Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YJL153C (INO1)1.195ON53353327680.0
Smik_10.811.195ON53353325780.0
Skud_10.631.195ON53353324950.0
Suva_6.2311.195ON54354224790.0
KLLA0D16412g1.195ON52952420420.0
CAGL0I06050g1.195ON53853020320.0
SAKL0F00396g1.195ON52752219990.0
TDEL0C035801.195ON53052419710.0
ZYRO0G18150g1.195ON53052419330.0
KAFR0F018601.195ON54253018630.0
TBLA0C020701.195ON53653818390.0
TPHA0A028801.195ON54053518300.0
Kpol_2001.171.195ON47146118020.0
NCAS0I027501.195ON58352818000.0
KNAG0C025201.195ON59252117970.0
NDAI0B001201.195ON56753716970.0
Smik_4.2013.154ON464106790.41
KAFR0F025203.211ON2482118761.5
YDL036C (PUS9)3.154ON46276732.4
KNAG0D004306.334ON319133722.6
KLLA0C17028g8.145ON460112722.9
ZYRO0E03586gna 1ON35073713.6
CAGL0L01287g1.481ON251137704.7
TBLA0H008008.408ON48148706.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL153C
         (533 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...  1070   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...   997   0.0  
Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...   965   0.0  
Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...   959   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   791   0.0  
CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...   787   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   774   0.0  
TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...   763   0.0  
ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...   749   0.0  
KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...   722   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   712   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   709   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   698   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   697   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   696   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   658   0.0  
Smik_4.201 Chr4 complement(367783..369177) [1395 bp, 464 aa] {ON...    35   0.41 
KAFR0F02520 Chr6 complement(487315..494763) [7449 bp, 2482 aa] {...    34   1.5  
YDL036C Chr4 complement(387513..388901) [1389 bp, 462 aa] {ON}  ...    33   2.4  
KNAG0D00430 Chr4 complement(63110..64069) [960 bp, 319 aa] {ON} ...    32   2.6  
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    32   2.9  
ZYRO0E03586g Chr5 (278440..279492) [1053 bp, 350 aa] {ON} conser...    32   3.6  
CAGL0L01287g Chr12 (147817..148572) [756 bp, 251 aa] {ON} simila...    32   4.7  
TBLA0H00800 Chr8 (179344..180789) [1446 bp, 481 aa] {ON} Anc_8.4...    32   6.0  

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/533 (97%), Positives = 520/533 (97%)

Query: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60
           MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL
Sbjct: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60

Query: 61  KKPEKXXXXXXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120
           KKPEK             STLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID
Sbjct: 61  KKPEKLGIMLIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120

Query: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180
           AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK
Sbjct: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180

Query: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240
           PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI
Sbjct: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240

Query: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL
Sbjct: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV 480

Query: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL
Sbjct: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/533 (89%), Positives = 502/533 (94%)

Query: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60
           MTEDN  PI SVKVVTDKCTY +NELLTKYSYENAVVTKTA G+FDVTPTVQDYVFKLDL
Sbjct: 1   MTEDNTTPIASVKVVTDKCTYTENELLTKYSYENAVVTKTAGGQFDVTPTVQDYVFKLDL 60

Query: 61  KKPEKXXXXXXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120
            KP+K             STLVAS+LAN+H++EFQTKEG+K+PNYFGSMTQCSTLKLGID
Sbjct: 61  NKPKKLGIMLIGLGGNNGSTLVASILANRHDMEFQTKEGLKKPNYFGSMTQCSTLKLGID 120

Query: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180
           AEGNDVYAPFNSLLPMV+PNDF+VSGWDIN A+LYEAMQR QVLEYDLQQRLKAKMS VK
Sbjct: 121 AEGNDVYAPFNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVK 180

Query: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240
           PLPSIYYPDFIAANQDERANNCINLDEKG VTTRGKW+HLQ+IRRDIQ+FKEEN+LDKVI
Sbjct: 181 PLPSIYYPDFIAANQDERANNCINLDEKGKVTTRGKWSHLQQIRRDIQHFKEENSLDKVI 240

Query: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEV+ GVNDTM+NLLQSIK+DHEEIAPST+FAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHEGTFIAGDD KSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL
Sbjct: 301 FVPGLVQLAEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RVSYKK   V+ED  K+E+FYPV
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKGSSVQEDHDKYESFYPV 480

Query: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPS NELRFEERLL
Sbjct: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEERLL 533

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/533 (86%), Positives = 494/533 (92%)

Query: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60
           MTEDN  P  SV+V T+KCTY ++ELLTKYSYENAVV+KT  GRFDVTPTVQDYVFK+ L
Sbjct: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60

Query: 61  KKPEKXXXXXXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120
            KP+K             STLVASVLANKH++EF TKEG+K+PNYFGSMTQ STLKLG+D
Sbjct: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120

Query: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180
           A GNDVYAPFNSLLPMV+PNDFV+SGWDIN+A+L EAMQR+QVLEYDLQQRL ++MS VK
Sbjct: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180

Query: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240
           PLPS+YYPDFIAANQDERANNCIN+D KG+VTT GKW HLQ+IR DIQ+FK+EN+LDKVI
Sbjct: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240

Query: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVE+S GVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHE  FIAGDDLKSGQTKLKSVLAQFLVDAGIKP+SIASYNHLGNNDGYNL
Sbjct: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RVSYK+V+P +ED GKFE+FYPV
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPV 480

Query: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           LTFLSYWLKAPLTRPGFHPVNGLNKQR+ALENF+RLLIGLPS NELRFEERLL
Sbjct: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/542 (84%), Positives = 492/542 (90%), Gaps = 10/542 (1%)

Query: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60
           MTEDN AP  SV+V ++KCTY DNELLTKYSYENAVV+KT  GR+DVTPTVQDYVFKLDL
Sbjct: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60

Query: 61  KKPEKXXXXXXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120
            KP K             ST  A++LANKHN+EFQTKEG+K+PNYFGSMTQ STLKLGID
Sbjct: 61  NKPAKLGVMLVGLGGNNGSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120

Query: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180
           A+GNDVYAPFNSLLPM +PNDFVV+GWDINNA+ +EAMQR+QVLEYDLQQRLK KMS +K
Sbjct: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180

Query: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240
           PLPSIYYPDFIAANQD+RANNCINLDEKG+VTT+GKW HLQ+IR DIQ+FKE+N+LDKVI
Sbjct: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240

Query: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEVS GVNDTMENLLQSIK+DHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHEG FIAGDD KSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDG+NL
Sbjct: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLG KVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDA--------- 471
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RVSYKK D  +E+          
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENEN 480

Query: 472 -GKFENFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEE 530
            GKFE+FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENF+RLLIGLPS NELRFEE
Sbjct: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540

Query: 531 RL 532
           RL
Sbjct: 541 RL 542

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/524 (71%), Positives = 437/524 (83%), Gaps = 5/524 (0%)

Query: 11  SVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDLKKPEKXXXXX 70
           +VKV TD   + + EL TKY+Y NA+V K+A G F+V P  QDY FK+DLK P K     
Sbjct: 10  TVKVATDVAEFSETELTTKYTYRNAIVEKSADGVFNVEPVTQDYEFKVDLKLP-KVGVML 68

Query: 71  XXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAPF 130
                   +T +AS+LANKH V+FQTKEG+K+ NY+GS+TQ STLKLG+DAEGNDVYAPF
Sbjct: 69  VGLGGNNGTTFLASILANKHKVKFQTKEGLKEANYYGSVTQSSTLKLGVDAEGNDVYAPF 128

Query: 131 NSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPDF 190
           NSL+PMVSPNDF VSGWDIN ADL  AM R++VL  DLQ +L+ +MS  KPLPSIYYPDF
Sbjct: 129 NSLVPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKPLPSIYYPDF 188

Query: 191 IAANQDERANNCINLDEK-GNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTER 249
           IAANQDERA+NC N D K G V+ + KW+H++ IR DI+ FKE N LDKV+VLWTANTER
Sbjct: 189 IAANQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVLVLWTANTER 248

Query: 250 YVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLA 309
           Y ++  GVNDT ENL+ +I++DH EIAPST+FA ASILE VPYINGSPQNTFVPG++ LA
Sbjct: 249 YADIVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNTFVPGVIDLA 308

Query: 310 EHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRSK 369
           E EG FIAGDD KSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDGYNLS+P+QF+SK
Sbjct: 309 EKEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFKSK 368

Query: 370 EISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNR 429
           EISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHNR
Sbjct: 369 EISKASVVDDIIESNQILYNDKLGNKIDHCIVIKYMPAVGDSKVAMDEYYSELMLGGHNR 428

Query: 430 ISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWLK 489
           ISIHNVCEDSLLATPLIIDLLVM EFC+R+ YKK++ +   +G + +FYPVLT LSYWLK
Sbjct: 429 ISIHNVCEDSLLATPLIIDLLVMAEFCSRIKYKKINDL---SGGYHSFYPVLTMLSYWLK 485

Query: 490 APLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           APLTRPGF  +NGLNKQR ALENFLRLLIGLP+ +ELRFEERL+
Sbjct: 486 APLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEERLV 529

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/530 (71%), Positives = 445/530 (83%), Gaps = 8/530 (1%)

Query: 11  SVKV--VTDKCTYKDNELLTKYSYE-NAVVTKTASGRFDVTPTVQDYVFKLDLKKPEKXX 67
           S++V  V DK +YK+NELLT Y+Y  N V T +   +F+VTP  ++Y FK+DL KPE+  
Sbjct: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERLG 67

Query: 68  XXXXXXXXXXXSTLVASVLANKHNVEFQT--KEGVKQPNYFGSMTQCSTLKLGIDAEGND 125
                      ST++A+VLANKHNV F+T  KEG+ +PNY+GS+TQ ST+KLG+D++G D
Sbjct: 68  VMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127

Query: 126 VYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSI 185
           VY PFNSL+PMV+PNDFVVSGWDIN A + +AM+R+ VLE DL+ +L   M   KPL S+
Sbjct: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187

Query: 186 YYPDFIAANQDERANNCINLD-EKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWT 244
           YYPDFIAANQDERA+NC+N+D + G VTT GKW HL  IR DI+ FK++N LDKVI+LWT
Sbjct: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247

Query: 245 ANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304
           ANTERYVE+ PGVNDTMENLL++IKNDH EIAPSTIFAAASILE  PYINGSPQNTFVPG
Sbjct: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307

Query: 305 LVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPK 364
           L++LAE   + IAGDD KSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDGYNLS+P+
Sbjct: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367

Query: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           QFRSKEISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 368 QFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELML 427

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPV--KEDAGKFENFYPVLT 482
           GGHNRISIHNVCEDSLLATPLIIDL+VMTEFC+RV+Y+ VD     E  G FENFYPVL+
Sbjct: 428 GGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLS 487

Query: 483 FLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532
           FLSYWLKAPLT+PG+ P+NGLNKQRTALENFLRLLIGLP+ +ELRFEERL
Sbjct: 488 FLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/522 (69%), Positives = 436/522 (83%), Gaps = 3/522 (0%)

Query: 12  VKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDLKKPEKXXXXXX 71
           VKV T+ C Y+ ++L+T Y+Y+N +V+K + G +   P V++Y FK+DLK P K      
Sbjct: 9   VKVATENCQYRGSDLITNYTYKNTIVSKCSDGSYSAQPVVENYQFKVDLKVP-KLGVMLV 67

Query: 72  XXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAPFN 131
                  ST +AS+LANKH ++F +KEG    NY+GS+TQ ST+KLGIDA+GNDVY PFN
Sbjct: 68  GLGGNNGSTFIASILANKHKIQFNSKEGTIGANYYGSVTQASTIKLGIDADGNDVYVPFN 127

Query: 132 SLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPDFI 191
           S+LP V+PNDFVV GWDIN +++YEAM R++VLEYDLQ++LKA+M  + PLPS+YYPD+I
Sbjct: 128 SVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHPLPSVYYPDYI 187

Query: 192 AANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTERYV 251
           AANQDERANNCIN   KG V+T+ KW H+++IR+DI++FKE N LDKVIVLWTANTERY 
Sbjct: 188 AANQDERANNCIN-RVKGTVSTKNKWDHVEKIRKDIRDFKETNGLDKVIVLWTANTERYS 246

Query: 252 EVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEH 311
           ++  GVND  ENLL++IK+DH EI+PS IFA ASILE VPYINGSPQNTFVPG+V+LAE 
Sbjct: 247 DLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNTFVPGIVELAEK 306

Query: 312 EGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRSKEI 371
             +FI GDD KSGQTKLKSVLAQFLVDAGI+PVSIASYNHLGNNDGYNLS+PKQF+SKEI
Sbjct: 307 NKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPKQFKSKEI 366

Query: 372 SKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRIS 431
           SKSSV+DDIIASN ILYN+KLGKK+DHCIVIKYM  V DSKVAMDEYYSELMLGGHNRIS
Sbjct: 367 SKSSVVDDIIASNSILYNEKLGKKIDHCIVIKYMPAVADSKVAMDEYYSELMLGGHNRIS 426

Query: 432 IHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWLKAP 491
           IHNVCEDSLLATPLIIDLLVM+EF +RV+YKK++     AG +E  Y +L+FLSYWLKAP
Sbjct: 427 IHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLES-DASAGSYEKLYSILSFLSYWLKAP 485

Query: 492 LTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           LTR GF  +NGLNKQR ALENFLRLLIGLP+ +ELRFEERL+
Sbjct: 486 LTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERLV 527

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/524 (69%), Positives = 428/524 (81%), Gaps = 6/524 (1%)

Query: 11  SVKVVTDKCTYKDNELLTKYSYENAVVTKT-ASGRFDVTPTVQDYVFKLDLKKPEKXXXX 69
           ++ V  DK  Y + +L T+Y Y N+VV K+   G  +V PT QDY F++DLK P K    
Sbjct: 10  TINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIP-KIGVM 68

Query: 70  XXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAP 129
                    +TLVASVLAN+  + F TK+G K+ NY+GS+TQ ST+KLGID +GNDVY P
Sbjct: 69  LVGLGGNNGTTLVASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVP 128

Query: 130 FNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPD 189
           FNS+LP VSPNDFVV GWDIN A+L +AM RSQVLEYDLQQ+L+ +M+   PLPSIYYPD
Sbjct: 129 FNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPD 188

Query: 190 FIAANQDERANNCINLDEK-GNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTE 248
           FIAANQDERA+NCIN D K GNV+T+GKW+H+++IR+DI+NFK  N LDKVIVLWTANTE
Sbjct: 189 FIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTE 248

Query: 249 RYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308
           RY +V   VND  +NLL +IKNDHEEIAPSTIFA ASILEGVPYINGSPQNTFVPG++ L
Sbjct: 249 RYADVLSNVNDNADNLLAAIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDL 308

Query: 309 AEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRS 368
           AE     IAGDD KSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDG+NL++ +QF+S
Sbjct: 309 AEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKS 368

Query: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428
           KEISK SV+DD+IASN ILYN+K G K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWL 488
           RISIHNVCEDSLLATPLIIDL+VM EFC+RVSYKK+     D   +E+FY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLG---SDQQSYESFYSILSFLSYWL 485

Query: 489 KAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532
           KAPLTR GF  +NGLNKQR  +ENFLRLLIGLP+ +ELRFEE+L
Sbjct: 486 KAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/524 (69%), Positives = 428/524 (81%), Gaps = 6/524 (1%)

Query: 11  SVKVVTDKCTYKDNELLTKYSYENAVVTK-TASGRFDVTPTVQDYVFKLDLKKPEKXXXX 69
           SVKV TDK  Y + EL TKY+Y N++VT+  A+   DV P  Q+Y FK+DLK P +    
Sbjct: 10  SVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLP-RVGVM 68

Query: 70  XXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAP 129
                    +T +AS+LAN+  ++F  KEG+K+ NY+GS+TQCSTLKLG+  +GND Y P
Sbjct: 69  LVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFYVP 128

Query: 130 FNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPD 189
           FNSLLP VSPNDF V+GWDI+  +L +AM+R+QVLEYDLQ++LK +MS  KPLPSIYYPD
Sbjct: 129 FNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYYPD 188

Query: 190 FIAANQDERANNCINL-DEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTE 248
           FIAANQD RA+NCIN  +  G  +T+ KW HL+RIR DI+ FK++  LDKVIVLWTANTE
Sbjct: 189 FIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTANTE 248

Query: 249 RYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308
           RY ++ PGVNDT +NLL +IK D EEIAPSTIFA ASILEG  YINGSPQNTFVPG+++L
Sbjct: 249 RYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVIEL 308

Query: 309 AEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRS 368
           AE E +FIAGDD KSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDGYNLS+ +QF+S
Sbjct: 309 AEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQFKS 368

Query: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428
           KEISK SV+DD++ASN +LYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKKSVVDDVVASNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWL 488
           RISIHNVCEDSLLATPLIIDLLVM EFCTRVSYK+V     + GK   FY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGK---FYNILSFLSYWL 485

Query: 489 KAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532
           KAPLTR G+  +NGLNKQR+ LENF+RLLIGLP+Q+ELRFEERL
Sbjct: 486 KAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/530 (66%), Positives = 421/530 (79%), Gaps = 9/530 (1%)

Query: 7   APITSVKVVTDKCTYK--DNELLTKYSYENAVVTK-TASGRFDVTPTVQDYVFKLDLKKP 63
           AP  SVK     CT    +NEL+++Y Y+N++V K   +   ++TP  QDY FK++L  P
Sbjct: 17  APRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-P 75

Query: 64  EKXXXXXXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEG 123
            K             ST +AS+LANK+N+ F T+EG  +PNY+GSMTQ STLKLGID+EG
Sbjct: 76  NKVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEG 135

Query: 124 NDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLP 183
           NDV+APFNS+LPMV+PNDFVVSGWDIN+ +L+ AMQR++VLEYDLQ +LK  M   KPL 
Sbjct: 136 NDVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLK 195

Query: 184 SIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLW 243
           SIYYPDFIA NQ ERANNCIN ++ G   T+ KW  L +IR+DI++FK  N L+ +IVLW
Sbjct: 196 SIYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLW 255

Query: 244 TANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVP 303
           TANTER VE+ PGVNDTM+NL+ SIK++H EI+PS IFA A+I+E VPYINGSPQNTFVP
Sbjct: 256 TANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVP 315

Query: 304 GLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAP 363
           GL++LAEH    IAGDD K+GQTKLKSV+ QFLVDAGIKPVSIASYNHLGNNDG NLS+ 
Sbjct: 316 GLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSH 375

Query: 364 KQFRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSEL 422
            QFRSKEISKSSVIDD I SN+IL+N K    K +HCIVIKYMK VGDSKVAMDEYYS+L
Sbjct: 376 AQFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQL 435

Query: 423 MLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLT 482
           MLGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF +R++YKK+   +E    F  FYP+L+
Sbjct: 436 MLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQE----FHKFYPILS 491

Query: 483 FLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532
           FLSYWLKAPLTR GF P+N LN+QR ALENFLRLL+GLP  +ELRFEERL
Sbjct: 492 FLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/538 (65%), Positives = 422/538 (78%), Gaps = 9/538 (1%)

Query: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVV-TKTASGRFDVTPTVQDYVFKLD 59
           MT     P  +VKV TDKC Y ++EL+TKY+Y+N +V +  A   FDV    +DY FK D
Sbjct: 1   MTAQTFVP--AVKVQTDKCRYTEDELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTD 58

Query: 60  LKKPEKXXXXXXXXXXXXXSTLVASVLANKHNVEFQTK--EGVKQPNYFGSMTQCSTLKL 117
           LK P K             +T VASVLANK  ++F+TK  +G+K  NY+GS+TQ ST+KL
Sbjct: 59  LKIP-KVGVMLVGMGGNNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKL 117

Query: 118 GIDAEG-NDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKM 176
           G+D+E  NDVY PFNSLLPMV+PNDFVVSGWDI + + Y+AM  SQVLEYDL Q+LK +M
Sbjct: 118 GVDSETLNDVYIPFNSLLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEM 177

Query: 177 SLVKPLPSIYYPDFIAANQDERANNCINLDEKGN--VTTRGKWTHLQRIRRDIQNFKEEN 234
           S +KPL SIYYPDF+A NQ ERANNCIN  +  +  +  + K + L  IR DI+ FK+EN
Sbjct: 178 SQIKPLKSIYYPDFLAMNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQEN 237

Query: 235 ALDKVIVLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYIN 294
            LDKVIVLWTA+TERY ++  GVNDT +NLL SIK  HEEIAPSTIFA ASILEG  YIN
Sbjct: 238 HLDKVIVLWTASTERYADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYIN 297

Query: 295 GSPQNTFVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGN 354
           GSPQNT VPG+V L++ E T IAGDD K+GQTKLKSVLAQFL+DAGIKP+S+ASYNHLGN
Sbjct: 298 GSPQNTLVPGVVDLSKRENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGN 357

Query: 355 NDGYNLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVA 414
           NDGYNLSAPKQFRSKEISKSSVIDD+I SN+ILYN K G +VDHCIVIKYM  VGD+KVA
Sbjct: 358 NDGYNLSAPKQFRSKEISKSSVIDDMIESNEILYNAKTGAEVDHCIVIKYMPAVGDNKVA 417

Query: 415 MDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKF 474
           MDEYYSELMLGGHNRIS+HNVCEDSLLATP++IDL+VM EF +R+SYK+V+   ++  ++
Sbjct: 418 MDEYYSELMLGGHNRISVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRDDEELEY 477

Query: 475 ENFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532
             F   L+FLSYWLKAP+ + GF P+NGLNKQR ALENFLRLLIGLP  +ELRFEERL
Sbjct: 478 STFNSTLSFLSYWLKAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPNDELRFEERL 535

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/535 (65%), Positives = 425/535 (79%), Gaps = 17/535 (3%)

Query: 12  VKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQ-DYVFKLDLKKPEKXXXXX 70
           + V  DKCT + N L +KY+Y + +VTK  S    +  TV+ DY F +DL  P K     
Sbjct: 10  IIVNNDKCTIEGNTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLP-KLGIML 68

Query: 71  XXXXXXXXSTLVASVLANKHNVEFQTK--EGVKQPNYFGSMTQCSTLKLGIDAEGND-VY 127
                   +TL+ASVLANK+N+EF +K  +G+K+ NY+GS+TQ ST+KLGID + ND +Y
Sbjct: 69  VGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTNDEIY 128

Query: 128 APFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYY 187
            PF  +LP+ +PNDFV++GWDI++ + +EAMQR+ VLE+DLQ +LK +M  +KPL SIYY
Sbjct: 129 VPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLKSIYY 188

Query: 188 PDFIAANQDERANNCINL--DEKGNV-------TTRGKWTHLQRIRRDIQNFKEENALDK 238
           PDFIA NQ+ERAN+C N   + +GN         T+ KW+H+++IR DI+NFK+EN LDK
Sbjct: 189 PDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKENNLDK 248

Query: 239 VIVLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQ 298
           VIVLWTANTERY  +  GVND  +NLL +IKNDH E++PSTIFA ASILEGVPYINGSPQ
Sbjct: 249 VIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYINGSPQ 308

Query: 299 NTFVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGY 358
           NTFVPG++ LAE E +FIAGDD KSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDG+
Sbjct: 309 NTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGF 368

Query: 359 NLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEY 418
           NLS+P QF+SKEISK  V DD+I SN IL+NDK+GK +DHCIVIKY+  VGDSKVAMDEY
Sbjct: 369 NLSSPMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYLNAVGDSKVAMDEY 428

Query: 419 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFY 478
           YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRV+YKK   + E A  +E FY
Sbjct: 429 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKK---LGEGATDYEQFY 485

Query: 479 PVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           PVLT LSYWLKAPLTRPGF P+NGL KQR ALENFLRLLIGLP  ++LRFEERL+
Sbjct: 486 PVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRFEERLI 540

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/461 (73%), Positives = 388/461 (84%), Gaps = 6/461 (1%)

Query: 79  STLVASVLANKHNVEFQTK--EGVKQPNYFGSMTQCSTLKLGIDAEGN-DVYAPFNSLLP 135
           +T +ASVLANK+N+EF +K  +G+K+ NY+GS+TQ ST+KLGI+ E N DVY PFN +LP
Sbjct: 11  TTFLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNEDVYIPFNEILP 70

Query: 136 MVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPDFIAANQ 195
            V+PNDFVVSGWDINN++  EAMQR+ VLEYDLQ +LK  M  V PL SIYYPDFIA NQ
Sbjct: 71  FVNPNDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSIYYPDFIAINQ 130

Query: 196 DERANNCINL---DEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTERYVE 252
           +ERANN IN    D      ++GKW+H++ IR DI+NFK EN LDKVIVLWTANTERY  
Sbjct: 131 NERANNVINRGTNDLSLENLSKGKWSHVEHIRNDIRNFKNENNLDKVIVLWTANTERYSV 190

Query: 253 VSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHE 312
           +  G+NDT +NL+ SIKNDH E++PSTIFA ASILEGVPYINGSPQNTFVPG+++LAE E
Sbjct: 191 IENGINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFVPGVIELAERE 250

Query: 313 GTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRSKEIS 372
            +FIAGDD KSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDGYNLS+P QF+SKEIS
Sbjct: 251 HSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSSPMQFKSKEIS 310

Query: 373 KSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISI 432
           K  V DD+I SN IL+NDK+GK +DHCIVIKYM  VGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 311 KRGVCDDMIESNQILFNDKVGKTIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISI 370

Query: 433 HNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWLKAPL 492
           HNVCEDSLLATPLIIDLLVMTEFCTRV+YKK+D       +FE FYPVLT LSYWLKAPL
Sbjct: 371 HNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLDGADATKKEFEPFYPVLTLLSYWLKAPL 430

Query: 493 TRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           TRPGF  +NGL KQR ALENF+RLLIGLP  +ELRFEERLL
Sbjct: 431 TRPGFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERLL 471

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/528 (65%), Positives = 413/528 (78%), Gaps = 13/528 (2%)

Query: 11  SVKVVTDKCTY--KDNELLTKYSYENAVVTKT-ASGRFDVTPTVQDYVFKLDLKKPEKXX 67
           +V + T KC Y  KDN LLT Y Y+ + V    A G   V+   QDY FK+DLK P K  
Sbjct: 62  NVVLATGKCQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVP-KVG 120

Query: 68  XXXXXXXXXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAE-GNDV 126
                      STL+AS+LANKHN+ F  K+G  +PNY GSMTQ +T+ LG D E G D 
Sbjct: 121 VMLVGFGGNNGSTLLASILANKHNISFHNKDGEIKPNYLGSMTQSATVHLGRDEETGRDF 180

Query: 127 YAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIY 186
           + PFN++LPMV+PND +V+GWDI+N +L E+MQR+QVL+YDLQ++L   M    P+ SIY
Sbjct: 181 FQPFNAVLPMVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIY 240

Query: 187 YPDFIAANQDERANNCINLDEKGN-VTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTA 245
           YP+FIAANQ +RANNCIN   KG+  TT+GKW H+ ++R DI+ FK EN LDKVIVLWTA
Sbjct: 241 YPEFIAANQFDRANNCIN--SKGDEFTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTA 298

Query: 246 NTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL 305
           NTE++ ++ PGVNDT ENLLQ+IKNDHEEIAPST+FA ASILEGVPYINGSPQNTFVPGL
Sbjct: 299 NTEKFAQIVPGVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGL 358

Query: 306 VQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQ 365
           ++LAEHE   IAGDD K+GQTKLKSVL QFLVDAGI+PVSIASYNHLGNNDG NLS+  Q
Sbjct: 359 IKLAEHENVLIAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQ 418

Query: 366 FRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           F+SKEISKS VI+DI+ SN I+Y D   K ++DHCIVIKYM  VGDSKVAMDEYY+ELML
Sbjct: 419 FKSKEISKSGVINDILESNSIMYGDDPEKARIDHCIVIKYMPAVGDSKVAMDEYYNELML 478

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFL 484
           GGHNRIS+HNVCEDSLLA P+I+DL++M EFC+RV+YK+ +    D G ++ F+PVLT L
Sbjct: 479 GGHNRISLHNVCEDSLLAAPIILDLVIMCEFCSRVTYKEAN----DNGDYKKFHPVLTLL 534

Query: 485 SYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532
           SYWLKAPL R  F PVNGL KQR ALENF+RLLIGLP+ +ELRFEERL
Sbjct: 535 SYWLKAPLAREDFLPVNGLMKQRAALENFMRLLIGLPANDELRFEERL 582

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/521 (66%), Positives = 412/521 (79%), Gaps = 6/521 (1%)

Query: 19  CTY--KDNELLTKYSYENAVV-TKTASGRF-DVTPTVQDYVFKLDLKKPEKXXXXXXXXX 74
           CT   + NEL++ + Y+N V+ T  ++G    ++P   +Y FK+DL  PEK         
Sbjct: 72  CTLSRETNELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEKVGVLLVGFG 131

Query: 75  XXXXSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAPFNSLL 134
               STL+AS+LAN+  + F  KEG ++ N+FGSMTQ ST+KLG+D +GNDV+ PFNS+L
Sbjct: 132 GNNGSTLLASILANRQKMVFNNKEGPQRANFFGSMTQSSTMKLGVDVKGNDVFVPFNSVL 191

Query: 135 PMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPDFIAAN 194
           PM  P +FVV GWDINNA+L+EAMQR  VLEYDLQ +LK++M  + P+ S+YYPDFIA N
Sbjct: 192 PMADPTEFVVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSVYYPDFIALN 251

Query: 195 QDERANNCINLDEKG-NVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTERYVEV 253
           Q +RANNCIN  + G   +T  K   L++IR+DI++FK  N LDKVIVLWTANTER V++
Sbjct: 252 QFDRANNCINATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWTANTERCVDI 311

Query: 254 SPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHEG 313
            P VND+ ++LL++I+++HEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL+ LAE   
Sbjct: 312 IPSVNDSADSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLIDLAERHD 371

Query: 314 TFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRSKEISK 373
             IAGDD KSGQTKLKSVL QFLVDAGIKPVSIASYNHLGNNDG NLS+ +QFRSKEISK
Sbjct: 372 VLIAGDDFKSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQRQFRSKEISK 431

Query: 374 SSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISI 432
           SSVIDD I SN ILYND   K KV+HCIVIKY+  VGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 432 SSVIDDCIQSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELMLGGHNRISI 491

Query: 433 HNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWLKAPL 492
           HNVCEDSLLA PLIIDLLVMTEF +R+ Y+K++     + KF +FYP+LTFLSYWLKAPL
Sbjct: 492 HNVCEDSLLAAPLIIDLLVMTEFFSRIKYQKIEDGAPPSDKFSDFYPILTFLSYWLKAPL 551

Query: 493 TRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           TR GF P+N LN+QR ALENFLRLLIGLP  +ELRFEERL+
Sbjct: 552 TRKGFQPINSLNRQRLALENFLRLLIGLPPNDELRFEERLV 592

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/537 (61%), Positives = 408/537 (75%), Gaps = 21/537 (3%)

Query: 16  TDKCTYK--DNELLTKYSYENAVVTKTAS---GRFDVTPTVQDYVFKLDLKKPEKXXXXX 70
           +DKC Y   +N LLT Y+Y   +V    S      +V+   +DY FK+DLK P K     
Sbjct: 33  SDKCKYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIP-KIGVML 91

Query: 71  XXXXXXXXSTLVASVLANKHNVEFQTKEG----VKQPNYFGSMTQCSTLKLGIDAEGN-D 125
                   +T +AS+LANK+N+ F  K+G     ++  + GSMTQ STL LG + + N D
Sbjct: 92  VGMGGNNGTTFLASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQSSTLYLGKNQQTNED 151

Query: 126 VYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSI 185
           VY PFNS+LPM +PND ++SGWDI+  ++++AMQR++VLEYDLQ++LK  M    PL SI
Sbjct: 152 VYVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYTPLKSI 211

Query: 186 YYPDFIAANQDERANNCINLDEKGN----VTTRGKWTHLQRIRRDIQNFKEENALDKVIV 241
           YYPDFIA NQ +RA+NCIN   KG      + + KW  L  IR++I++FK +N LDKVI+
Sbjct: 212 YYPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKLDKVII 271

Query: 242 LWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTF 301
           LWTA TE++ EV PG+NDT ENLL SIK +H+EIAPSTIFA ASILE  PYINGSPQNTF
Sbjct: 272 LWTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGSPQNTF 331

Query: 302 VPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLS 361
           VPGL+ LAE E   IAGDD K+GQTKLKSVLAQFL+DAGIKP+SIASYNHLGNNDG NLS
Sbjct: 332 VPGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNNDGLNLS 391

Query: 362 APKQFRSKEISKSSVIDDIIASNDILY--NDKLGKK---VDHCIVIKYMKPVGDSKVAMD 416
           +  QF+SKEI+KS+VIDD+I SN ILY  +DK+ KK   VDHCIVIKYM+ +GDSKVAMD
Sbjct: 392 SSLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDSKVAMD 451

Query: 417 EYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFEN 476
           EYY+ELMLGGHNRISIHNVCEDSLLA+P+I+DL++M EFC+R++Y +    + D G ++ 
Sbjct: 452 EYYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIESGNQQGD-GNYQQ 510

Query: 477 FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533
           FYPVL+ LSYWLKAPLTRPG+ P+NGLNKQR AL+NF+RLLIGLP  +ELRFEERL+
Sbjct: 511 FYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERLM 567

>Smik_4.201 Chr4 complement(367783..369177) [1395 bp, 464 aa] {ON}
           YDL036C (REAL)
          Length = 464

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 45/106 (42%), Gaps = 2/106 (1%)

Query: 376 VIDDIIASNDILYNDKLGK--KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISIH 433
           + +D I SND ++   LGK  +VD   V+  +  +G SK A   +Y     G   R    
Sbjct: 353 IANDPIYSNDEVWGSNLGKNGQVDLATVVTKLDEIGKSKPAKSWFYDSYGYGEVLRQEKC 412

Query: 434 NVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYP 479
           +VCE  L   P   DL +        S K  + + E    ++  YP
Sbjct: 413 SVCESDLYTDPGPNDLDLWLHAYLYESTKTEEEIGEKNWCYKTEYP 458

>KAFR0F02520 Chr6 complement(487315..494763) [7449 bp, 2482 aa] {ON}
            Anc_3.211 YBL004W
          Length = 2482

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 17/118 (14%)

Query: 191  IAANQDERANNCINLDEKGNVTTRGKW----THLQRIRRD--IQNFKEEN-----ALDKV 239
            +AAN  ++A  C+N D   N+  R +W    + +  +  D  I+ F  EN     ++ K+
Sbjct: 1045 MAANLRQKALKCLN-DVFQNLGDRVQWNEYVSEIYEVIIDPRIETFAHENLQQVSSILKL 1103

Query: 240  IVLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSP 297
            +V WT N E Y  +       M+ L+ ++ ++H +  P      A+IL+GV     +P
Sbjct: 1104 VVFWTKNKEFYPFLYRDDYSIMKALMCTLSSEHVK-EP----VVATILDGVHEFMKNP 1156

>YDL036C Chr4 complement(387513..388901) [1389 bp, 462 aa] {ON}
           PUS9Mitochondrial tRNA:pseudouridine synthase, catalyzes
           the formation of pseudouridine at position 32 in
           mitochondrial tRNAs; contains an N-terminal
           mitochondrial targeting sequence
          Length = 462

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 376 VIDDIIASNDILYNDKLGK--KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISIH 433
           + +D I SND ++ + LGK  + D  IVI  +  +G  K A   ++S    G   R    
Sbjct: 351 IANDPIYSNDEVWGNNLGKGGQADFDIVITKLDEIGKRKPAKSWFHSNGGYGEVLRQEKC 410

Query: 434 NVCEDSLLATPLIIDL 449
           ++CE  L   P   DL
Sbjct: 411 SICESDLYTDPGPNDL 426

>KNAG0D00430 Chr4 complement(63110..64069) [960 bp, 319 aa] {ON}
           Anc_6.334 YNR027W
          Length = 319

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 62/133 (46%), Gaps = 9/133 (6%)

Query: 354 NNDGYNLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKV 413
           N+ GY   +  Q+ S+++ + +++  +I S DI Y+  L        +++ M  + +SK+
Sbjct: 41  NHPGYGFFSGFQY-SEKVLRDTLLKGLIESMDIHYDVVLTGYCPSGEILEEMARIINSKM 99

Query: 414 AMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMT-------EFCTRVSYKKVDP 466
           A  ++  + +LG +NR+ +     D +  T L  +L+ +T       E  T    +    
Sbjct: 100 AHVKWVLDPVLGDNNRLYVSETVVD-VYRTLLRDNLVYLTTPNQFEMELLTGTKIRDAPS 158

Query: 467 VKEDAGKFENFYP 479
           + E   +F   YP
Sbjct: 159 LHESLRRFHKLYP 171

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 47/112 (41%), Gaps = 15/112 (13%)

Query: 258 NDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHEGTFIA 317
           N T   L Q I N ++ +AP  +FA +S +  +  I        +  L+  ++H  T IA
Sbjct: 50  NPTRTVLQQQIANLYD-VAPEQVFAVSSGMTALDII--------LRTLIDNSDHIPTIIA 100

Query: 318 GDDLKSGQTKLKSVLAQ------FLVDAGIKPVSIASYNHLGNNDGYNLSAP 363
           GDDL  G  +L + L           D       I  YN LG  D   L +P
Sbjct: 101 GDDLYGGTQRLLTFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESP 152

>ZYRO0E03586g Chr5 (278440..279492) [1053 bp, 350 aa] {ON} conserved
           hypothetical protein
          Length = 350

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 9/73 (12%)

Query: 220 LQRIRRDIQNFKEENALDKV-IVLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPS 278
           L R+ R++Q F + N L  V I  W  +     EV        E L+ SI  DH+ + P 
Sbjct: 106 LARVERELQEFIKVNKLTPVNISTWECDISDPQEV--------EELINSIPRDHDGLIPD 157

Query: 279 TIFAAASILEGVP 291
            +   A   + VP
Sbjct: 158 KLVHTAGYCQNVP 170

>CAGL0L01287g Chr12 (147817..148572) [756 bp, 251 aa] {ON} similar
           to uniprot|P32626 Saccharomyces cerevisiae YEL038w UTR4
          Length = 251

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 15/137 (10%)

Query: 219 HLQRIRRDIQNFKEENALDKVIVLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPS 278
           H+QRI    +NF EE+  D+ I    A  +   E   G N  +E+LL  + ND ++   S
Sbjct: 35  HVQRIV--YENFNEEHPKDEFIAEQLAKYDIKEEGQAGKNKLVEHLLDLVANDTKD---S 89

Query: 279 TIFAAASILEGVPYINGSPQNTFVPGLVQ-LAEHEGTFIAGDD------LKSGQTKLKSV 331
           T+ A    +  V Y +G  +    P ++  L  ++G    GDD        SG    + +
Sbjct: 90  TLKALQGHVWEVGYNSGELEVPLYPDVIDFLVRNDGR---GDDKVPVYIYSSGSIHAQKL 146

Query: 332 LAQFLVDAGIKPVSIAS 348
           L   + ++G     IA 
Sbjct: 147 LFGHVKNSGNSHAKIAG 163

>TBLA0H00800 Chr8 (179344..180789) [1446 bp, 481 aa] {ON}
          Anc_8.408 YDR200C
          Length = 481

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 1  MTEDNIAPITSVKVVTDKCTYKDNEL-LTKYSYENAVVTKTASGRFDV 47
          +  DNI PI +  + + K T ++ ++ LTK+ Y N ++ K+ +G F+ 
Sbjct: 35 LENDNINPIATTLIASPKKTTENQQVGLTKHRYTNILILKSLNGTFET 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,140,912
Number of extensions: 2616013
Number of successful extensions: 7201
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7378
Number of HSP's successfully gapped: 29
Length of query: 533
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 419
Effective length of database: 40,409,475
Effective search space: 16931570025
Effective search space used: 16931570025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)