T   +H        W +   Y L   SE  A  TG E A+ ++P  MK F++++F+ T
Sbjct: 455 ATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFT 514

Query: 511 NAFGSAIGCALSPVTVDP 528
            A  SAI   ++P   DP
Sbjct: 515 VAISSAIILPITPFFKDP 532

>KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON} 
          Length = 407

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 90/228 (39%), Gaps = 39/228 (17%)

Query: 285 VVTLIFG-----KKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWND 339
           +VTL++G     +K ++ R     + A +       TK   D  A K S++P      + 
Sbjct: 191 IVTLLYGVCGIARKNHVFRNFLVMMAALASIQVISYTKATCDMLAGKLSINPSTGEVTDL 250

Query: 340 KFVDEIKRAL----AACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSI 395
              D +K +L     +  V +F  ++   +G   +S I Q+S + L GI          I
Sbjct: 251 FLFDRLKASLICGLGSLSVGVFAVMWHRWFGKPSASLIQQSSHLSLIGI-------MSII 303

Query: 396 ALIIFIPIFEKFVYPFIRRYTP-----LKPITKIFFGFMFGSFAM-----------TWAA 439
            L+ F+P   K  Y  I  Y       L  +  +FFG +   F++               
Sbjct: 304 LLLPFVPDL-KLSYQVISFYYADKTFWLTLMGSLFFGTVPCLFSLLHLNKKNPPEFVTTV 362

Query: 440 VLQSFVYKA-GPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASIT 486
            L S ++     W  EP+         V W++  Y+++  S IF S+T
Sbjct: 363 NLGSIIFMGLAEWLTEPIQTTI-----VRWEVIGYIVLVLSCIFLSMT 405

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 57/166 (34%), Gaps = 33/166 (19%)

Query: 10  DDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSXXXXXXXXXXXXXMQ 69
           D    E +   PV +E+  + V   D   + +  N  +     P                
Sbjct: 29  DGQTRELRMKPPVADEDGAEEVLAADEKAATEATNELDVEEEYPD--------------- 73

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGL 129
                GG    R WL  +      F  +G +     Y  Y  N        L S GA  +
Sbjct: 74  -----GG---YRAWLTVLGSFVGIFPIWGTANALGAYEGYISNHQ------LASSGAGEV 119

Query: 130 SYFFQFW---CYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFIL 172
           S+ F      C+V  VF G   D   G+   I  G+ +Y+ GIF++
Sbjct: 120 SWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYVFGIFMM 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,951,908
Number of extensions: 2509033
Number of successful extensions: 7174
Number of sequences better than 10.0: 30
Number of HSP's gapped: 7263
Number of HSP's successfully gapped: 30
Length of query: 601
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 486
Effective length of database: 40,294,809
Effective search space: 19583277174
Effective search space used: 19583277174
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)