Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YJL061W (NUP82)1.319ON71371336890.0
Smik_10.1791.319ON71371330430.0
Suva_6.1371.319ON71871828290.0
Skud_10.1581.319ON71671427320.0
ZYRO0G20680g1.319ON69269913661e-180
NCAS0A092101.319ON71072513671e-180
NDAI0G057501.319ON73472813351e-174
TDEL0D018801.319ON69170213121e-171
KAFR0A017201.319ON71667612731e-165
KNAG0C058401.319ON74772911511e-147
SAKL0D06930g1.319ON69072311031e-140
Kpol_1035.241.319ON71772010981e-139
TBLA0F013101.319ON7427209871e-122
TPHA0O014601.319ON7217219331e-115
Kwal_14.25801.319ON6877129261e-114
CAGL0J05214g1.319ON7166998751e-106
KLTH0H10692g1.319ON6917248581e-104
Ecym_62901.319ON6717098005e-96
AEL168C1.319ON6737097247e-85
KLLA0F01661g1.319ON6877295064e-54
Suva_10.1778.276ON24869810.24
KNAG0B067504.361ON105283830.29
Skud_12.1618.276ON25069810.29
Smik_12.1528.276ON25069800.33
YLR093C (NYV1)8.276ON25369800.38
Ecym_31571.509ON110761790.80
TPHA0A011008.609ON528120752.2
NCAS0B050608.276ON23794722.9
CAGL0M09999g3.124ON3124158752.9
CAGL0F02079g8.68ON122399743.2
CAGL0C00429g8.276ON23467705.4
KLTH0A02178g8.90ON38989716.3
NDAI0E017802.402ON100727708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL061W
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...  1425   0.0  
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...  1176   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...  1094   0.0  
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...  1056   0.0  
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   530   e-180
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   531   e-180
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   518   e-174
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   509   e-171
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   494   e-165
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   447   e-147
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   429   e-140
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   427   e-139
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   384   e-122
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   363   e-115
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   361   e-114
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   341   e-106
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   335   e-104
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   312   5e-96
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   283   7e-85
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   199   4e-54
Suva_10.177 Chr10 complement(331316..331927,331928..332062) [747...    36   0.24 
KNAG0B06750 Chr2 (1332805..1335963) [3159 bp, 1052 aa] {ON} Anc_...    37   0.29 
Skud_12.161 Chr12 complement(309662..310273,310274..310414) [753...    36   0.29 
Smik_12.152 Chr12 complement(306393..307004,307005..307145) [753...    35   0.33 
YLR093C Chr12 complement(326513..327258,327400..327415) [762 bp,...    35   0.38 
Ecym_3157 Chr3 (294832..298155) [3324 bp, 1107 aa] {ON} similar ...    35   0.80 
TPHA0A01100 Chr1 (212665..214251) [1587 bp, 528 aa] {ON} Anc_8.6...    33   2.2  
NCAS0B05060 Chr2 complement(940241..940938,941045..941060) [714 ...    32   2.9  
CAGL0M09999g Chr13 (987540..996914) [9375 bp, 3124 aa] {ON} simi...    33   2.9  
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...    33   3.2  
CAGL0C00429g Chr3 (43086..43790) [705 bp, 234 aa] {ON} similar t...    32   5.4  
KLTH0A02178g Chr1 complement(186546..187715) [1170 bp, 389 aa] {...    32   6.3  
NDAI0E01780 Chr5 (352387..355410) [3024 bp, 1007 aa] {ON} Anc_2....    32   8.8  

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score = 1425 bits (3689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/713 (98%), Positives = 700/713 (98%)

Query: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60
           MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS
Sbjct: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120
           RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE
Sbjct: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120

Query: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180
           VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN
Sbjct: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180

Query: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDST 240
           DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSV             KSLVMYESLDST
Sbjct: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDST 240

Query: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300
           TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT
Sbjct: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300

Query: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREI 360
           NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREI
Sbjct: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREI 360

Query: 361 KSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATI 420
           KSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATI
Sbjct: 361 KSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATI 420

Query: 421 ERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMS 480
           ERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMS
Sbjct: 421 ERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMS 480

Query: 481 FTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIV 540
           FTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIV
Sbjct: 481 FTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIV 540

Query: 541 KAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELME 600
           KAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELME
Sbjct: 541 KAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELME 600

Query: 601 RFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKS 660
           RFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKS
Sbjct: 601 RFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKS 660

Query: 661 ELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713
           ELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ
Sbjct: 661 ELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/713 (79%), Positives = 627/713 (87%)

Query: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60
           MSQS  L++LPIFQASLSASQSPRYIF+SQNGTRIVFIQDNIIRWYNVLTD  YHSL+ S
Sbjct: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120
           RHLVLDDTFHVISSTSGDLLC FND EIFVMEVPWGYSNVE++SIQDAFQ+FHYS+DE E
Sbjct: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120

Query: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180
           +GPKS IKKVLFHPKSY DSCIVVLKE+DTI MFDILN QEKPI+LNKPNNSFGLDAR+N
Sbjct: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180

Query: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDST 240
           DITDL FSKDGLTLYCLNTTEGGDIFAFYPFLPS              KSLVMYESLD T
Sbjct: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240

Query: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300
           TDV VKRN+IKQLQFVSKLHENW+S+  KVDI  EYRL KVQGPFTINPFP ELYDYTA 
Sbjct: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300

Query: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREI 360
           NIATI IDN QNEI C+SFDDGSLILL KDLEMSMSWDV NYVYN+SLVLIERVK+Q+EI
Sbjct: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI 360

Query: 361 KSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATI 420
           +SLITLPEQ+GKLYV S N + QVN  SW ST+SKCINESDLNPL  LKFESK+E+IAT+
Sbjct: 361 ESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV 420

Query: 421 ERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMS 480
           E +PNLA+I WN+ SNLAL SNK LTFQ +S D K QST  ET I TE+S      +++ 
Sbjct: 421 EGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELR 480

Query: 481 FTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIV 540
           FTQP++EIL LN+NFQ+ACISPCE+IIPS DRQIPLKNEASENQLEIFTD+SKEFLQ+I 
Sbjct: 481 FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIA 540

Query: 541 KAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELME 600
           KAQ+LGVSI+NRIHEQQ ELTRQLQSTCKIISKD DLR+KFEAQNKKWDAQ+ RQS+LME
Sbjct: 541 KAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLME 600

Query: 601 RFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKS 660
           RFSKL++ LS+I++SNKFKEK IS+ EM+WFKEIRNQILQFN +VHSQKSLQQDLSYLK 
Sbjct: 601 RFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKR 660

Query: 661 ELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713
           ELTRIE ETI+VDKKSQ+EW+ELRKMLEIDSKIIKECNEEL   SQ+ TTKTQ
Sbjct: 661 ELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/718 (73%), Positives = 614/718 (85%), Gaps = 5/718 (0%)

Query: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60
           M QS  L+ALPIFQASLSA+QSPRYIFSS NGTR+V IQD+IIRW ++LTD  YHSLNFS
Sbjct: 1   MPQSDSLAALPIFQASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120
           RHLVLDDTFH ISS SGDLLC ++D EIFVME+PWGY N+ DVSIQDAFQ+FHYS+DE E
Sbjct: 61  RHLVLDDTFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELE 120

Query: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180
           +G  S IKKVLFHPKSY DSCIVVLK DDTITMFDILN QE PI+LNK N+SFGLDARVN
Sbjct: 121 LGSNSPIKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQEAPIILNKRNSSFGLDARVN 180

Query: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDST 240
           DITD  FSKDGLTLYCLNTTEGGDIFAFYPFLPSV             KSLVMYESL++T
Sbjct: 181 DITDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNAT 240

Query: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300
           TD  VKRN+ KQLQFVSKLH+NW+S+  KV I  EYRL K+QGPFTINPFP ELYD+TA+
Sbjct: 241 TDYKVKRNITKQLQFVSKLHKNWDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTAS 300

Query: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKL-QRE 359
            I TI IDN QNEIVCVSFDDGSLI+LF+DLEMSMSWDVDNYVYNNSL+LIER+KL Q+E
Sbjct: 301 KITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQKE 360

Query: 360 IKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIAT 419
           +KSL  LP+QLGKLYV  ++ + Q++  SW S LSKCI+ESDLN LA +KF SK EDIAT
Sbjct: 361 MKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFEDIAT 420

Query: 420 IERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAA----ETSISTEKSDTVGD 475
           I ++ N AYINWND+S+LAL+S + LT QNIS+  K QS  A    +T+++++KSDT   
Sbjct: 421 IHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKSDTGKR 480

Query: 476 GFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEF 535
           G+++SFTQPINEIL LN++FQK C+SPCERIIP ADRQ+PLKNEA+ENQLEIFTDISKEF
Sbjct: 481 GYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEF 540

Query: 536 LQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQ 595
           L++I+KAQ+LGVSI+NRIHEQQFELTRQLQST KII+KD+ L++K EAQ +KW++Q SRQ
Sbjct: 541 LRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQ 600

Query: 596 SELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDL 655
           +ELM RF KL++ LS++AES+KFKE+ ISHGEM+WFKEIRNQILQFN FVHSQKS+QQDL
Sbjct: 601 AELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDL 660

Query: 656 SYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713
           SYLK EL RIE+ETI  DKKSQNEWDELRKMLE+DSKIIKECNEEL+ VSQ+ TTKTQ
Sbjct: 661 SYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTTKTQ 718

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/714 (73%), Positives = 601/714 (84%), Gaps = 2/714 (0%)

Query: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60
           MS+S+ L ALPIFQASLSASQSP YIFSS NGTR+VFIQDNIIRW N LT+S Y SL+FS
Sbjct: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120
           RHL+LDDTF VISS SGDLL  FN  EIFVMEVPWGY+N+E+ S+QDAFQ+FHYS+ + E
Sbjct: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120

Query: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180
            G +S IKKVLFHPKSY DSCIVVLKEDDTITMFDILN Q KPIVLNK +NSFGLDARVN
Sbjct: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180

Query: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDST 240
           DITDL FS+DGLTLYCLNTTEGGD+FAFYP LP V             KSLVMYESLDST
Sbjct: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240

Query: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300
           TD+ VKRN+IKQLQ VSKLHEN +S+ GKV+I +EYRL K+QGPFTINPFP ELY+YTA 
Sbjct: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300

Query: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQR-E 359
           NI TI IDN QNEIVCV FDDGSL LLF+DLEMSMSWDVDNYV+NNSLVLIER+K+Q  +
Sbjct: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360

Query: 360 IKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIAT 419
           IKSL TLPE+LGKLYV S+N + Q++  +W++ LS+CI ESDLN L  +KFESKLE+I T
Sbjct: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420

Query: 420 IERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKM 479
           IE   NLAYI+WND SNL L +   LTFQNIS+D + Q+T  + +  +++ D  G  ++M
Sbjct: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRID-AGKHYEM 479

Query: 480 SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRI 539
           SFTQPINEIL LN++FQKACISPCE+IIP A RQ+PLKNEASENQLEIFT ISKEFLQ+I
Sbjct: 480 SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKI 539

Query: 540 VKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELM 599
           +KAQ+LG SI+NRI EQQFELTRQLQ+T KIISKD DL+ K  AQNKKWDAQ+SRQ +LM
Sbjct: 540 IKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLM 599

Query: 600 ERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLK 659
           ERF KL++ LSQIAES K +EK I+ GEMKWFKEIRNQILQFN+FV SQKSLQQDLSY+K
Sbjct: 600 ERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMK 659

Query: 660 SELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713
            ELTRIEAETIK D+K+QNEWDELRKMLE DSKIIKECNEEL+ VSQ+ TT TQ
Sbjct: 660 KELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQ 713

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  530 bits (1366), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 289/699 (41%), Positives = 429/699 (61%), Gaps = 22/699 (3%)

Query: 18  SASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSG 77
           ++  S R++ +SQ+G+++V  QD+ IRW N   DS Y  +       ++D  HV+ S +G
Sbjct: 12  ASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TIEDVEHVVLSPTG 68

Query: 78  DLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSY 137
            LL L+N  E+ ++E+PWGYS V      + FQ F YS+D  +      IKKVLFHP +Y
Sbjct: 69  TLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQ---DPLIKKVLFHPLAY 121

Query: 138 RDSCIVVLKEDDTITMFD---ILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTL 194
           R+ CIV+LK D+TI + D     + Q K +VLN+ + +FG++  V DI  + FS+DGLTL
Sbjct: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181

Query: 195 YCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIVKRNVIKQLQ 254
           Y L+  EG DI+AFYP LP               KSLV YE+L   T    KRN IKQ Q
Sbjct: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241

Query: 255 FVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEI 314
           F+SKL +   +   K+DI  ++   + QGPFTI PFP   YD TA  +  + I    N++
Sbjct: 242 FISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPI-GANNDL 300

Query: 315 VCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLY 374
           + +SFDDG++++L++DLE++M WD   Y YNNSLVL+E ++L+R    L+     L + +
Sbjct: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLER--GELVLKQGTLSQFF 358

Query: 375 VISDNI-IQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWND 433
           V+     I  V+   W+  LS CI+ SDL P+A L+F+S++  I  + +I + A    + 
Sbjct: 359 VLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKDT 418

Query: 434 QSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMSFTQPINEILILND 493
           +     +S  T+  ++ + + +P +   E     +K++     ++++  QP++EIL LN 
Sbjct: 419 EPKDVFVSKDTVFVKSTAVNDQPSTVKDE-----KKANVDIPRYEVALNQPMSEILSLNA 473

Query: 494 NFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRI 553
           +FQ     P  +++  + RQ  L NE++E QLEI T +SKEFLQ+IVKAQ LG ++HNR 
Sbjct: 474 SFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRC 533

Query: 554 HEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIA 613
            EQQ+ELTRQLQ + +I+SK D LR K ++Q+ + ++++ RQ +L++RF+ LS+KL +I 
Sbjct: 534 LEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRIN 593

Query: 614 ESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTRIEAETIKVD 673
           ES KF+E  I+  EM WFKEIRNQ+L FN +VH QK+ Q  L YL+ EL  I  E   V 
Sbjct: 594 ESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVG 653

Query: 674 KKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKT 712
           +KS++EW EL  +LE D+KIIKECN +L   S E    T
Sbjct: 654 EKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  531 bits (1367), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 290/725 (40%), Positives = 454/725 (62%), Gaps = 36/725 (4%)

Query: 1   MSQSSRLSALPIFQA-SLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNF 59
           MS    +++ PIFQ    +   +PR++F+S +GTR+V +Q  ++RW +V T S ++S+  
Sbjct: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSV-TASSFNSMTI 59

Query: 60  SRHLVLDDTFH--------VISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQI 111
                  D F          I S SG+ +C++ ++ I V+E+PWGY      S+   FQ+
Sbjct: 60  -------DFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYV-TPSPSMVSKFQL 111

Query: 112 FHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNN 171
           F Y+  +++    S IK+VLFHP++Y+DSC+VVL ++ TI++ D+     K I LNK   
Sbjct: 112 FSYNNKDDD--GYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRVA 168

Query: 172 SFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSL 231
           +FG+D ++ DI  + FSKDG TLY L+ ++GGDI+AFYP LP               +S+
Sbjct: 169 TFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESV 228

Query: 232 VMYESLDSTTDVIVKRNVIKQLQFVSKLH-------ENWNSRFGKVDIQKEYRLAKVQGP 284
           ++YESL   TD  VKRNVI+Q+QFV+KL+       +N N  F  ++I++EYRL + QGP
Sbjct: 229 LLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDF--IEIEQEYRLIRGQGP 286

Query: 285 FTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVY 344
           FTI+P+P  LY  TA  I+T+ I N  NE++C+ FDDGS+ LLFKDL ++MSWDVDNYV+
Sbjct: 287 FTIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVH 345

Query: 345 NNSLVLIERVKLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLN 403
           NNS  L+E ++L+  ++K +++ P+  G+ ++  D+ +  V+   W+  L+K I+ S+LN
Sbjct: 346 NNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLN 405

Query: 404 PLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAET 463
            L  + F SKL+   T   I   +   W  +  +  ++ + +    +  +M+        
Sbjct: 406 ELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPV--EMRKSGILGNN 463

Query: 464 S-ISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASE 522
             +     +     +K SF QP+ E++ LN  FQ+ C     ++I   +RQ+ L NE +E
Sbjct: 464 KPVLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNE 523

Query: 523 NQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFE 582
            QLE+ +D+SKE + +I + Q L +++H+R+ EQQ+ELTRQL+    I+SK  DLRRK E
Sbjct: 524 VQLELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSE 583

Query: 583 AQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFN 642
            Q+++WD Q SR S+L++R   L  K+ +I  S K KE  I+  E++WFKEIRNQ+L+FN
Sbjct: 584 EQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFN 643

Query: 643 SFVHSQKSLQQDLSYLKSELTRIEAETIKV-DKKSQNEWDELRKMLEIDSKIIKECNEEL 701
           SFVH+Q+  Q++L++LK +L RI  ET ++ D+KS  EWDELR +L+ D++II+ECN+EL
Sbjct: 644 SFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKEL 703

Query: 702 LQVSQ 706
           L  ++
Sbjct: 704 LSTTE 708

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  518 bits (1335), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/728 (39%), Positives = 442/728 (60%), Gaps = 33/728 (4%)

Query: 5   SRLSALPIFQASLSASQ-SPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHL 63
           S +++ PIF  S+  ++ S R+ F+S  GTR+V +Q  I++W NV+ D+ YHS+      
Sbjct: 6   SPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVI-DTTYHSMKVKS-- 62

Query: 64  VLDDTFHVIS---STSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120
           + ++   +I    S SGD LC++    I ++E+PWGY  + D  +   FQ FHY I    
Sbjct: 63  IFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDISSST 121

Query: 121 VGPKS--SIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDAR 178
               S   IK+VLFHPKSY ++C+V+L ED  I + D   S E  I +N+P  + G++ R
Sbjct: 122 SALSSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTE-TITINQPTGTLGVETR 180

Query: 179 VNDITDLEFSKD-GLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESL 237
           V DI  + F K  GL LY L+ ++GGDI+A YP LP+              KS+V+Y+SL
Sbjct: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240

Query: 238 DSTTDVIVKRNVIKQLQFVSKLHENW-----------NSRFGK------VDIQKEYRLAK 280
                  VKRNVIKQLQF +KL   +            +R  +      +D+  EYRL  
Sbjct: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300

Query: 281 VQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVD 340
            QGPFTI+PFP ELY  TA     + I N  NE++ ++FDDGS+ LLF+DLE++MSWD+ 
Sbjct: 301 FQGPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIA 359

Query: 341 NYVYNNSLVLIERVKLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINE 399
           NY+++NS  L+E +KL+  +I  LI   +  GK +++SD++I  V+  SW+  L+K I++
Sbjct: 360 NYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDD 419

Query: 400 SDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQST 459
           S+LN L+ + FES++     + +  N     ++ + ++  +S+  +  +N++      + 
Sbjct: 420 SNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNI 479

Query: 460 AAETSISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNE 519
              +S S    +T    +K++F QPI+E++ LN+ FQK C  P  ++I   DRQI L NE
Sbjct: 480 KG-SSTSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNE 538

Query: 520 ASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRR 579
           ++E QLEI TD+SKE + +I+  QTLG ++HNR+ EQQ ELTRQL+ T  +  K D ++ 
Sbjct: 539 SNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKN 598

Query: 580 KFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQIL 639
           K +   K+W+ QL+R  +L +R   L++KL  I +S       I+  E++WFKEIRNQ+ 
Sbjct: 599 KNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVH 658

Query: 640 QFNSFVHSQKSLQQDLSYLKSELTRIEAE-TIKVDKKSQNEWDELRKMLEIDSKIIKECN 698
           +FNSFVH+Q+   ++LS+LK EL RI  + T  VD+KS+ EW+ELR +LE DSKIIKECN
Sbjct: 659 KFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECN 718

Query: 699 EELLQVSQ 706
            EL + ++
Sbjct: 719 IELTKTTE 726

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  509 bits (1312), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 281/702 (40%), Positives = 429/702 (61%), Gaps = 39/702 (5%)

Query: 11  PIFQASLSA-SQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69
           PIF+ SL+A S S R+  ++ +G R V +QD+ IRW NV ++  YHS+   R     D  
Sbjct: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNV-SEPGYHSMTLER--AFKDVK 63

Query: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKK 129
           HV+ S SG+ LCL+ND+E+ ++EVPW Y+ V   S+ +AFQ+F +  DE      + IK+
Sbjct: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVS--SMANAFQLFRFVSDE------ARIKQ 115

Query: 130 VLFHPKSYRDSCIVVLKEDDTITMFDILNSQE----KPIVLNKPNNSFGLDARVNDITDL 185
           VLFHP +Y+   +V+LK+DD+IT   I+N Q+    KP VLN  N ++ LD+ + D+  +
Sbjct: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172

Query: 186 EFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIV 245
            FS+DGLTLY L+ +EG DI+AFYP L                KSL+ Y+ L+  TD  V
Sbjct: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232

Query: 246 KRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATI 305
           KRN IKQL+FVS LH+  NS+   ++I +  R  + QGPFTI PFP ++Y  T T IA++
Sbjct: 233 KRNTIKQLKFVSGLHKQQNSQ-RILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291

Query: 306 LIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKL-QREIKSLI 364
            I N QNE++ +S DDG++ +L +DL+++M+WD   Y YNNS  L+E + L  +EI+ ++
Sbjct: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350

Query: 365 TLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIP 424
               + G+  V++   +  ++   W+  ++ C+ ESDL PLA  K ES++      +   
Sbjct: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410

Query: 425 NLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVG-----DGFKM 479
           ++A+ N   QS +  +SN+ +  + +S             +S +  D  G     + +  
Sbjct: 411 SVAWWNTTPQS-VVKVSNREVKSKQVSE-----------GVSKQDDDITGSRQEPEKYNA 458

Query: 480 SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRI 539
            ++QPI EI+ LN  FQ        ++IP  +RQ PLKNEASE QL++ T+ SK+F+ +I
Sbjct: 459 HYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKI 518

Query: 540 VKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELM 599
              QTLGV++HNRI+EQQ +LT QL+++ +++ K   +   F +Q+ + DA  +R S LM
Sbjct: 519 AVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLM 578

Query: 600 ERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLK 659
            RF+K    L QI  S +FK+ +IS  E++WFKEIR Q+L FN  VH+QK LQ  L +LK
Sbjct: 579 SRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLK 638

Query: 660 SELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEEL 701
            E+ RI   T   + ++++EW ELR MLE D+ I+++CN +L
Sbjct: 639 QEMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQL 680

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  494 bits (1273), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 264/676 (39%), Positives = 426/676 (63%), Gaps = 31/676 (4%)

Query: 41  NIIRWYNVLTDSLYHSLNFSRHLVLDDTFH--VISSTSGDLLCLFNDNEIFVMEVPWGYS 98
           N +RW +V + S YHSL     L  DD+ +  VI S SG  LCL++   + ++E+PWGY 
Sbjct: 52  NQLRWGSVAS-SQYHSLPL---LFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYD 107

Query: 99  NVEDVSIQDAFQ-IFHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDIL 157
                SI+ +FQ +F       +V   S IKK+LFHPK+  D C+V+L E+D I +FD+ 
Sbjct: 108 GAV-TSIKSSFQRVFR------DVNKSSDIKKILFHPKAADDGCVVILFENDVICLFDLR 160

Query: 158 NSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXX 217
            S++  + LNK  N  G++ RV DI D+EFS+DGLTLY L+ T+GGDI+AFYP LP    
Sbjct: 161 KSEK--LFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLS 218

Query: 218 XXXXXXXXXXXKSLVMYESLDSTTDVIVKRNVIKQLQFVSKLHENWN--SRFGKVDIQKE 275
                      KS ++Y+SLDST  + V++NV+KQ++F++ L ++ +  ++   ++I  +
Sbjct: 219 LKKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSDETKNSCLEISND 278

Query: 276 YRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSM 335
           +R  K QGPFT+ P+P +LY+ TA  I T+ I N  NE+  ++FD+G++ LL KDLE+SM
Sbjct: 279 FRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNN-NELFAITFDNGTVTLLLKDLELSM 337

Query: 336 SWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNI-IQQVNFMSWASTLS 394
           SW+ DNYVYNNS VLIE V++  E   L+      G++++  ++  +++++  +W+  +S
Sbjct: 338 SWNADNYVYNNSFVLIESVEMGPESIKLLKSSSLTGQMFISQNHSSVRKIDTTAWSFKVS 397

Query: 395 KCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISSDM 454
           KCI  SDL  L  + F+SK+ D+   E +      +   +  +  +SN ++  + +    
Sbjct: 398 KCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNSSVISRTL---- 453

Query: 455 KPQSTAA------ETSISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIP 508
            P+S ++      E S S    D V   +++SFTQPI+EI+ LND+FQ+ C  P ++II 
Sbjct: 454 -PESDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHPFKKIIS 512

Query: 509 SADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTC 568
             +RQ  L N+++E QL   T+IS + +  IV+ Q+LG+ + NR++EQQ+ELT+QL+ + 
Sbjct: 513 PEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLKESI 572

Query: 569 KIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEM 628
           ++I K   L+  ++ +  +W+  L +Q EL++RF+ L+  L++I ES +  +  IS  E+
Sbjct: 573 QLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTPISEKEV 632

Query: 629 KWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLE 688
           +WFKE+RNQIL+FN FVH  +++Q+ +++L+  L+RIE++  +      +EW E +K+LE
Sbjct: 633 EWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQRSSHLTSEWAEFKKILE 692

Query: 689 IDSKIIKECNEELLQV 704
            D+ IIKECNEEL + 
Sbjct: 693 TDTNIIKECNEELTKA 708

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  447 bits (1151), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 269/729 (36%), Positives = 417/729 (57%), Gaps = 54/729 (7%)

Query: 2   SQSSRLSALPIFQ--ASLSASQSPRYIFSSQNGTRIVFIQ--DNIIRWYNVLTDSLYHSL 57
           S S  +   PI Q  A L +  S RY+F++  GT+ V++   + ++RW +V  D  Y+S+
Sbjct: 15  SVSQLMGQRPILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDE-YNSM 73

Query: 58  NFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSID 117
                   D + +VI S SG+ LC+++ + + V+EVPW Y N E++S      +F  S  
Sbjct: 74  PLKISNFADKSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSY-----VFQTSF- 127

Query: 118 EEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDA 177
            +E+   S IKKVLFHP++ + +C+V+L EDDTI +FD+ ++ +  I LN P+ + G++ 
Sbjct: 128 -KEIRKDSFIKKVLFHPRAIKKTCMVILFEDDTIYLFDVEDNNK--IALNVPSGNIGIED 184

Query: 178 RVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESL 237
           R+  I D+EFS+DGLTLY L+  + GD++A YP LP +             +S+++Y+SL
Sbjct: 185 RITSIADIEFSQDGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSL 244

Query: 238 DSTTDVIVKRNVIKQLQFVSKLHENWNSRFGK------VDIQKEYRLAKVQGPFTINPFP 291
             TT   VK+ VIKQ++F+S+L    N   GK      ++I   YRLAK QGPFTI PFP
Sbjct: 245 TETTPSAVKKGVIKQVEFISQLQ---NISHGKEEISNVLEIDTIYRLAKPQGPFTIAPFP 301

Query: 292 GELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLI 351
            +LY  TAT I  + I  G NEI+C+++D+G+ + LFKDLE+SM+WDV    YNNSLVL+
Sbjct: 302 EKLYSATATEICPLNIGGG-NEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLM 360

Query: 352 ERVKLQRE----------IKSLITLPE--------------QLGKLYVISDNIIQQVNFM 387
           E   LQ E          +  LI                  Q G L V   ++I+ V+  
Sbjct: 361 EEFDLQTESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTK 420

Query: 388 SWASTLSKCINESDLNPLAGLKFESKLEDIATIER-IPNLAYINWNDQSNLALMSNKTLT 446
           +W+S +S CI+  D+N L  + F+SK    A     I +    N      +  ++NK++T
Sbjct: 421 AWSSVVSDCIDRHDINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVT 480

Query: 447 FQNISSDMKPQSTAAETSISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERI 506
            + +    K  S   E S S+EK        K  F+ PI+E+  LN N+Q  C      I
Sbjct: 481 CKELK---KQVSWKPEQSTSSEKKKQAFP--KPEFSVPISELNALNINYQDTCRIGFHDI 535

Query: 507 IPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQS 566
           I   DRQ PL N ++E QL++ T +S   L  + K Q LG++++NR+ EQQ ELT+QLQ 
Sbjct: 536 ISPLDRQKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQC 595

Query: 567 TCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHG 626
           + KI+ K   + +K E Q   W+ +L++Q++L ERFS L +KL+ I ++ K  +  I+  
Sbjct: 596 SNKILMKQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDE 655

Query: 627 EMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKM 686
           E  WFKE++ + L FN  V+ Q+S+Q DL +LK EL+   +++ ++   +  EW  L++M
Sbjct: 656 ESVWFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEM 715

Query: 687 LEIDSKIIK 695
           L+ DS +++
Sbjct: 716 LKHDSLLLR 724

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  429 bits (1103), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 271/723 (37%), Positives = 413/723 (57%), Gaps = 62/723 (8%)

Query: 11  PIFQ-ASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69
           PIFQ  S+     P+ + ++Q+G R+V IQ + IR        L  S N S++ +++   
Sbjct: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIR--------LCSSGN-SQYQIIECGI 57

Query: 70  HVISST----SGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFH-YSIDEEEVGPK 124
           + ++      SG LLC +N+ E+ V+ +P  +     VS        H Y+I       K
Sbjct: 58  NTVAGAALNNSGTLLCAYNETELQVIVLPSPF-----VSSHGGILKPHTYNIT-----VK 107

Query: 125 SSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNS--QEKPIVLNKPNNSFGLDARVNDI 182
           S IK+V +HP+   DS  VVL +DDTI M+++ N   Q+   VLN   N  G+ + + DI
Sbjct: 108 SPIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDI 167

Query: 183 TDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTD 242
             + FSKDGL LY LN++EGGD++A YPFLPSV             KS + YE+L S   
Sbjct: 168 ESMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDS 227

Query: 243 VIVKRNVIKQLQFVSKLHENWNS------RFGKV--DIQKEYRLAKVQGPFTINPFPGEL 294
             VKRNVIKQLQFVS+LH+ + S      R G +  +IQ+ YR AK+QGPFTINPF  +L
Sbjct: 228 PTVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKL 287

Query: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERV 354
           Y  TAT I T+ ID   NE++ V FD+G+++  F+DL++SM W+  +   NNSLV++E +
Sbjct: 288 YSATATQITTMPIDEF-NELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESL 346

Query: 355 K-LQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413
             L  +I  L   P +   L   S      V+   W   LS+CIN S+L  L+ +  +S 
Sbjct: 347 DILSGQIICLT--PHKFAVLGPKSF----VVDSSEWTKALSECINFSNLEVLSQINIKST 400

Query: 414 LEDIATIERIPNLAYIN---W--NDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTE 468
           +  +       N A+     W  N +  L  MS+K+     + S   P+    + ++S  
Sbjct: 401 ITPV-------NGAFTQAGLWESNGEKQLIFMSDKS-----VKSITLPEPNKTKDAVSKT 448

Query: 469 KSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIF 528
                   ++  F+QPI EIL+LN  FQ  C    + +IP     +PL+N+++E+QL + 
Sbjct: 449 VQPVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALL 508

Query: 529 TDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKW 588
           TDISKE   +I++ QTLG+ IHNR+ EQ++ELTRQL+ + +I+ K   L+ ++  QN +W
Sbjct: 509 TDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRW 568

Query: 589 DAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQ 648
           +    +Q  +  RF KL  +L++I+ S K K+  IS  EM+WFKEI++Q+  FN FV  Q
Sbjct: 569 EHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQ 628

Query: 649 KSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEF 708
           + +++ L +++SEL    A   +V K+   +W EL+++L +DS+IIKECNE L++ ++E 
Sbjct: 629 QDVKEQLEFVQSELKT--AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686

Query: 709 TTK 711
             K
Sbjct: 687 DEK 689

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  427 bits (1098), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 274/720 (38%), Positives = 418/720 (58%), Gaps = 34/720 (4%)

Query: 11  PIFQ-ASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69
           PIF+  S+S   + R+ FS+ NGTRI+  QD+ IRW     +  Y S+   R   +D T 
Sbjct: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVTG 65

Query: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVS--IQDAFQIFHYSIDEEEVGPKSSI 127
            +IS   GD LCL+N ++I V+E+PWG +NV+++S  +  + Q   Y+ +E+    K S+
Sbjct: 66  AIISD-PGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNED----KLSV 120

Query: 128 KKVLFHPKSYRDSCIVVLKEDDTITMFDILN---SQEKPI--VLN-KPNNSFGLDARVND 181
           K+VLFHP S     +VVL     I   D+ N   S + PI   LN   +N  G+D RV +
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 182 ITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTT 241
           I  + F+ D L+LY L  T   D++ FYP LP V             KS+V+YE+L    
Sbjct: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237

Query: 242 DVIVKRNVIKQLQFVSKLH------ENWNSRFG-KVDIQKEYRLAKVQGPFTINPFPGEL 294
           D IV++NVIKQLQ  S L       EN N      V+I  E+R  K QG F+I+P+P  L
Sbjct: 238 DDIVRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESL 297

Query: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERV 354
           Y  T   I+ + I  G NE+  VSFD+G+++++FKD E +MSWDV++Y +NNS  L+E +
Sbjct: 298 YTCTGKQISVLPIGEG-NELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356

Query: 355 KLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413
           K +  E+ +++ L  +LGK  V  +     V+   W+S +SKCI ++DL PL GL+ +S 
Sbjct: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416

Query: 414 LEDIATIERIPNLAYINWNDQSNLALM-SNKTLTFQNISSDMKPQSTAAETSISTEKSDT 472
           +  I +  +I +    N  +  +L L+ +N  + +Q    +++ +  +AE  ISTE  + 
Sbjct: 417 ITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAE-EISTELENF 475

Query: 473 VGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDIS 532
             D     FT P NE+   N  FQ+A   P  ++IP+  +Q+P  + A E QL+I  DIS
Sbjct: 476 TLD----KFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDIS 531

Query: 533 KEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQL 592
           ++   +IV+ Q+LG+ +++R+ EQQ +L+ QL  T KI+ +   ++  + AQ  K D +L
Sbjct: 532 RDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKL 591

Query: 593 SRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQ 652
            +Q  L +   K+   L+ I ES K K   +S  E++ FKE+R+QIL FN+FVH QK  +
Sbjct: 592 KKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQK 651

Query: 653 QDLSYLKSELTR-IEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTK 711
           Q++ +LK EL + I+    +  K   NEW+ELR++L  D+KIIKECNE+L Q+S+E  TK
Sbjct: 652 QNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTK 711

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  384 bits (987), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 254/720 (35%), Positives = 390/720 (54%), Gaps = 43/720 (5%)

Query: 11  PIFQAS-LSAS---QSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNF-SRHLVL 65
           PIF+ + LS+S    SPR+ F++    R+V +QD  IRW    + + YHS    SR+  +
Sbjct: 19  PIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQN-YHSYTIASRNFDI 77

Query: 66  DDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKS 125
            D+   + S SG  +C ++D +I +ME+PW +SN  + S     Q + YS  +  +    
Sbjct: 78  KDS---LISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSL---- 130

Query: 126 SIKKVLFHPKSYRDSCIVVLKEDDTITM------FDILNSQEKPIVLNKPNNSFGLDARV 179
           ++K+VLFHP +  +SC+VVL  DDTI        FD+L+S     +LNK + S GL +++
Sbjct: 131 TVKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSD---YILNKKSKSIGLSSQI 187

Query: 180 NDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDS 239
           +DI  L FS+DGLTLY L+++   D++AFYP LP               KS+V YE L  
Sbjct: 188 SDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELRE 247

Query: 240 TTDVIVKRNVIKQLQFVSKLH--------ENWNSRFGKVDIQKEYRLAKVQGPFTINPFP 291
                +K N+IKQL+F S L+        E+ +S+  K D+  EYRL + QGPFTI+PFP
Sbjct: 248 DDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFP 307

Query: 292 GELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLI 351
             LY  + T+I ++ ID   NE++ +SF DGS++ LF+DLE++MSWD DN+  NNSLVL+
Sbjct: 308 DSLYYSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLL 366

Query: 352 ERVKLQRE-IKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKF 410
           E +K + + I+ L T   Q G  Y++      +V    W+STL+ CI  SD+  L+ L  
Sbjct: 367 ELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLI 426

Query: 411 ESKLE--DIATIERI-------PNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAA 461
           +S ++  D A  E         P ++ + + ++S +  ++ K     +  +     S  A
Sbjct: 427 KSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHLLTSELA 486

Query: 462 ETSISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEAS 521
           +  I   +         M     I+++  +N  F++         IPS +R + L N+ +
Sbjct: 487 QKYIPPLEDKIFKIELPMGIL--ISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTN 544

Query: 522 ENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKF 581
           ENQLE  T ISK    +I   Q+LG  I+N+I +QQ  +  QL+ T +++ K+  L  K+
Sbjct: 545 ENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKY 604

Query: 582 EAQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQF 641
             Q  K  A   RQ +LM R   +++KL +           IS  E+++FKEIR Q+L F
Sbjct: 605 NEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLF 664

Query: 642 NSFVHSQKSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEEL 701
           N FVH QK     L ++K EL RI+ E   VD+    +WD LR ML  D+  I+ C E +
Sbjct: 665 NEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESI 724

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  363 bits (933), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 238/721 (33%), Positives = 394/721 (54%), Gaps = 47/721 (6%)

Query: 16  SLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVL-TDSLYHSLNFSRHLVLDDTFHVISS 74
           S+    S R   +  NG +I+  Q+N +R+  V   D  + S+   + ++ D    +I+ 
Sbjct: 14  SVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGD--VSIIAD 71

Query: 75  TSGDLLCLFNDNEIFVMEVPWG-YSNVEDVSIQ--DAFQIFHYSIDEEEVGPKSSIKKVL 131
             G+ LCLFN+ EI V+E+PW  +   ED S Q  +  QI  Y  D +  G  ++I+K+L
Sbjct: 72  QIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSY--DLKSFG--TTIQKIL 127

Query: 132 FHPKSYRDSCIVVLKEDDTITMFDI---LNSQEKP---IVLNKPNNSFGLDARVNDITDL 185
           FHP      C+VVL ++  I   DI   L  +E P   I         GL + ++DI D+
Sbjct: 128 FHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIIDI 187

Query: 186 EFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIV 245
            FS D L+LY L  T   DI+ FYPFL                KS++++E+L++ +   V
Sbjct: 188 SFSSDKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAV 244

Query: 246 KRNVIKQLQFVSKLHENWNSRFGKV-----------DIQKEYRLAKVQGPFTINPFPGEL 294
           +RN+IKQLQ +S L  +  ++  +V           DI  EYR    QG F+I PFP EL
Sbjct: 245 RRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEEL 304

Query: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERV 354
           Y  +A N++ I I +G NE+  +++DDG++++L++DLE SMSWD ++Y +NNS +L+E++
Sbjct: 305 YKQSAVNLSVIQIGHG-NELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKL 363

Query: 355 KLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413
           K    E KS++ +P + G   +  D  +  ++   W+  LS+CI ++D+  LAGL  ES 
Sbjct: 364 KFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESH 423

Query: 414 LEDIATIERIPNLAYINWNDQSN--LALMSNKTLTFQNISSDMKPQSTAAETSISTEKSD 471
            + I T+E  PN + I WN+ +   L  ++   L    ISSD+   +  +   +     +
Sbjct: 424 KQTINTLEE-PN-SCILWNEHNKKELLFITETKL----ISSDILESNNESAEKLPVPAIN 477

Query: 472 TVGDGFKM---SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIF 528
            +    K+   +++QPI EI I    ++ +C  P  ++IP+  RQ P  N+ +E+QL   
Sbjct: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537

Query: 529 TDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKW 588
           T+IS+E   +I++ QT+ + +H R+ EQQ     QL  T K +  +  +++ ++ Q+ K 
Sbjct: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597

Query: 589 DAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQ 648
                R ++L ER SKL + + +I +S ++K   I+  E K FKEI+ Q+L FN  V+ Q
Sbjct: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657

Query: 649 KSLQQDLSYLKSELTRIEAETIK----VDKKSQNEWDELRKMLEIDSKIIKECNEELLQV 704
           +  Q+ + +L++EL  I  +  +    +    ++EW+EL  +L  D+KII++CN EL   
Sbjct: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717

Query: 705 S 705
           S
Sbjct: 718 S 718

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  361 bits (926), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 226/712 (31%), Positives = 369/712 (51%), Gaps = 47/712 (6%)

Query: 11  PIFQASL-SASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69
           PIF     S+ +S R++F+    ++   +Q N +RW +      Y  L F   +   D  
Sbjct: 7   PIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHE-YQYLEFEPRI---DYT 62

Query: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKK 129
            V+ + SG LLCL+N  ++ ++ V W  S  + + I                 P + IK+
Sbjct: 63  SVVINESGSLLCLYNSKQVQILAVSWDESKSDTILI----------------SPPAGIKQ 106

Query: 130 VLFHPKSYRDSCIVVLKEDDTITMFDILNSQ--EKPIVLNKPNNSFGLDARVNDITDLEF 187
            L+HP+    SC+ VL   D I ++++L     E   +LN      G+ + V DIT + F
Sbjct: 107 ALWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSF 166

Query: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIVKR 247
           S DGLTLY L+T+EG DI++ YP LPS              K+L+ Y+ L+      ++R
Sbjct: 167 SSDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRR 226

Query: 248 NVIKQLQFVSKLHEN---WNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIAT 304
            V KQLQFVSKL +     ++    V I K +R  + QGPFTINPFP  LY  T   +  
Sbjct: 227 KVTKQLQFVSKLQKKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEV 286

Query: 305 ILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLI 364
           I +     E++ +SFDDG+++  F D E  MSW+ + +  NNSL+++  V +  EI +L+
Sbjct: 287 IKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNIGGEI-ALV 345

Query: 365 TLPEQLGKLYVI-SDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERI 423
                 G  +V+ S   +  V+    A  +   +N+ D++           E +    R 
Sbjct: 346 N-----GYTFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSE--EVVEKNGRF 398

Query: 424 PNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMSFTQ 483
            +      +++S +AL+S  T +  +I   +   +    T++ T K+D   + ++  + Q
Sbjct: 399 CSAIICASSEKSCVALLSETTTSHIDIPFSL--DAPKMRTALGTAKTDV--EQYR-PYGQ 453

Query: 484 PINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQ 543
           P+NE+L LN+  Q     P +  +  + RQ  L NE++E+QL + T ISKE + RI  AQ
Sbjct: 454 PLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQ 513

Query: 544 TLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFS 603
           TL +S++ R+  QQ ELT+ L++  K+      + R+ + Q+ +W+A  ++   +  R  
Sbjct: 514 TLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLE 573

Query: 604 KLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELT 663
           ++S KL Q++ S KF+ + IS+ E++WFKEIR+Q+++FN  VH Q+SL   LS LK EL 
Sbjct: 574 QISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELE 633

Query: 664 RIEA-------ETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEF 708
            +          +   D K +  WDELR +L  D +II EC + L  V+++ 
Sbjct: 634 YVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQL 685

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  341 bits (875), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 233/699 (33%), Positives = 381/699 (54%), Gaps = 29/699 (4%)

Query: 16  SLSASQSPRYIFSSQNGTRIVFIQD-NIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISS 74
           + + + + R++FSS +GT+IV I D   +RW +  T + Y SL+F            +SS
Sbjct: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS-TSTTYKSLDFDLQFE-GKVEGAVSS 69

Query: 75  TSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHP 134
           T+ D +C++N +E+ V+EVPW YS  E+  ++    I+ +  DE       SIK+VLFHP
Sbjct: 70  TTADYVCIYNRDELHVLEVPWMYSGEEN-GLKHLCHIYSHKFDENH-----SIKQVLFHP 123

Query: 135 KSYRDSCIVVLKEDDTITMF--DILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGL 192
           KSY DS I+VL  DD+I M   D   S +  I LN  N++ GL  R+NDI  + FS+DGL
Sbjct: 124 KSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGL 183

Query: 193 TLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIVKRNVIKQ 252
           +L  L+  EG DIF  YP LP               KSL++Y +++  T    KRN++KQ
Sbjct: 184 SLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQ 243

Query: 253 LQFVSKLHEN---WNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDN 309
           L F+ K+      + +    + ++  Y  A+ QGPF++ P+P ELYD+ AT+I  I I  
Sbjct: 244 LNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQ 303

Query: 310 GQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQ-REIKSLITLPE 368
             + ++ ++F +G+++L   DLE  MSWD+  +  +NSL L+E++KL+  +    +++P 
Sbjct: 304 NIS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPG 362

Query: 369 QLGKLYVISDNIIQQ--VNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNL 426
             GK +V++DN+     VN   W++ L++ I++SD+  LA LK +S +E++  +      
Sbjct: 363 TYGK-FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK- 420

Query: 427 AYINWNDQ--SNLALMSNKTL----TFQNISSDMKPQSTAAETSISTEKSD--TVGDG-F 477
           + I W ++  S   ++S+K +        ISS  K +      S    K D   + +G +
Sbjct: 421 SIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLY 480

Query: 478 KMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQ 537
           ++ F +P+ EI      + K   +     IP   R  PLKN ++ENQLE  T IS+ +++
Sbjct: 481 EVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMK 540

Query: 538 RIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSE 597
            I  AQTLG     R+ +   E +RQ+++T +I    D+  +  E QN K D    +Q +
Sbjct: 541 MISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQK 600

Query: 598 LMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSY 657
           LMER S L  K+    E        IS  E +WF EI+  +++FNS+V    +  Q+L +
Sbjct: 601 LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF 660

Query: 658 LKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKE 696
           +K +  +I  +   +  ++  EW++L+++L  D KII E
Sbjct: 661 IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  335 bits (858), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 232/724 (32%), Positives = 373/724 (51%), Gaps = 63/724 (8%)

Query: 9   ALPIFQA-SLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSL---YHSLNFSRHLV 64
           A PIFQA SL  S+S R    +++ +R + ++ N ++W   L D+    Y  LN      
Sbjct: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKW--CLMDAPNYEYMELN-----A 57

Query: 65  LDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPK 124
           + +    + + SG LLCL N +EI V+ + W  +  E   I+                  
Sbjct: 58  ISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIK----------------VP 101

Query: 125 SSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNS--QEKPIVLNKPNNSFGLDARVNDI 182
           + +K+VL+HP+   DSC+ VL + D I ++++L+        VLN   N  G+ + V DI
Sbjct: 102 AGVKQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDI 161

Query: 183 TDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTD 242
             + FS DGLTLY ++ +EG D+F+ YP +PS              K+L+ Y+ L     
Sbjct: 162 ESVCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDS 221

Query: 243 VIVKRNVIKQLQFVSKLH-------ENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELY 295
             +K    +QL F+S L+       ++  +      I+K YR A+ QGPFTI+PFP +LY
Sbjct: 222 PELKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLY 281

Query: 296 DYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVK 355
             TA  I  I +++   E++ ++FDD +++  F DL   MSW+       NSL+ +  +K
Sbjct: 282 LATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLK 341

Query: 356 LQREIKSLITLPEQLGKLYV-ISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKL 414
           L   I SLI      G  +V IS      VN      ++ + +++ D   L+    E  L
Sbjct: 342 LPGSI-SLI-----YGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELS----EEDL 391

Query: 415 EDIATIERIPNLAYINWNDQS--NLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDT 472
            +  T ++    +   W +     + L+S K +T  +ISS   P S+  E     EKS+T
Sbjct: 392 TEEITEKKGTFQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTE---KIEKSET 448

Query: 473 VGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDIS 532
                +  ++QP++E+  LN   Q    SP   +IP+A RQ  L N  +E+QL + TDIS
Sbjct: 449 ---NRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDIS 505

Query: 533 KEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQL 592
           KE L R+  AQTLG+S+H R+  QQ EL + L+   ++ +K + +     +Q  +W+A  
Sbjct: 506 KEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQ 565

Query: 593 SRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQ 652
            +   +  RF  L + ++QI++S++ + + I+  EM+WFKE+RNQ+++FN  VH Q+ L 
Sbjct: 566 EKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLA 625

Query: 653 QDLSYLKSELTRIEAETIKVDKKSQNE--------WDELRKMLEIDSKIIKECNEELLQV 704
           + LS LK  L  +  ++ +   +S+          WDEL+ ML  DS+IIKEC  EL   
Sbjct: 626 EALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCT 685

Query: 705 SQEF 708
           +QE 
Sbjct: 686 TQEL 689

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  312 bits (800), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 213/709 (30%), Positives = 364/709 (51%), Gaps = 55/709 (7%)

Query: 11  PIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFH 70
           PIFQ     + S  ++   +N T+IV   D  +R+  V   +       S+HL +  + H
Sbjct: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFK-----SKHLDIKHSEH 61

Query: 71  VISSTSGDLLCLF--NDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIK 128
            I + SG L+  +  ND E+F M+   G  +   V                E+G    IK
Sbjct: 62  SILNNSGTLIAFYGSNDVELFDMD---GKKSCLRV----------------ELG----IK 98

Query: 129 KVLFHPKSYRDSCIVVLKEDDTITMFDIL--NSQEKPIVLNKPNNSFGLDARVNDITDLE 186
           +VL+HP +Y DSC+VVL +++TI ++++   N     +VLN+     G+ + V++I  + 
Sbjct: 99  QVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMA 158

Query: 187 FSKDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIVK 246
           FS DGLTLY L+  EGGD++A +P LPS              K+  +YES+D  T    K
Sbjct: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218

Query: 247 RNVIKQLQFVSKLHE--NWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIAT 304
             +I+   FVSK+++  + +S F  V+I +  R+   +GPF+I  FP ELY+ TAT + T
Sbjct: 219 IAMIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278

Query: 305 ILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNN--SLVLIERVKLQREIKS 362
           + +++    ++ +SFDDG+++ LF D+E+ MSW   +   NN  S VLIE+ +   EI +
Sbjct: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSW---SRSLNNACSFVLIEKFRAGGEIFA 335

Query: 363 LITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIER 422
           + +       + ++  N    V F  +   L +CI E D+ P+  +K  S +  +A    
Sbjct: 336 IES------GVAILEKNNAHIVRF-PYLKALGECIKEGDIAPMVDVKLTSDITPLAGSYH 388

Query: 423 IPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMSFT 482
                 + WN+ S   ++       ++I  D+   S       +  ++      + + F 
Sbjct: 389 ----TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGK----YTVCFP 440

Query: 483 QPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKA 542
             + E+L  N   Q     P   ++P   + +PL +E +E+QL   T IS E + RI+ A
Sbjct: 441 STMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILA 499

Query: 543 QTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERF 602
           Q+LG  ++NR   QQFEL RQL++  K+  +   L++  ++   + D+   +   L  R 
Sbjct: 500 QSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRL 559

Query: 603 SKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSEL 662
            KL + L ++ ES KF E  +S  E  WF+E++N +L FN +V     L ++L++LK EL
Sbjct: 560 EKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKEL 619

Query: 663 TRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTK 711
             IE+    +  +    +++L+ +L +DSK+I +CN++LL  +++   K
Sbjct: 620 ELIESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLENK 668

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  283 bits (724), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 206/709 (29%), Positives = 349/709 (49%), Gaps = 53/709 (7%)

Query: 11  PIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFH 70
           PIF A    +    +  +  +GT+IV   +  +R     T+  Y S     H  +D    
Sbjct: 7   PIFNADALGASHRLHAHTHGDGTKIVGYYNKHLR-LGRFTEQTYKSW----HAEVDAKAS 61

Query: 71  VISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKV 130
            I + SG LL  + D+ I V++             ++  +I         +     IK+V
Sbjct: 62  SILNGSGSLLAFYGDHIIEVVD-------------REGKKI--------TLTVNGGIKQV 100

Query: 131 LFHPKSYRDSCIVVLKEDDTITMFDILNSQ-EKP-IVLNKPNNSFGLDARVNDITDLEFS 188
           L+HP +Y DSC+VVL   +TI ++++   + EKP +VLN+P +  G+ +RV DIT++ F+
Sbjct: 101 LWHPLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFA 160

Query: 189 KDGLTLYCLNTTEGGDIFAFYPFLPSVXXXXXXXXXXXXXKSLVMYESLDSTTDVIVKRN 248
            DGL+LY  +T+EGGD+    P LPS              K+  +Y +L   T    K  
Sbjct: 161 PDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVA 220

Query: 249 VIKQLQFVSKLHE--NWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATIL 306
            I+ L+FV++L +    N   G++ I +  R    QGP+ I+ FP +LY    T +  + 
Sbjct: 221 TIEYLEFVTQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVP 280

Query: 307 IDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITL 366
           +   +  ++ +SFDD + ILLF   E+ MSW  D     N+  L+    L  E  +  T 
Sbjct: 281 LGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKD---LKNAYTLM----LVEEFTATGTA 333

Query: 367 PEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNL 426
                 + V+  +  Q+V  + +   L  CI + +L  L  + F S +  I    +  ++
Sbjct: 334 FATCDGVAVLGIDSAQRVE-IPYLQALEDCIRDCNLAALQDINFTSSICKIPG--KFHSV 390

Query: 427 AYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGD--GFKMSFTQP 484
           A  N      + L+ +         + + P + AA++   TE     G    + + F   
Sbjct: 391 ARFNAPGNKGIILVGDH-------HAKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNS 443

Query: 485 INEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQT 544
           + EIL  N   Q+    P   ++P A + IPL ++ +E  L   T+ISKE + RI+ +Q+
Sbjct: 444 LEEILNTNKELQRRKHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQS 502

Query: 545 LGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSK 604
            G+ +HNR+  QQ+EL RQ+++   I S+   LR   EA + +  + L R   L +R   
Sbjct: 503 AGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCM 562

Query: 605 LSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTR 664
           L   L++I  S+KF +  +S  E  WF+E++NQ + FN +V     L+ +L++LK+EL  
Sbjct: 563 LQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELES 622

Query: 665 IEAETIKVDKKSQNEWD--ELRKMLEIDSKIIKECNEELLQVSQEFTTK 711
           +  E  + D++ +  +D   L+++L++DSKII EC + L   ++E   K
Sbjct: 623 L-PEHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAARELERK 670

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  199 bits (506), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 205/729 (28%), Positives = 334/729 (45%), Gaps = 101/729 (13%)

Query: 12  IFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTD--SLYHSLNFSRHLVLDDTF 69
           IFQ  +S + S R +    N   I   QDNI+R   V +D  + Y S N     V +   
Sbjct: 12  IFQ-EVSLNPSDRLV--CNNSNTIYLWQDNILR---VQSDHETQYRSYNVELPFVPE--- 62

Query: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKK 129
            ++ S SG L+    ++E++VMEV       E   ++  F           +G    IKK
Sbjct: 63  QMVISPSGGLVAFHANSELYVMEVN------EQSRLRKHFNT--------SLG----IKK 104

Query: 130 VLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPI-VLNKPNNSFGLDARVNDITDLEFS 188
           +L+HP +      V+L +D TI ++D+ + + + I V N+ + SFGL   V  + D+ F 
Sbjct: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164

Query: 189 KDGLTLYCLNTTEGGDIFAFYPFLP-------------SVXXXXXXXXXXXXXKSLVMYE 235
             GLTLY L++    DI+A +P LP             +              KSL +Y 
Sbjct: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224

Query: 236 SLDSTTDVI-------------VKRNVIKQLQFVSKLHENWNSRFGKVDI--QKEYRLAK 280
           SLD    +I             +K +++KQ+QF     +N       +D    K  R + 
Sbjct: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKN-----DGIDTFTSKAIRNSV 279

Query: 281 VQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVD 340
            QGPF I  FP  L     T + TI+    +  ++ + F DG+ ++LF D E+ MSW + 
Sbjct: 280 PQGPFIIKKFPTALNAKEVTGL-TIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLR 338

Query: 341 NYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINES 400
           +    N+L +I     + + + L +   +L    V + +    +  M W   L++CI   
Sbjct: 339 SNTTFNNLSVITMFNAKGQCQLLNSSEPKL----VFTGDSSTTIMEMPWLEPLAQCIRLH 394

Query: 401 DLNPLAGLKFESKLEDIAT--IERIPNLAY-INWNDQSNLALMSNKTLTFQNISSDMKPQ 457
           D + +  +KFE+K+  ++   +  +  L+  I +N  S   + SN   T Q      KP 
Sbjct: 395 DFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQ------KPI 448

Query: 458 STAAETSISTEKS-DTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPL 516
           +   E   + + S  T G    M  T+   E            IS     IP +   +PL
Sbjct: 449 NRTDEVKYTYKPSLPTSGKELDMLLTKYKTE--------ANGFISG----IPDSLAPLPL 496

Query: 517 KNEASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDD 576
           KN ++E QLE+ +++ KE ++R+   Q +   + N+ +E+  EL RQL+ T +I    + 
Sbjct: 497 KNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEI----EM 552

Query: 577 LRRKFEAQNKKWDAQLSRQSE----LMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFK 632
           LR K          + SR  E    L +R  KL +  S I  + K +   IS  E+ WFK
Sbjct: 553 LRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFK 612

Query: 633 EIRNQILQFNSFVHSQKSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSK 692
            I+NQ+L+FN++VH    L+++L +L    T++ + T   D  S+ E+  L++ML  D K
Sbjct: 613 SIKNQVLKFNNYVHLTNKLREELEFLD---TQLRSTTKGDDFFSELEFSSLQQMLLNDKK 669

Query: 693 IIKECNEEL 701
           +I  C  EL
Sbjct: 670 VINSCMNEL 678

>Suva_10.177 Chr10 complement(331316..331927,331928..332062) [747
           bp, 248 aa] {ON} YLR093C (REAL)
          Length = 248

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 572 SKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQI-AESNKFKEKKISHGEMKW 630
           + +D ++   +  N   D  L RQ    ER S L  K SQ+ + SNKF+ K ++  E+ W
Sbjct: 165 ATEDQIKDVIQIMNDNIDKFLERQ----ERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMW 220

Query: 631 FKEIRNQIL 639
           +++++N  L
Sbjct: 221 WQKVKNITL 229

>KNAG0B06750 Chr2 (1332805..1335963) [3159 bp, 1052 aa] {ON}
           Anc_4.361 YJR132W
          Length = 1052

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 7/83 (8%)

Query: 563 QLQSTCKIISKDDDLRRKFE-AQNKKWD-AQLSRQSELMERFSKLSKKLSQIAESNKFKE 620
           QL  T +I+SKD D+RR +   + KKW  A L R   L +R++  S  LS+  E   FK+
Sbjct: 251 QLPLTEQILSKDVDVRRTYSWVKCKKWAYANLYR---LFQRYA--STSLSRKFEYGGFKK 305

Query: 621 KKISHGEMKWFKEIRNQILQFNS 643
             + H    + + I NQI Q+ +
Sbjct: 306 VYVEHFLPNFLQLIFNQIEQWGA 328

>Skud_12.161 Chr12 complement(309662..310273,310274..310414) [753
           bp, 250 aa] {ON} YLR093C (REAL)
          Length = 250

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 572 SKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQI-AESNKFKEKKISHGEMKW 630
           + +D ++   +  N   D  L RQ    ER S L  K SQ+ + SNKF+ K ++  E+ W
Sbjct: 167 ATEDQIKDVIQIMNDNIDKFLERQ----ERVSLLVDKTSQLNSNSNKFRRKAVNIKEIMW 222

Query: 631 FKEIRNQIL 639
           +++++N  L
Sbjct: 223 WQKVKNITL 231

>Smik_12.152 Chr12 complement(306393..307004,307005..307145) [753
           bp, 250 aa] {ON} YLR093C (REAL)
          Length = 250

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 572 SKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQI-AESNKFKEKKISHGEMKW 630
           + +D ++   +  N   D  L RQ    ER S L  K SQ+ + SNKF+ K ++  E+ W
Sbjct: 167 ATEDQIKDVIQIMNDNIDKFLERQ----ERVSLLVDKTSQLNSNSNKFRRKAVNIKEIMW 222

Query: 631 FKEIRNQIL 639
           +++++N  L
Sbjct: 223 WQKVKNITL 231

>YLR093C Chr12 complement(326513..327258,327400..327415) [762 bp,
           253 aa] {ON}  NYV1v-SNARE component of the vacuolar
           SNARE complex involved in vesicle fusion; inhibits
           ATP-dependent Ca(2+) transport activity of Pmc1p in the
           vacuolar membrane
          Length = 253

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 572 SKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQI-AESNKFKEKKISHGEMKW 630
           + +D ++   +  N   D  L RQ    ER S L  K SQ+ + SNKF+ K ++  E+ W
Sbjct: 170 ATEDQIKDVIQIMNDNIDKFLERQ----ERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMW 225

Query: 631 FKEIRNQIL 639
           +++++N  L
Sbjct: 226 WQKVKNITL 234

>Ecym_3157 Chr3 (294832..298155) [3324 bp, 1107 aa] {ON} similar to
           Ashbya gossypii AFR416C
          Length = 1107

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%)

Query: 372 KLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINW 431
           +L++ S+ + +  NF   +S    CI  + L  L+ L+F+  L++IA++  + ++  + W
Sbjct: 789 RLWLDSEEVNRATNFDGTSSNAQHCIPRTHLGKLSHLEFKEVLQNIASLPELEDILSVIW 848

Query: 432 N 432
           N
Sbjct: 849 N 849

>TPHA0A01100 Chr1 (212665..214251) [1587 bp, 528 aa] {ON} Anc_8.609
           YOR198C
          Length = 528

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 8/120 (6%)

Query: 596 SELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQIL----QFNSFVHSQKSL 651
           S L ++   ++K+L  I E+   K+ +         K   +QI     Q    V+ Q SL
Sbjct: 22  SPLQKQMDDITKQLKDIEEAIAVKDSEAKATRNNRSKVDNSQITKLQQQVKKLVNKQTSL 81

Query: 652 QQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTK 711
            Q+   L++++  IE E     K+   E DE    ++ + K ++E +EEL ++ QEF  K
Sbjct: 82  SQEKDNLQAQIRSIEVEV----KRKTAEIDEKLATIKFNFKTLEEFDEELKKIDQEFNAK 137

>NCAS0B05060 Chr2 complement(940241..940938,941045..941060) [714 bp,
           237 aa] {ON} Anc_7.67 YAL030W
          Length = 237

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 5/94 (5%)

Query: 559 ELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIAE-SNK 617
           ELT       +  S ++DL+      N   D  L RQ    ER S L  K SQ+ + S+ 
Sbjct: 141 ELTALQNENSEGASTENDLQDVVNIMNNNIDKFLERQ----ERISLLVDKTSQLNDNSHN 196

Query: 618 FKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSL 651
           FK+K +   E  W++ ++N  L   + + +  +L
Sbjct: 197 FKKKAVRIKERMWWQRMKNTTLMIFAVILTVSAL 230

>CAGL0M09999g Chr13 (987540..996914) [9375 bp, 3124 aa] {ON} similar
            to uniprot|P18963 Saccharomyces cerevisiae YBR140c IRA1
            or uniprot|P19158 Saccharomyces cerevisiae YOL081w IRA2
          Length = 3124

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 25/158 (15%)

Query: 538  RIVKAQTLGVSIHNRIHEQQFELTRQLQSTCK-IISKDDDLRRKFEAQNKKWDAQLSRQS 596
            RI   +   V++  ++HE  F L  Q+ +  + ++++DDD R                  
Sbjct: 1444 RIKIEELRSVNLSQKVHESSFVLLEQIITIVRTVLNRDDDER------------------ 1485

Query: 597  ELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQ-QDL 655
             +M  FS   + +S I + +   EK I H  +K++K I      F +  HS+ SL  ++ 
Sbjct: 1486 -IMLLFSI--RVVSTIDQLSDLVEK-IPHSSVKYYKAIIQMAKLFRAIQHSEISLGIKNH 1541

Query: 656  SYLKSELTRIEAETIKVDKKSQNEWDELRKML-EIDSK 692
             YLK++  ++     KV      ++D L K L E+D K
Sbjct: 1542 FYLKNKWLKLLTNWFKVTISIDYDFDNLSKPLREMDLK 1579

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
           chromosome segregation protein
          Length = 1223

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 10/99 (10%)

Query: 597 ELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLS 656
           EL +++ K+ +     A +   K+++  H E+K +KE  ++  ++  +V  +K +Q +LS
Sbjct: 182 ELKDQYDKICQ-----ASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRVQTNLS 236

Query: 657 YLKSELTRIEAETIKVDKK---SQNEWDELRKMLEIDSK 692
               +L  +E E  +  +K   SQN+ D +R+ LE + K
Sbjct: 237 LW--QLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEK 273

>CAGL0C00429g Chr3 (43086..43790) [705 bp, 234 aa] {ON} similar to
           uniprot|Q12255 Saccharomyces cerevisiae YLR093c
          Length = 234

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 5/67 (7%)

Query: 574 DDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQI-AESNKFKEKKISHGEMKWFK 632
           +DD++   +  N   D  L RQ    ER S L  K S + + S  FK K I   E  W++
Sbjct: 153 EDDMQEVIQIMNDNIDKFLERQ----ERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWR 208

Query: 633 EIRNQIL 639
            ++N  L
Sbjct: 209 RMKNYTL 215

>KLTH0A02178g Chr1 complement(186546..187715) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q12341 Saccharomyces cerevisiae
           YPL001W HAT1 Catalytic subunit of the Hat1p-Hat2p
           histone acetyltransferase complex that uses the cofactor
           acetyl coenzyme A to acetylate free nuclear and
           cytoplasmic histone H4 involved in telomeric silencing
           and DNA double- strand break repair
          Length = 389

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 12/89 (13%)

Query: 512 RQIPLKNEASENQLEIFTDISKEFLQRIVKAQTLGV-------SIHNRIHEQQFELTRQL 564
           R++P+KNE  E Q  IF  I K   QR+++   L +        +  R++E+ ++L   L
Sbjct: 285 RELPIKNEWIEAQRSIFK-IEKRQFQRLIEMLLLHICSPNFRLQVKKRLYEKNYDLLADL 343

Query: 565 QSTCKIISKDDDLRRKFEAQNKKWDAQLS 593
            +     +++D L+  F +  +++D+ L+
Sbjct: 344 DTP----TRNDKLQTAFLSIKEEYDSILA 368

>NDAI0E01780 Chr5 (352387..355410) [3024 bp, 1007 aa] {ON} Anc_2.402
           YLR039C
          Length = 1007

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 34  RIVFIQDNIIRWYNVLTDSLYHSLNFS 60
           RIVFI +NI+R+Y+ +   L HS N S
Sbjct: 339 RIVFIHENIVRFYDPIKKKLSHSWNTS 365

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,356,236
Number of extensions: 3450183
Number of successful extensions: 15445
Number of sequences better than 10.0: 425
Number of HSP's gapped: 16025
Number of HSP's successfully gapped: 515
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)