Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL155C (GUT2)5.711ON64964932920.0
Smik_9.145.711ON65262731910.0
Skud_9.135.711ON64964931880.0
Suva_9.325.711ON53853828190.0
KAFR0D021705.711ON66060722130.0
KLTH0E00836g5.711ON64162321900.0
CAGL0H06699g5.711ON65062521830.0
NCAS0G001805.711ON65460021740.0
SAKL0E15114g5.711ON64963121740.0
Kwal_55.196495.711ON64160321630.0
KLLA0A00418g5.711ON64260021310.0
NDAI0F002105.711ON65360421220.0
TDEL0B020905.711ON64359821140.0
TPHA0E001505.711ON64659620830.0
Kpol_1043.775.711ON65763620780.0
Ecym_40105.711ON64462020710.0
AFR295W5.711ON63161920670.0
TBLA0E017505.711ON66560720600.0
ZYRO0B16522g5.711ON64361220340.0
KNAG0L021905.711ON64559919020.0
Smik_13.4086.294ON256179780.54
TBLA0C021004.276ON114186771.4
Smik_15.4398.702ON806178742.4
Kpol_1008.77.505ON79995742.6
SAKL0G16610g4.296ON196670742.7
CAGL0M00770g4.327ON1088136724.2
TBLA0H020705.191ON152146707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL155C
         (649 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...  1272   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...  1233   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...  1232   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...  1090   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   857   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   848   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   845   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   842   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   842   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   837   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   825   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   822   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   818   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   806   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   805   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   802   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   800   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   798   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   788   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   737   0.0  
Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W...    35   0.54 
TBLA0C02100 Chr3 (499045..502470) [3426 bp, 1141 aa] {ON} Anc_4....    34   1.4  
Smik_15.439 Chr15 complement(757966..760386) [2421 bp, 806 aa] {...    33   2.4  
Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}...    33   2.6  
SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} sim...    33   2.7  
CAGL0M00770g Chr13 (86290..89556) [3267 bp, 1088 aa] {ON} weakly...    32   4.2  
TBLA0H02070 Chr8 (492770..497335) [4566 bp, 1521 aa] {ON} Anc_5....    32   7.9  

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1272 bits (3292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/649 (94%), Positives = 616/649 (94%)

Query: 1   MFSVXXXXXXXXXXXXXXXXXXLYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLD 60
           MFSV                  LYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLD
Sbjct: 1   MFSVTRRRAAGAAAAMATATGTLYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLD 60

Query: 61  RLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120
           RLAKTHQFDVLII               RGLNVALVEKGDFASGTSSKSTKMIHGGVRYL
Sbjct: 61  RLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120

Query: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDF 180
           EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDF
Sbjct: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDF 180

Query: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240
           FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT
Sbjct: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240

Query: 241 VLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSG 300
           VLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSG
Sbjct: 241 VLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSG 300

Query: 301 LPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360
           LPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF
Sbjct: 301 LPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360

Query: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420
           FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP
Sbjct: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420

Query: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480
           LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG
Sbjct: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480

Query: 481 GFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540
           GFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE
Sbjct: 481 GFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540

Query: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600
           SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR
Sbjct: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600

Query: 601 TRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           TRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV
Sbjct: 601 TRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/627 (94%), Positives = 600/627 (95%)

Query: 23  LYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXX 82
           LYW+ +QG+RP VHND SYMVQFPTAAPPQVSRRDLL+RL KTHQFDVLII         
Sbjct: 26  LYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIGGGATGTGC 85

Query: 83  XXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 142
                 RGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER
Sbjct: 86  ALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 145

Query: 143 KHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 202
           KHLINTAPHLCTVLPILIPIYST QVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA
Sbjct: 146 KHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 205

Query: 203 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGA 262
           PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDP SGKVIGA
Sbjct: 206 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGA 265

Query: 263 EARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTFNQIAVM 322
           EARDVETNEL+RI AKCVVNATGPYSDAILQMDRNPSG PDSPLNDNSK KS FNQIAVM
Sbjct: 266 EARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDNSKAKSAFNQIAVM 325

Query: 323 DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 382
           DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE
Sbjct: 326 DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 385

Query: 383 NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV 442
           NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV
Sbjct: 386 NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV 445

Query: 443 RSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWT 502
           RSHFLFTSDN LITIAGGKWTTYRQMAEET+DKVVEVGGFHNL PCHTRDIKLAGAEEWT
Sbjct: 446 RSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWT 505

Query: 503 QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSE 562
           QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICE+FKESMENKLPLSLADKENNVIYSSE
Sbjct: 506 QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSE 565

Query: 563 ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVM 622
           ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALN+VHATVKVM
Sbjct: 566 ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVM 625

Query: 623 GDEFNWSEKKRQWELEKTVNFIKTFGV 649
           GDEFNWSEKKRQWELEKTVNFIKTFGV
Sbjct: 626 GDEFNWSEKKRQWELEKTVNFIKTFGV 652

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/649 (91%), Positives = 605/649 (93%)

Query: 1   MFSVXXXXXXXXXXXXXXXXXXLYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLD 60
           MFSV                  +YW T+QGDR LV ND SYMV FPTAAPPQVSRRDLLD
Sbjct: 1   MFSVSRRRAAAAAAAIATATGSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLD 60

Query: 61  RLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120
           RLAKTHQFDVLII               RGLNVALVEKGDFASGTSSKSTKMIHGGVRYL
Sbjct: 61  RLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120

Query: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDF 180
           EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY+TWQVPYIYMGCKFYDF
Sbjct: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDF 180

Query: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240
           FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT
Sbjct: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240

Query: 241 VLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSG 300
           VLNYVEVQ+LIKDP SGKV+GAEARDVETNELV+INAKCVVNATGPYSDAILQMDRNPSG
Sbjct: 241 VLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSG 300

Query: 301 LPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360
            P+SPLNDNS IKSTFNQIAV DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF
Sbjct: 301 QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360

Query: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420
           FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP
Sbjct: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420

Query: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480
           LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG
Sbjct: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480

Query: 481 GFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540
            FHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE
Sbjct: 481 RFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540

Query: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600
           SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR
Sbjct: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600

Query: 601 TRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           TRFAFLDAKEALN+ HATVKVMGDEFNWSEKKRQWELEKT+NFIKTFGV
Sbjct: 601 TRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/538 (95%), Positives = 529/538 (98%)

Query: 112 MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYI 171
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY+TWQVPYI
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 172 YMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 231
           Y GCKFYDFFAG QNLK SYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 232 ITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAI 291
           ITAVENGATVLNYVEVQKLIKDP SGKV+GAEARDVETNELVRINAKCVVNATGPYSDAI
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 292 LQMDRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351
           LQMDRN SG P+SPLNDNSKIKS FNQ+AVMDP+MVIPSIGVHIVLPSFYCPKD+GLLDV
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240

Query: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300

Query: 412 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 471
           LSAWAGVRPLVRDPR+IPA GKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE
Sbjct: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360

Query: 472 TVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 531
           T+DKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV+NYGTRS
Sbjct: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420

Query: 532 SIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 591
           SIICEFFK+SMENKLPLSLADKENN IYS+EENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480

Query: 592 TPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           TPLDFLLRRTRFAFLDAKEALN+VHATVKVMGDEFNWS+KKRQWELEKTVNFIKTFGV
Sbjct: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/607 (66%), Positives = 487/607 (80%), Gaps = 16/607 (2%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           +R DL+ +L KT+QFDVL+I               RGLNVALVEK DFASGTSSKSTKM 
Sbjct: 59  TRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMA 118

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173
           HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+Y+ WQ+PY Y 
Sbjct: 119 HGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYA 178

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           GCK YD FAGSQNLK SYLLSK +  + APML T  LKA LVYHDG+FNDSR+N+TLA+T
Sbjct: 179 GCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVT 238

Query: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293
           A+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   I AK V+NATGPYSDAILQ
Sbjct: 239 AIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQ 298

Query: 294 MDRNPSGLPDSPLNDNSKIKSTF-NQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVR 352
           MD+NP+GLPD PLN N K  +    +++V +PKMV+PS GVHI+LPSFYCPKD+GLLD +
Sbjct: 299 MDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357

Query: 353 TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVL 412
           TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDILKELQHYI FPVKREDVL
Sbjct: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417

Query: 413 SAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEET 472
           SAWAG+RPLV+DPRT+  +G    +TQG+VRSHF+FTSD+GL+TIAGGKWTTYR MAEET
Sbjct: 418 SAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEET 475

Query: 473 VDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSS 532
           VD+ ++VG F N+KPC TRDIKLAG E W  N  ALLAQ YHLSSK+S +L  NYGTR+ 
Sbjct: 476 VDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAP 535

Query: 533 IICEFFKESMENKLPLSLA----------DKENNVIYSSEENNLVNFDTFRYPFTIGELK 582
           IICE + +  +NKLP++LA          +  N++IY++E  ++  F+ FRYPFT+GE+K
Sbjct: 536 IICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDV--FECFRYPFTVGEVK 593

Query: 583 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVN 642
           YS+ YEY  T LDFL+RR+RFAFLDAKEA++AV  TVK+MGDE NW E +R  E+E T+ 
Sbjct: 594 YSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIK 653

Query: 643 FIKTFGV 649
           +IKTFGV
Sbjct: 654 YIKTFGV 660

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/623 (65%), Positives = 482/623 (77%), Gaps = 10/623 (1%)

Query: 29  QGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXX 88
           Q DR   HN+    +     AP   SR +LLD++AKT QFDVL+I               
Sbjct: 27  QRDRS-AHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGAT 85

Query: 89  RGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINT 148
           RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NT
Sbjct: 86  RGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNT 145

Query: 149 APHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTD 208
           APHLC VLPI+IP+Y+ WQVPY Y+GCK YD FAGSQNLK SY+++     E APML   
Sbjct: 146 APHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDAS 205

Query: 209 NLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVE 268
            LKA LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  +G+V GA ARD E
Sbjct: 206 ILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRE 265

Query: 269 TNELVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLND--NSKIKSTFNQIAVMDPKM 326
           T +  RINAK VVN+TGP+SD ILQMD    GLP + L    N    S  +++AV +P+M
Sbjct: 266 TGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRM 325

Query: 327 VIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMP 386
           V+PS GVHIVLP+FYCPK +GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  
Sbjct: 326 VVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTA 385

Query: 387 TEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHF 446
           TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLVRDPRT+  +G   S+TQG+VR+HF
Sbjct: 386 TEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLK-EGDDVSSTQGLVRNHF 444

Query: 447 LFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYV 506
           LFTSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G F   KPC T+ IKLAGAE W  N+V
Sbjct: 445 LFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFV 503

Query: 507 ALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNL 566
           A+LAQ YHLSSKM+ +L  NYGTRS IICE F+   +N+LP++   +EN  +Y +     
Sbjct: 504 AMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKN----- 558

Query: 567 VNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEF 626
           VNFD+FRYPFTI ELKYS++YEY RT LDFL+RRTRF FLDAK+AL AV  TV +MGDE 
Sbjct: 559 VNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDEL 618

Query: 627 NWSEKKRQWELEKTVNFIKTFGV 649
            W E KR  E+++  +FIKTFGV
Sbjct: 619 GWDENKRLSEIQQASDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/625 (66%), Positives = 486/625 (77%), Gaps = 21/625 (3%)

Query: 34  LVHNDPSYM--VQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGL 91
           L+ ND S +  V+ P    P  +R +LLD+L++T+QFDVLII               RGL
Sbjct: 38  LISNDVSLISPVEKPDVKLP--TRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGL 95

Query: 92  NVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPH 151
           NVALVEK DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPH
Sbjct: 96  NVALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPH 155

Query: 152 LCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLK 211
           LC +LPI+IP+Y+ WQVPY Y GCK YD FAGSQNLK SYL+SK+AT+E APML   NLK
Sbjct: 156 LCKLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLK 215

Query: 212 ASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNE 271
           A LVYHDGSFND+R+NATLA+TA+EN ATVLNY+EV++L+KD   GKV GA   D ET +
Sbjct: 216 AGLVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETGK 274

Query: 272 LVRINAKCVVNATGPYSDAILQMDRNPSGLPD------SPLND-NSKIKSTFNQIAVMDP 324
              + AK VVNATGPYSD +LQMD NP GLPD       P+ D N+ +KS  +Q+AV  P
Sbjct: 275 TYSVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKP 334

Query: 325 KMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENP 384
            MV+PS GVHI+LPSFYCPK+MGLLD +TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENP
Sbjct: 335 NMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENP 394

Query: 385 MPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRS 444
             TEADIQDILKELQ YI+FPVKREDVLSAWAG+RPLV DPR      K   +TQG+VRS
Sbjct: 395 TATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRK---KSKADGSTQGLVRS 451

Query: 445 HFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQN 504
           HF+FTSD+GL+TIAGGKWTTYR MAEET+D+VV+ G F + KPC TR +KLAGAE W  N
Sbjct: 452 HFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDPN 510

Query: 505 YVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEEN 564
             ALLAQ YHLS KMS+YL +NYGTR+ +ICE F E  EN+LPL LADKE   +      
Sbjct: 511 LPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGH--- 567

Query: 565 NLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGD 624
             V+FD+FRYP TI ELKY+++YEY RT LDFL+RRTRFAFLDAK+ALNAV  TV++MGD
Sbjct: 568 --VDFDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGD 625

Query: 625 EFNWSEKKRQWELEKTVNFIKTFGV 649
              W E++RQ E+  +  FIKTFGV
Sbjct: 626 SLGWDEQRRQDEIRYSTEFIKTFGV 650

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/600 (68%), Positives = 477/600 (79%), Gaps = 10/600 (1%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           +R  LL +L +  QFDVLII               RGL VALVE+ DFASGTSSKSTKM 
Sbjct: 61  TRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKMA 120

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173
           HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+ WQVPY Y 
Sbjct: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           GCK YD FAG+QNLK SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLAIT
Sbjct: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240

Query: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293
           A+E GATVLNYVEVQKL+KD  +G + G   RD+ET + + + +K VVNATGP+SD ILQ
Sbjct: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300

Query: 294 MDRNPSGLPDSPLNDNSKI---KSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLD 350
           MD+NP+GLPD  +N N K+   +   ++IAV +P MV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 301 MDKNPTGLPDD-MNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359

Query: 351 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 410
           VRTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKRED
Sbjct: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419

Query: 411 VLSAWAGVRPLVRDPRTIPADGKKG-SATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469
           VLSAWAG+RPLVRDPR +  D KK   +TQG+VRSHF+FTSDNGL+TIAGGKWTTYR+MA
Sbjct: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479

Query: 470 EETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 529
           EET+D+VV+ G F + KPC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL  NYGT
Sbjct: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539

Query: 530 RSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 589
           RS IICE F     NKLP+ LA +E   I  +      +F+TFRYP TIGELKYSM+YEY
Sbjct: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRYEY 594

Query: 590 CRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
            RT LDFL+RRTRFAFLDAKEAL AV  TVK+MGDEFNWS ++RQ E EKT+ FIK+FGV
Sbjct: 595 ARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/631 (64%), Positives = 486/631 (77%), Gaps = 10/631 (1%)

Query: 23  LYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXX 82
           + W   Q  + +++ND +       +     +R+DLL +L+KT+QFDVLII         
Sbjct: 25  ILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGTGS 84

Query: 83  XXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 142
                 RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLV+EALNER
Sbjct: 85  ALDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNER 144

Query: 143 KHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 202
            H++ TAPHLC +LPI+IP+Y+ WQ PY Y+GCK YD FAGSQNLK SY+L+ S   E A
Sbjct: 145 AHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVA 204

Query: 203 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGA 262
           PML    LKA LVYHDGSFNDSR+NATLA+TAVE GATVLNY+EV++LIK+  +GKV GA
Sbjct: 205 PMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGA 264

Query: 263 EARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTF-NQIAV 321
            A+D ET E  RI AK VVNATGP+SD ILQMD +  GLPD  L  +S I +T  +++AV
Sbjct: 265 VAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAV 324

Query: 322 MDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVP 381
            +P+MV+PS GVHIVLPSFYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+P
Sbjct: 325 ANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 384

Query: 382 ENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGK---KGSAT 438
           ENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR    +       S+T
Sbjct: 385 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASST 444

Query: 439 QGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGA 498
           Q +VRSHFLFTSDN L+TIAGGKWTTYR+M+EET+++VV+VG F N KPC TR +KLAGA
Sbjct: 445 QELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLAGA 503

Query: 499 EEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVI 558
           E +  N  A+LAQ YHLSSKM+ YL  NYGTR+ +ICE FK+  +NKLP++   KEN  +
Sbjct: 504 ENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTV 563

Query: 559 YSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHAT 618
           Y +     V+FD+FRYPFTIGELKYS+  EY RT LDFL+RRTR+AFLDAK+AL AV  T
Sbjct: 564 YGN-----VDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGT 618

Query: 619 VKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           VKVMGDE +W   +RQ E EK   FIKTFGV
Sbjct: 619 VKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/603 (66%), Positives = 473/603 (78%), Gaps = 9/603 (1%)

Query: 49  APPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSK 108
           AP   +R +LL+++AKT QFDVLII               RGLNVALVE  DFASGTSSK
Sbjct: 46  APALPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSK 105

Query: 109 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQV 168
           STKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+Y+ WQV
Sbjct: 106 STKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQV 165

Query: 169 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 228
           PY Y+GCK YD FAGSQNLK SY++S     E APML    LKA LVYHDGSFNDSR+NA
Sbjct: 166 PYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNA 225

Query: 229 TLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYS 288
            LA+TA+E GATVLNY+EV +L+K+  SG++ GA  RD ET E  RI AK VVN+TGP+S
Sbjct: 226 ALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFS 285

Query: 289 DAILQMDRNPSGLPDSPLND--NSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDM 346
           D +LQMD    G P + L    N    S  ++IAV +P+MV+PS GVHIVLP+FYCPK++
Sbjct: 286 DRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEI 345

Query: 347 GLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPV 406
           GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPV
Sbjct: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405

Query: 407 KREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYR 466
           KR DVLSAWAG+RPL+RDPRTI  +G   S+TQG+VR+HFL+TSDNGL+TIAGGKWTTYR
Sbjct: 406 KRGDVLSAWAGIRPLIRDPRTIK-EGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYR 464

Query: 467 QMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQN 526
           +MAEET+D+VV+ G F   KPC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  N
Sbjct: 465 EMAEETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANN 523

Query: 527 YGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQ 586
           YGTRS IICE FK   +N+LP++   +EN  +Y +     VNFD+FRYPFTIGELKYSMQ
Sbjct: 524 YGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIGELKYSMQ 578

Query: 587 YEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKT 646
           YEY RT LDFL+RRTRF FLDA++AL AV  TV VMGDE  WS+ +RQ E ++   FIKT
Sbjct: 579 YEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKT 638

Query: 647 FGV 649
           FG+
Sbjct: 639 FGL 641

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/600 (66%), Positives = 474/600 (79%), Gaps = 16/600 (2%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           SR +LL RL+KT +FDVLII               RGLNVALVE  DFASGTSSKSTKM 
Sbjct: 55  SRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKMA 114

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173
           HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+Y+ WQVPY Y+
Sbjct: 115 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYV 174

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           G K YD FAGSQNLK SYLLS S   E APML    LKA LVYHDGSFNDSR+N++LAIT
Sbjct: 175 GTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAIT 234

Query: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293
           A+E GATVLNYV++++L+K+  +GKV GA A D ET +  +I AK VVNATGPYSD +LQ
Sbjct: 235 AIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQ 294

Query: 294 MDRNPSGLPDSP----LNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLL 349
           MD++P+GLPD      +N+N+ + +   +IAV +PKMV+PS GVHIVLPSFYCPK++GLL
Sbjct: 295 MDQSPTGLPDDSVLQKINENATVST---KIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351

Query: 350 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 409
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVKRE
Sbjct: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411

Query: 410 DVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469
           DVLSAWAG+RPLV+DPR   AD   GS TQ +VRSHFLFTS + L+TI+GGKWTTYR+MA
Sbjct: 412 DVLSAWAGIRPLVKDPRK--ADSGSGS-TQQLVRSHFLFTSPSNLVTISGGKWTTYREMA 468

Query: 470 EETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 529
           EET+D+VV+VG F N KPC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NYGT
Sbjct: 469 EETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGT 527

Query: 530 RSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 589
           R+ +ICE F E   NKLP++LA +EN  ++       V++D+FRYP+TIGELKYS++YEY
Sbjct: 528 RAPLICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKYEY 582

Query: 590 CRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
            R  LDFL+RRTR+AFLDAK+ALNAV  TVKVMGDE  W  KKRQ E+++   +IKTFGV
Sbjct: 583 ARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/604 (66%), Positives = 475/604 (78%), Gaps = 16/604 (2%)

Query: 54  SRRDLLDRLA-KTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKM 112
           SR  L ++L  K HQFD+LII               RGLNVALVE+ DFASGTSSKSTKM
Sbjct: 58  SRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTKM 117

Query: 113 IHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIY 172
            HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+ WQ+PY Y
Sbjct: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177

Query: 173 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAI 232
            GCKFYDFFAG QNLK SYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++AI
Sbjct: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237

Query: 233 TAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAIL 292
           TA+ENGATVLNYVEV+KL+KDP S K+IG   +D ET E+  + +K +VNATGPYSD IL
Sbjct: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297

Query: 293 QMDRNPSGLP-----DSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMG 347
           QMD+N SGLP     D  + D + I S   +IAV +PKMV+PS GVHI+LPS+YCPK MG
Sbjct: 298 QMDKNLSGLPDLANIDPKMYDPNDISS---KIAVSNPKMVVPSSGVHIILPSYYCPKQMG 354

Query: 348 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 407
           LLD RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV+
Sbjct: 355 LLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVR 414

Query: 408 REDVLSAWAGVRPLVRDPRTIPADG-KKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYR 466
           REDVLSAWAG+RPLVRDPR I  D  +K   TQG+VRSHFLFTSDNGLITIAGGKWTTYR
Sbjct: 415 REDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYR 474

Query: 467 QMAEETVDKVVEVGGFHNL-KPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQ 525
           +MAEET+D+VV+ G F N  KPC T+D+KL GAE W  N VALL+Q ++LSS M+ YL +
Sbjct: 475 EMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSE 534

Query: 526 NYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSM 585
           NYGTRS+IIC+ F+    NKLP+ LA  E+  I  +     V+F+TFRYP TI ELKY+M
Sbjct: 535 NYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYAM 589

Query: 586 QYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIK 645
           +YEY RTPLDFL+RRTRFA+LDA +AL AV  TVKVMGDEF W  K+R+ E++    FI+
Sbjct: 590 KYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIE 649

Query: 646 TFGV 649
           +FGV
Sbjct: 650 SFGV 653

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/598 (65%), Positives = 468/598 (78%), Gaps = 14/598 (2%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           SR DLL +L+KT QFDVL+I               RGLNVALVE  DFASGTSSKSTKM 
Sbjct: 58  SREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMHDFASGTSSKSTKMA 117

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173
           HGGVRYLEKA ++ SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+Y+ WQ+PY Y+
Sbjct: 118 HGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPYFYV 177

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           GCK YD FAGSQNLK SYLL+K    + APML    LKA LVYHDGSFNDSR+N  LA+T
Sbjct: 178 GCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTALAVT 237

Query: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293
           A+ENGATVLNY+EV++LIKD  +GKV GA   + ET E   + AK  VNATGPYSD +LQ
Sbjct: 238 AIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDKLLQ 297

Query: 294 MDRNPSGLPD--SPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351
           MD N  G PD   PL  N+ I +   ++AV +PKMV+PS GVHI+LPSFYCP++MGLLDV
Sbjct: 298 MDENKDGKPDPTKPL-PNATIST---KVAVENPKMVVPSAGVHIILPSFYCPREMGLLDV 353

Query: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411
           +TSDGRVMFFLPWQGKVLAGTTDIP+KQVP+ P   E+DIQDIL+ELQHYI+FPVKREDV
Sbjct: 354 KTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIKFPVKREDV 413

Query: 412 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 471
           LSAWAG+RPLV DPR   + G  G +TQG+VRSH  FT+DNG++TIAGGKWTTYR+MAEE
Sbjct: 414 LSAWAGIRPLVIDPRK--SQGNTGGSTQGLVRSHLCFTTDNGMVTIAGGKWTTYREMAEE 471

Query: 472 TVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 531
           T+++VV+VG F N+KPC TR +KL+GAE W  N  ALLAQ YHLS  MSN+L +NYGTR+
Sbjct: 472 TINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAMSNHLSENYGTRA 530

Query: 532 SIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 591
            +ICE F+E   N+LP++   +EN  +Y +     VNFD+FRYPFTIGEL YS+ YEY R
Sbjct: 531 PLICEMFQEDERNQLPVTFGGRENVTVYGN-----VNFDSFRYPFTIGELNYSVDYEYTR 585

Query: 592 TPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           T LDFL+RRTRFAFLDA++AL+AV  TV VMGD+ NW   +R+ E+EK+  FI+TFGV
Sbjct: 586 TALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/596 (64%), Positives = 464/596 (77%), Gaps = 12/596 (2%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           +R +L++ L  T QFDVLII               RGLNVALVEK DFASGTSSKSTKM 
Sbjct: 63  TRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTKMA 122

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173
           HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +LPI+IP+Y  WQVPY Y 
Sbjct: 123 HGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYFYA 182

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           G K YD FAGSQNLK SYL+SK+   E APML    LKA LVYHDG+FNDSR+N+TLAIT
Sbjct: 183 GVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLAIT 242

Query: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293
           A+ENGATVLNY+EV++L+KDP+S ++ GA   D+ET E ++INAK +VNATGPYSD ILQ
Sbjct: 243 AIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKILQ 302

Query: 294 MDRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRT 353
           MD N +G PD      S   S   ++AV +P MV+PS GVHI+LPSFYCP++MGLLD  T
Sbjct: 303 MDNNKNGKPDE--FTQSAETSIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLLDANT 360

Query: 354 SDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLS 413
           SDGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQDILKELQHYI+FPVKREDVLS
Sbjct: 361 SDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDVLS 420

Query: 414 AWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETV 473
           AWAG+RPLV+DPR  P +G    ATQ +VRSHF+FTSD+GL+TIAGGKWTTYR+MAEET+
Sbjct: 421 AWAGIRPLVQDPRKTPKEG----ATQELVRSHFIFTSDHGLVTIAGGKWTTYREMAEETI 476

Query: 474 DKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSI 533
           D VV+ G F N+KPC TR +KLAG E +  N  ALLAQ YHL SK+S +L  NYGTRS +
Sbjct: 477 DTVVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANNYGTRSPL 535

Query: 534 ICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTP 593
           IC+ F     N+LP+ LA KE N +Y +     V+FD+FRYP++I E+KY + +EY RT 
Sbjct: 536 ICDMFVADDHNRLPIYLAGKEENKVYGT-----VDFDSFRYPYSIAEVKYCVHHEYARTT 590

Query: 594 LDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           LDFL+RR+RFAFLDAK+AL +V  TVK+MGDE NW E++R+ E + ++ +IKTFGV
Sbjct: 591 LDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/636 (64%), Positives = 479/636 (75%), Gaps = 23/636 (3%)

Query: 26  MTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXX 85
           +T+      V+NDPS      T      SR DLL +L KT+QFDVLII            
Sbjct: 33  LTNNSSNNAVYNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAID 92

Query: 86  XXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHL 145
              RGLNVALVEK D+ASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER HL
Sbjct: 93  AATRGLNVALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHL 152

Query: 146 INTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPML 205
           + TAPHLC +LPI+IP+Y  WQVPY Y+G K YD FAGSQNLK SYLLSKS+  E APML
Sbjct: 153 LYTAPHLCKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPML 212

Query: 206 TTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEAR 265
            +  LKA LVYHDGSFNDSR+NATLAI+A+E GATVLNY+EV++L+KD  + K+ GA   
Sbjct: 213 DSSKLKAGLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVE 272

Query: 266 DVETNELVRINAKCVVNATGPYSDAILQMDRNPSGLPD------------SPLNDNSKIK 313
           D ET E  +I AK +VNATGPYSD ILQMD N +GLPD            +PLN  +  +
Sbjct: 273 DTETGETYQIKAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITP-E 331

Query: 314 STFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTT 373
           S   ++AV +P MV+PS GVHI+LPS+YCP +MGLLD  T+DGRVMFFLPWQGKVLAGTT
Sbjct: 332 SISKEVAVQNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTT 391

Query: 374 DIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGK 433
           DIP+K VPENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR      +
Sbjct: 392 DIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV-----Q 446

Query: 434 KGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDI 493
           KG ATQ VVRSHF+FTSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G F N KPC TR +
Sbjct: 447 KGGATQEVVRSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKL 505

Query: 494 KLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADK 553
           KLAGAE W  N  ALL+Q Y++S+ M+ +L  NYGTRS IICE  KES ENKLP++LA +
Sbjct: 506 KLAGAENWDANLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGR 565

Query: 554 ENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALN 613
           EN  I     N  V +D+FRYP+TI ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL+
Sbjct: 566 ENESI----SNAHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALD 621

Query: 614 AVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           AV+ TVK+MGD  NW   +R+ E     ++IKTFGV
Sbjct: 622 AVNGTVKIMGDHLNWDNDRREREKVYATDYIKTFGV 657

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/620 (62%), Positives = 469/620 (75%), Gaps = 21/620 (3%)

Query: 34  LVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNV 93
            V N+    ++    AP   SR  LL++L KT QFDVL+I               RGLNV
Sbjct: 42  FVANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNV 101

Query: 94  ALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLC 153
           AL+E  D+ASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC
Sbjct: 102 ALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLC 161

Query: 154 TVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKAS 213
            +LPI+IP+Y  WQVPY Y+G K YDFFAG QNLK SYLLS +   + APML    LKA 
Sbjct: 162 KILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAG 221

Query: 214 LVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELV 273
           LVYHDGSFNDSR+N+TLA+TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +  
Sbjct: 222 LVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQY 281

Query: 274 RINAKCVVNATGPYSDAILQMDRNPSGLPD----SPLNDNSKIKSTFNQIAVMDPKMVIP 329
            + AK VV+ATGP+SD ILQM+ +P GLPD    S  N+ + I +   ++AV DPKMV+P
Sbjct: 282 SVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATITT---KVAVADPKMVVP 338

Query: 330 SIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEA 389
           S GVHI+LPSFYCPKDMGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEA
Sbjct: 339 SSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEA 398

Query: 390 DIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFT 449
           DIQDILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFT
Sbjct: 399 DIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFT 452

Query: 450 SDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALL 509
           SD+GL+TI+GGKWTTYR+MA+ET+D+VV+VG F N KPC TR IKL G+E W  N  A+L
Sbjct: 453 SDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAIL 512

Query: 510 AQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNF 569
           +Q Y+L   +S YL +NYGT+++ ICE F+    N+LP+SLA        + +    V++
Sbjct: 513 SQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDY 564

Query: 570 DTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWS 629
           D FRYPFT+GELKY+++ EY R PLDFL+RRTR+AFLDAK+A+ AV  TVK+MGDE  W 
Sbjct: 565 DAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWD 624

Query: 630 EKKRQWELEKTVNFIKTFGV 649
             KR+ E +  + FIKTFGV
Sbjct: 625 SAKREMETKYAIEFIKTFGV 644

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/619 (62%), Positives = 468/619 (75%), Gaps = 16/619 (2%)

Query: 32  RPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGL 91
           RP + N+    ++    AP   SR +LL++L KT+QFDVL+I               RGL
Sbjct: 28  RPSLVNEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGL 87

Query: 92  NVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPH 151
           NVAL+E  DFASGTSSKSTKM HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPH
Sbjct: 88  NVALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPH 147

Query: 152 LCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLK 211
           LC VLPI+IP+Y  WQVPY Y+G K YDFFAGSQNLK SYLLS SA  E APML    LK
Sbjct: 148 LCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLK 207

Query: 212 ASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNE 271
           A LVYHDGSFNDSR+NAT+A+TA+ENGATVLNY+EV++LIK+P  GKV GA A D ET +
Sbjct: 208 AGLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGK 267

Query: 272 LVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTF-NQIAVMDPKMVIPS 330
              + AK VVNATGP+SD +LQMD +P GLPD  + D     ST   ++AV +PKMV+PS
Sbjct: 268 EYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPS 327

Query: 331 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 390
            GVHI+LPS+YCPK+MGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEAD
Sbjct: 328 SGVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEAD 387

Query: 391 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 450
           IQDILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS
Sbjct: 388 IQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTS 441

Query: 451 DNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLA 510
            NG++TI+GGKWTTYR+MAEETV++VV+VG F N KPC TR +KL+GAE W  N  ALL+
Sbjct: 442 KNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLS 501

Query: 511 QNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD 570
             Y++   ++ +L QNYGT+++ +CE F++   N LP+SLA         +++   ++++
Sbjct: 502 HQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLA---------ADKPTSIDYN 552

Query: 571 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSE 630
            FRYP+TIGELK++M +EY RTPLDFL+RRTR+AFLDAK+AL AV  TVKVMGD   W  
Sbjct: 553 AFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDS 612

Query: 631 KKRQWELEKTVNFIKTFGV 649
            KR  E +  + +IKTFGV
Sbjct: 613 AKRVAETKYAIEYIKTFGV 631

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/607 (63%), Positives = 470/607 (77%), Gaps = 15/607 (2%)

Query: 50  PPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKS 109
           PP  SR +LL  L KT +FDVLII               RGLNVAL+E  DFAS TSSKS
Sbjct: 67  PP--SRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKS 124

Query: 110 TKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVP 169
           TKM HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+Y+ W+VP
Sbjct: 125 TKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184

Query: 170 YIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNAT 229
           Y Y GCK YDFFAGSQNLK +YLLSK++  + APML    LKA+LVYHDGSFND+R+N +
Sbjct: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244

Query: 230 LAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSD 289
           LA+TA+ENGATVLNY+EV+KLIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD
Sbjct: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304

Query: 290 AILQMDRNPSGLPD--SPLN-DNSKIKS----TFNQIAVMDPKMVIPSIGVHIVLPSFYC 342
            ILQMDRN SG PD     N D SK+ S      ++IAV +PKMV+PS GVHI+LPS+YC
Sbjct: 305 NILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364

Query: 343 PKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYI 402
           PKDMG+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY 
Sbjct: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424

Query: 403 EFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKW 462
           +FPVKREDVLSAWAG+RPLVRDPR +  + K   +TQG+VRSHF+FTS+N L+TIAGGKW
Sbjct: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 463 TTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNY 522
           TTYR+MAEET+D+ ++VG   N KP  T+D+ L+G E WT N  ALL+Q YH+ S +S Y
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543

Query: 523 LVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELK 582
           L +NYGTR+ IICE  K+  +N+LP++LA KE+N I  +     V+F   RYP+T+ E+K
Sbjct: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVK 598

Query: 583 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVN 642
           Y +  EY RT LDFLLRRTRF FLDAKEA+NAV  TV +MGDE NW  +KR  E++K+  
Sbjct: 599 YCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKE 658

Query: 643 FIKTFGV 649
           +IKT GV
Sbjct: 659 YIKTLGV 665

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/612 (62%), Positives = 456/612 (74%), Gaps = 17/612 (2%)

Query: 38  DPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVE 97
           DP   V  P       SR DLL  L KT +FDVLII               RGLNVA VE
Sbjct: 49  DPRPSVNLP-------SREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVE 101

Query: 98  KGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLP 157
             DFASGTSSKSTKM HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LP
Sbjct: 102 ANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILP 161

Query: 158 ILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYH 217
           I+IP+YS WQVPY + GCK YD+FAG QNL+ SYLLSK+   E APML    LKA LVYH
Sbjct: 162 IMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYH 221

Query: 218 DGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINA 277
           DGSFNDSR+N+TLAI+A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++ A
Sbjct: 222 DGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKA 281

Query: 278 KCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVL 337
           K  VNATGPYSD ILQMD+N +GLPD P        S   ++AV  P MV+PS GVHI+L
Sbjct: 282 KVTVNATGPYSDLILQMDKNKNGLPD-PQPPQPANVSIATEVAVNKPNMVVPSAGVHIIL 340

Query: 338 PSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKE 397
           PS+YCPK +GLLDV+T+DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+E
Sbjct: 341 PSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRE 400

Query: 398 LQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITI 457
           LQHYI+FPV+REDVLSAWAG+RPLV DPR        G +T+G+VR+H +FTS+ GLIT+
Sbjct: 401 LQHYIKFPVRREDVLSAWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITL 457

Query: 458 AGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSS 517
           AGGKWTTYR+MAE+T+D+VV+ GGF ++KPC TR IKLAG E WT N  ALLAQ+Y LS 
Sbjct: 458 AGGKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQ 516

Query: 518 KMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFT 577
            MS +L  NYGTR+ IICE FKE   N+LP++   +EN  +        VNFD+FRYPFT
Sbjct: 517 AMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFT 571

Query: 578 IGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWEL 637
           IGE  YS+++EY R   DFL+RRTR+AFLDA  AL AV  TVKVMGDE NW   +RQ E+
Sbjct: 572 IGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREI 631

Query: 638 EKTVNFIKTFGV 649
           E+   FIKTFGV
Sbjct: 632 EECTEFIKTFGV 643

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/599 (61%), Positives = 433/599 (72%), Gaps = 18/599 (3%)

Query: 55  RRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIH 114
           R  +L RL  T +FDVL++               RGL VALVEK DFA+GTSSKSTK+ H
Sbjct: 61  RAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKLAH 119

Query: 115 GGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMG 174
           GGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y  W+VPY Y G
Sbjct: 120 GGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAG 179

Query: 175 CKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITA 234
           CK YDFFAG+QNLK SYLLS+      APML    LK  LVYHDG FNDSRL ATLAI+A
Sbjct: 180 CKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISA 239

Query: 235 VENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQM 294
           VE GATV NYV V++LIKD T+G + GA+  D ET     +NAK VVNATGPYSD ILQM
Sbjct: 240 VERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQM 299

Query: 295 DRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTS 354
           D NP GLP+    +  K       IAV +PKMV+PS GVHI LPSFYCP +MGLLD  TS
Sbjct: 300 DANPQGLPE---KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTS 356

Query: 355 DGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSA 414
           DGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+REDVLSA
Sbjct: 357 DGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSA 416

Query: 415 WAGVRPLVRDPRTIPADGKKGSA-TQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETV 473
           WAG+RPLVRDPR   A+G  GS  T+G+VRSHF+FTS   L+TIAGGKWTTYR+MAEETV
Sbjct: 417 WAGIRPLVRDPRV--AEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474

Query: 474 DKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVQNYGTRSS 532
           D+V++VG F  LKPC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG R+ 
Sbjct: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534

Query: 533 IICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD--TFRYPFTIGELKYSMQYEYC 590
           IICE F+    +KLP+ L        Y   ++ + N D   F YPFTI ELKY +++EY 
Sbjct: 535 IICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYV 586

Query: 591 RTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649
           RT LDFLLRR+RFAFLDA+EALNAV  TV ++GDE  W  +KR  E  KT  +IKTFGV
Sbjct: 587 RTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W
           (REAL)
          Length = 256

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 68/179 (37%), Gaps = 37/179 (20%)

Query: 162 IYSTW--QVPYIYMGCKFYD----FFAGSQNLKKSYLLSKSATVEKAPMLTTDNL----- 210
           +Y TW  +   ++ G  FYD              SY  ++    E+A    + N      
Sbjct: 31  LYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGNPRDPTC 90

Query: 211 -KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEV--QKLIKDPTSGKVIGAEARDV 267
            KASL+Y  G++N S           ENG   LN +EV  ++L  DP + + +   +R  
Sbjct: 91  PKASLIYQHGTYNIS-----------ENGTLTLNPIEVDGRQLFSDPCTDQGVSTYSRYN 139

Query: 268 ETNELVRINAKCVVNATGPYSDAILQMD-----------RNPSGLPDSPLNDNSKIKST 315
           +T      N   +    G Y+  + Q D           R P  LP   LN  S   ST
Sbjct: 140 QTEIFKEYNVG-IDPYHGIYTLQLYQFDGTPMQPLYLAYRPPMMLPTETLNPTSSAVST 197

>TBLA0C02100 Chr3 (499045..502470) [3426 bp, 1141 aa] {ON} Anc_4.276
           YLR410W
          Length = 1141

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query: 296 RNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSD 355
           +NP+ +PDSP ND S I+  F ++             +  VL  F  P++ G+ D    D
Sbjct: 913 KNPNAIPDSPFNDPSFIQ--FREL-----------FKLTKVLFDFISPQEYGIEDTEKLD 959

Query: 356 GRVMFFLPWQGKVLAGTTDIPLKQVP 381
             ++  LP   ++L    D+  K  P
Sbjct: 960 IGLLTSLPLAKQILNDLKDLKEKTSP 985

>Smik_15.439 Chr15 complement(757966..760386) [2421 bp, 806 aa] {ON}
           YOR256C (REAL)
          Length = 806

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 73/178 (41%), Gaps = 39/178 (21%)

Query: 173 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPM-LTTDNL----------KASLVYH-DGS 220
           MGC  Y  + G  N+  SY  +++   EK  + L+T+N           K SL+Y   G+
Sbjct: 213 MGCLVYSNYPG--NVTISYYDNEN---EKHDLRLSTENFNPLSSNGKLSKVSLIYGGKGT 267

Query: 221 FND-SRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKC 279
            ND   L  +  I   ++   +LNY E+        S +V+ AE          +  AK 
Sbjct: 268 TNDLQNLKNSKTIEDGKDYVLLLNYDEI-------VSQQVLIAE----------KFGAKA 310

Query: 280 VVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMV----IPSIGV 333
           V+  + PY D I  +   P GLP     D S        +   DPK      IP+I +
Sbjct: 311 VIFISEPYGDNIDVIQSKPVGLPQYSTGDASTPTWFHPNVEEEDPKFWRLAHIPTIPI 368

>Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}
           complement(9101..11500) [2400 nt, 800 aa]
          Length = 799

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 128 SKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNL 187
           +  +L+  +E ++   +LIN      ++LP+     S   VP+IY+G KF  F     +L
Sbjct: 404 TDEELEKYLEYVSHPMNLINLPRAEGSLLPVFGKRISGMTVPWIYVGSKFSTF---CWHL 460

Query: 188 KKSYLLSKSATVEKAPML-------TTDNLKASLV 215
           +  Y LS +   E AP +       + D+L++ LV
Sbjct: 461 EDQYTLSANYQHEGAPKVWYSIPEYSCDSLRSYLV 495

>SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} similar
            to uniprot|Q06409 Saccharomyces cerevisiae YLR422W
            Hypothetical ORF
          Length = 1966

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 240  TVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKC--VVNATGPYSDAILQMDRN 297
            T++N  EV+K+ +   S       +  ++  EL  +   C  ++   G YS+   ++ RN
Sbjct: 1685 TLMNRTEVKKISEKVLSPVENAIRSLQLKIQELTGLENMCYKLIKENGEYSEIFGELSRN 1744

Query: 298  PSGLPDSPLN 307
             SG  D+P+N
Sbjct: 1745 ISGTIDAPIN 1754

>CAGL0M00770g Chr13 (86290..89556) [3267 bp, 1088 aa] {ON} weakly
           similar to uniprot|P06701 Saccharomyces cerevisiae
           YLR442c SIR3 silencing regulatory and DNA-repair protein
          Length = 1088

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 64/136 (47%), Gaps = 6/136 (4%)

Query: 468 MAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQ--NYVALLAQNYHLSSKMSNYLVQ 525
           +  + +DK  E      LKP  T    L   +++ Q  N V L AQ+ + S  +   L +
Sbjct: 569 LCHQPIDKTPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKN-SGSIFEKLRK 627

Query: 526 NYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSM 585
              + S I C    +S+ + + LS+ +KE   IY S  N ++N    +  +  G+ +Y++
Sbjct: 628 CTTSESLIQC--MSDSITSDIILSMRNKEFVTIYGSLFNAIINGRN-KSLYLTGDDEYTI 684

Query: 586 QYEYCRTPLDFLLRRT 601
           +Y + +   + LL  T
Sbjct: 685 KYVFNKVAHELLLSAT 700

>TBLA0H02070 Chr8 (492770..497335) [4566 bp, 1521 aa] {ON} Anc_5.191
           YLR024C
          Length = 1521

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 556 NVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRT 601
           N+IY    NN  NF +F  P TI  LK  ++++  +  L  +LR T
Sbjct: 830 NLIYICLLNNFKNFQSFFTPITISHLKSLLKFDSIQLLLQNILRMT 875

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,429,765
Number of extensions: 2879472
Number of successful extensions: 8128
Number of sequences better than 10.0: 32
Number of HSP's gapped: 8294
Number of HSP's successfully gapped: 32
Length of query: 649
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 533
Effective length of database: 40,180,143
Effective search space: 21416016219
Effective search space used: 21416016219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)