Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL154C (IMP2')5.710ON34634612431e-172
Smik_9.155.710ON34434611871e-163
Skud_9.145.710ON35135111661e-160
Suva_9.345.710ON32034910451e-142
NDAI0F002305.710ON4862077781e-99
NCAS0G001905.710ON4432087498e-96
TDEL0B021005.710ON3403456591e-83
CAGL0H06677g5.710ON3382826461e-81
ZYRO0B16500g5.710ON3423546452e-81
KAFR0D021805.710ON3872026396e-80
Kpol_1043.765.710ON3722986221e-77
KNAG0L021805.710ON4392205906e-72
TBLA0E017405.710ON3752015733e-70
SAKL0E15092g5.710ON3522565418e-66
TPHA0E001605.710ON4403305462e-65
Kwal_55.196555.710ON3242544893e-58
KLTH0E00858g5.710ON3242544874e-58
KLLA0A00440g5.710ON3552773806e-42
AFR294W5.710ON3402603291e-34
Ecym_40115.710ON4222913032e-30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL154C
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}  IM...   483   e-172
Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON} Y...   461   e-163
Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 3...   453   e-160
Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641...   407   e-142
NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}...   304   1e-99
NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}...   293   8e-96
TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {O...   258   1e-83
CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} simila...   253   1e-81
ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} simi...   253   2e-81
KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {O...   250   6e-80
Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON} (1644...   244   1e-77
KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5....   231   6e-72
TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.7...   225   3e-70
SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some...   213   8e-66
TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}...   214   2e-65
Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}...   192   3e-58
KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}...   192   4e-58
KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON...   150   6e-42
AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic ho...   131   1e-34
Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON} s...   121   2e-30

>YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}
           IMP2'Transcriptional activator involved in maintenance
           of ion homeostasis and protection against DNA damage
           caused by bleomycin and other oxidants, contains a
           C-terminal leucine-rich repeat
          Length = 346

 Score =  483 bits (1243), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 248/346 (71%), Positives = 248/346 (71%)

Query: 1   MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQM                         
Sbjct: 1   MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMERGHRERGRSKKKRGERDSNVSSLS 60

Query: 61  XXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
                        EEEFLKWTVLRQDPSMRLR                            
Sbjct: 61  RSRSRASSRSRVREEEFLKWTVLRQDPSMRLRVVDVDSEEEGEGNDEDDDDGDGDDMDEE 120

Query: 121 XXXXXXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENE 180
                    IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENE
Sbjct: 121 ESDEEQVSDIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENE 180

Query: 181 DVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTV 240
           DVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTV
Sbjct: 181 DVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTV 240

Query: 241 YIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEM 300
           YIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAG          SLTHPYPKHLLNEM
Sbjct: 241 YIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEM 300

Query: 301 IHGLKPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           IHGLKPVALCCSLSVILSTLQNFVCSVPI             GISE
Sbjct: 301 IHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE 346

>Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON}
           YIL154C (REAL)
          Length = 344

 Score =  461 bits (1187), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 238/346 (68%), Positives = 243/346 (70%), Gaps = 2/346 (0%)

Query: 1   MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MQKSILLTKPDGTQSNLHS KTETPTTVEFDSEQM                         
Sbjct: 1   MQKSILLTKPDGTQSNLHSAKTETPTTVEFDSEQMERGQRERGRSKKKRGDQDSSVSSLS 60

Query: 61  XXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
                        EEEFLKWTVLRQDPSMRLR                            
Sbjct: 61  RSRSRASSRSRVREEEFLKWTVLRQDPSMRLRVVDVDSEEEGEGNDDDGDDGDDVDEEES 120

Query: 121 XXXXXXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENE 180
                    +ENDLEIDEEFHYDLGMKVLPNFCTSINEVL+SSKPWIAKYEISIRGHE+E
Sbjct: 121 DEEQVSD--VENDLEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIRGHEDE 178

Query: 181 DVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTV 240
            VSLEQLDGGYVRAMQLLTKGAGAE GNQRSFILYTDLSSESTYALTYLMGA VNQGDT+
Sbjct: 179 GVSLEQLDGGYVRAMQLLTKGAGAEPGNQRSFILYTDLSSESTYALTYLMGAVVNQGDTL 238

Query: 241 YIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEM 300
           YIVHWEPSKPTDD+QMFANVARIRKHVMHLFDCVAG          SLTHPYPKHLLNEM
Sbjct: 239 YIVHWEPSKPTDDAQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEM 298

Query: 301 IHGLKPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           IHGLKPVALCCSLSVILSTLQNFVCSVPI             GI E
Sbjct: 299 IHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGICE 344

>Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 351
           aa] {ON} YIL154C (REAL)
          Length = 351

 Score =  453 bits (1166), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 236/351 (67%), Positives = 241/351 (68%), Gaps = 5/351 (1%)

Query: 1   MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMXX---XXXXXXXXXXXXXXXXXXXX 57
           MQKSILLTKPDGTQSNLH  KTETPTTVEFDSEQM                         
Sbjct: 1   MQKSILLTKPDGTQSNLHRTKTETPTTVEFDSEQMERGHRERGRSKKKRDERDSYASSLS 60

Query: 58  XXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXX 117
                           EEEFLKWTVLRQDPSMRL+                         
Sbjct: 61  RSRSRASRASSRSRVREEEFLKWTVLRQDPSMRLKVADADSDEEEEGEGGDDDDDDEDGD 120

Query: 118 XXXXXXXX--XXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIR 175
                         +END EIDEEFHYDLGMKVLPNFCTSINEVL+SSKPWIAKYEISIR
Sbjct: 121 DMDEEESDEEQVSDVENDAEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIR 180

Query: 176 GHENEDVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVN 235
           GHENE VSLEQLDGGYVRAMQLLTKGAGAE GNQRSFILYTDLSSESTYALTYLMGA VN
Sbjct: 181 GHENEGVSLEQLDGGYVRAMQLLTKGAGAEPGNQRSFILYTDLSSESTYALTYLMGAVVN 240

Query: 236 QGDTVYIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKH 295
           QGDT+YI+HWEPSKPTDDSQMFANVARIRKHVMHLFDC AG          SLTHPYPKH
Sbjct: 241 QGDTLYILHWEPSKPTDDSQMFANVARIRKHVMHLFDCAAGVLDDLDVVVLSLTHPYPKH 300

Query: 296 LLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           LLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPI             GISE
Sbjct: 301 LLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE 351

>Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641)
           [963 bp, 320 aa] {ON} YIL154C (REAL)
          Length = 320

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 227/349 (65%), Gaps = 32/349 (9%)

Query: 1   MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMXXXXXXXXXXXXXXXXXXXXXXXXX 60
           M KSILLT PDG Q+NLH  K ETPTTVEFDSEQ+                         
Sbjct: 1   MHKSILLTTPDGAQTNLHQTKPETPTTVEFDSEQLERGHRERGRSKK------------- 47

Query: 61  XXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
                        EE+FLKWTVLRQDPSMRLR                            
Sbjct: 48  -------------EEQFLKWTVLRQDPSMRLRVVDQDSEEDEDNDNNNNNDDDGPNDDDV 94

Query: 121 XXXXX---XXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGH 177
                       ++NDLEIDEEFHYDLGMKVLPNFCTSIN+VLDS+KPWIAKYE+   GH
Sbjct: 95  DDEESDEEQVSDVDNDLEIDEEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYEM---GH 151

Query: 178 ENEDVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQG 237
           EN+ VSLE+L GGYVRAMQLLTKGAGAE G QR FILYTDLSSESTYALTYLMGA +NQG
Sbjct: 152 ENDGVSLERLAGGYVRAMQLLTKGAGAEPGAQRCFILYTDLSSESTYALTYLMGAVLNQG 211

Query: 238 DTVYIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLL 297
           DT+YIVHWEPS P DD+QM ANVARIRKHVMHLFDCVAG          SLTHPYPKHLL
Sbjct: 212 DTLYIVHWEPSTPVDDAQMLANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLL 271

Query: 298 NEMIHGLKPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           NEMIHGLKPVALCCSLSVIL TLQNFVCSVP              GI E
Sbjct: 272 NEMIHGLKPVALCCSLSVILGTLQNFVCSVPTLAVRKKLKRAKRKGICE 320

>NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}
           Anc_5.710 YIL154C
          Length = 486

 Score =  304 bits (778), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 142/207 (68%), Positives = 165/207 (79%), Gaps = 10/207 (4%)

Query: 130 IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDG 189
           IEND+EIDE F+YDLGMKVLPNFC+SIN++LD++KPWIAKYE SI+G ENE V+   LDG
Sbjct: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330

Query: 190 GYVRAMQLLTKGAGAE--------AGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVY 241
           GY+RAMQLLTKG GA         AG  R +ILYTDLSSESTYALTY+MGA +N GDT+Y
Sbjct: 331 GYIRAMQLLTKGKGASMDFDPMKPAG--RCYILYTDLSSESTYALTYMMGAVLNNGDTLY 388

Query: 242 IVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMI 301
           IVHWE SK  ++  M  NV R+RKHVMH+FDCV+           SLTHPYPKHLLNEMI
Sbjct: 389 IVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448

Query: 302 HGLKPVALCCSLSVILSTLQNFVCSVP 328
           HGLKPV++ CSL++ILSTLQNFVCSVP
Sbjct: 449 HGLKPVSIACSLTIILSTLQNFVCSVP 475

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/19 (94%), Positives = 19/19 (100%)

Query: 74  EEEFLKWTVLRQDPSMRLR 92
           EEEFLKWTVLRQDPSMRL+
Sbjct: 178 EEEFLKWTVLRQDPSMRLQ 196

>NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}
           Anc_5.710 YIL154C
          Length = 443

 Score =  293 bits (749), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 137/208 (65%), Positives = 162/208 (77%), Gaps = 9/208 (4%)

Query: 130 IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDG 189
           IEND+EIDE F+YDLGMKVLPNFC+SIN++LD++KPWIAKYE SI+G EN++V + +LDG
Sbjct: 218 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENDNVEIGRLDG 277

Query: 190 GYVRAMQLLTKGAGAEAGNQ---------RSFILYTDLSSESTYALTYLMGAAVNQGDTV 240
           GY+RAMQLLTKG GA    +         R +ILYTDLSSESTYALTY MGA +N GDT+
Sbjct: 278 GYLRAMQLLTKGKGAYLNTESTATPTPAGRCYILYTDLSSESTYALTYTMGAVINNGDTL 337

Query: 241 YIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEM 300
           Y+VH E S   D+  M  NV RIRKHVMH+FDC++           SLTHPYPKHLLNEM
Sbjct: 338 YVVHSENSNIFDEPLMLKNVGRIRKHVMHMFDCISAVVDDVDVVALSLTHPYPKHLLNEM 397

Query: 301 IHGLKPVALCCSLSVILSTLQNFVCSVP 328
           IHGLKPVALC  LS++LS+LQNFVCSVP
Sbjct: 398 IHGLKPVALCVPLSIMLSSLQNFVCSVP 425

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/19 (94%), Positives = 19/19 (100%)

Query: 74  EEEFLKWTVLRQDPSMRLR 92
           EEEFLKWTVLRQDPSMRL+
Sbjct: 135 EEEFLKWTVLRQDPSMRLQ 153

>TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {ON}
           Anc_5.710 YIL154C
          Length = 340

 Score =  258 bits (659), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 188/345 (54%), Gaps = 12/345 (3%)

Query: 3   KSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           + ILLT  DG+QS L+    E    V+FDSEQ+                           
Sbjct: 7   RGILLTGTDGSQSPLNVNDNEPAGGVQFDSEQLERGRSRTKIRNNGSSQLSASSSRSRSR 66

Query: 63  XXXXXXXXXXXEEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
                      +EEFLKWTVLR+DPSMRL+                              
Sbjct: 67  ASSRIR-----DEEFLKWTVLRRDPSMRLQLNQKDDKKSRDEQSDDEDSEELDLEDDVSD 121

Query: 123 XXXXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDV 182
                  ++ND +IDEEFHYDLGMKVLPNF  S+N+VLDSSK WI ++  + +  E   +
Sbjct: 122 EEQVTD-VDNDFDIDEEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANTQEPE---I 177

Query: 183 SLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYI 242
            L  L GGY RAM  L+KG G+     RS+IL +DL+SES YALTY+MGA V+ GDT+Y+
Sbjct: 178 PLATLAGGYKRAMLPLSKGKGSTT--DRSYILCSDLTSESQYALTYVMGALVSNGDTLYV 235

Query: 243 VHWEPSKPTD-DSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMI 301
           VHW+    +D D+++  N+  IR++V H+FD +            SL HP+PK LL EMI
Sbjct: 236 VHWDNQSSSDADAKLQKNILTIRENVEHMFDSIGAVIEDFDVVVLSLQHPFPKQLLTEMI 295

Query: 302 HGLKPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           HGL+PVALCCSLS+ILSTLQN+VCSVP              GISE
Sbjct: 296 HGLQPVALCCSLSMILSTLQNYVCSVPTLVIRKKLKRAKKKGISE 340

>CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154c IMP2
          Length = 338

 Score =  253 bits (646), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 146/282 (51%), Positives = 171/282 (60%), Gaps = 9/282 (3%)

Query: 74  EEEFLKWTVLRQDPSMRLRXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXX 128
           EEEFLKWTVLR+DPSMRL                                          
Sbjct: 57  EEEFLKWTVLRRDPSMRLTTLKKNKKSGSGTGGDDDDDDDEDDDDEDDDDEEESDEERVS 116

Query: 129 XIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIR-GHENEDVSLEQL 187
            IEND EIDEEFH+DLG KVLPNF TSIN+VL++SKPWI KY  ++    E   V+ E L
Sbjct: 117 DIENDAEIDEEFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLSTLDMEKERAGVNFETL 176

Query: 188 DGGYVRAMQLLTKGAGAEA--GNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHW 245
           +GGY RA++L+ KG GAEA     +++IL TDLSSESTYALTY+MG+ V+ GDT+YIVHW
Sbjct: 177 EGGYSRALELVRKGKGAEAHPETSKNYILCTDLSSESTYALTYVMGSLVSNGDTLYIVHW 236

Query: 246 EPSKPTDDSQMFA-NVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGL 304
           +    T     F  N  R++KHV HL DCV+           SLTHPYPKHLLNEMIHGL
Sbjct: 237 DGDSTTSTKDSFIDNALRVKKHVRHLMDCVSVIVDDLDVVIISLTHPYPKHLLNEMIHGL 296

Query: 305 KPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           KPV L CSLS+ILS+LQNFVCSVP              GISE
Sbjct: 297 KPVTLACSLSLILSSLQNFVCSVPTLVIRKKLKRSRKKGISE 338

>ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154C IMP2'
           Transcriptional activator involved in maintenance of ion
           homeostasis and protection against DNA damage caused by
           bleomycin and other oxidants contains a C- terminal
           leucine-rich repeat
          Length = 342

 Score =  253 bits (645), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/354 (40%), Positives = 189/354 (53%), Gaps = 24/354 (6%)

Query: 2   QKSILLTKPDGTQSNL-------HSIKTETPTTVEFDSEQMXXXXXXXXXXXXXXXXXXX 54
           QKSILLT PDGT++ L       HS+    P  V+FDSEQ+                   
Sbjct: 4   QKSILLTVPDGTRTVLLDEPHRRHSLAE--PGGVQFDSEQLERGRSRVKAARGIKSNSGS 61

Query: 55  XXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRL-RXXXXXXXXXXXXXXXXXXXXX 113
                                EFLKWTVL++DPSMRL +                     
Sbjct: 62  RSRSRNPSHVR--------NGEFLKWTVLKRDPSMRLHKKPHGNGIGNNADDEEEEEEDE 113

Query: 114 XXXXXXXXXXXXXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEIS 173
                           +ENDLEIDE+ HYD+G +VLPN+  SINEVL S+K WI+ YE  
Sbjct: 114 DQEDEDLVSDEEQVSDVENDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ 173

Query: 174 IRGHENEDVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAA 233
                 +DVS  +L GGY R  QLL++G GA    +RSF+L TDL++ES YAL Y++GA 
Sbjct: 174 ---ETTQDVSFTKLPGGYSRCCQLLSRGKGATT--RRSFVLCTDLTTESHYALAYVIGAL 228

Query: 234 VNQGDTVYIVHWEPSKPTDDSQMF-ANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPY 292
           +N GDT+YIVHW+  +P    +    +V  +R+HV+H  DC +           SL+HPY
Sbjct: 229 LNNGDTLYIVHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCASASLQDLDVVLLSLSHPY 288

Query: 293 PKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           PKHLL+EMI+ L+P+ALCCSLS++L+TLQNFVCSVP              GIS+
Sbjct: 289 PKHLLSEMIYALQPIALCCSLSLVLTTLQNFVCSVPTLVIRKKLKRSKRKGISD 342

>KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {ON}
           Anc_5.710 YIL154C
          Length = 387

 Score =  250 bits (639), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 115/202 (56%), Positives = 157/202 (77%), Gaps = 3/202 (1%)

Query: 130 IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRG-HENEDVSLEQLD 188
           I+N++EIDE+  +DLGMKVLPNFC SINEVL+S KPW+ +YE  I     +E   L++++
Sbjct: 168 IDNEVEIDEKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYEKEIESVLPDETTKLDEIE 227

Query: 189 GGYVRAMQLLTKGAGA-EAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEP 247
            GY+RA+ L+TKG G+ + G+ +S+IL+ DLSSES YALTY+MG  +N GDT+YIV+WE 
Sbjct: 228 DGYIRAIDLVTKGEGSSKNGDGQSYILFMDLSSESIYALTYVMGCVINNGDTLYIVNWES 287

Query: 248 S-KPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKP 306
           + K  D++ ++ N+ R++K  +HLFDC++G          SLTHPYPKHLL+EMI+GLKP
Sbjct: 288 TLKHIDETIIYNNLKRVKKMTLHLFDCISGVIDNLDVIIVSLTHPYPKHLLSEMIYGLKP 347

Query: 307 VALCCSLSVILSTLQNFVCSVP 328
           +ALCCSLS++LSTLQNFVCSVP
Sbjct: 348 MALCCSLSIMLSTLQNFVCSVP 369

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 44/107 (41%), Gaps = 20/107 (18%)

Query: 2   QKSILLTKPDGTQSNLHSIKTET-----------------PTTVEFDSEQMXXXXXXXXX 44
            KSILLT PDGTQ+ LH++++ T                  T V+F+ ++          
Sbjct: 7   NKSILLTTPDGTQAPLHAVESRTTKDSSPSPKDESILHKNATEVQFNIDR---GRSRLKK 63

Query: 45  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRL 91
                                        EEEFLKWTVLRQDPSMRL
Sbjct: 64  QRSNASTSQSFSRSRSRSKSFSRNSSKVREEEFLKWTVLRQDPSMRL 110

>Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON}
           (164489..165607) [1119 nt, 373 aa]
          Length = 372

 Score =  244 bits (622), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/298 (43%), Positives = 173/298 (58%), Gaps = 28/298 (9%)

Query: 74  EEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXX------------XXXXXXXXXXXXXXX 121
           +EEFLKWTVLR+DPSMRLR                                         
Sbjct: 78  DEEFLKWTVLRRDPSMRLRTIRKKNQQGLNKKKHGAEEDDDEEEDEEEEEEEEDDDDDEI 137

Query: 122 XXXXXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENED 181
                   IEN+ +IDE+  +DLG KVLPN+C SIN++++SSK WI+ Y        N++
Sbjct: 138 SDEEQVSDIENENDIDEDITFDLGTKVLPNYCMSINDIMESSKKWISDYLSRPENLRNDN 197

Query: 182 VSLEQLDGGYVRAMQLLTKG---------AGAEAGNQRSFILYTDLSSESTYALTYLMGA 232
           V +E+++GG+V+AM+L++K          +G E     S+ILYTDL+SESTYAL Y++GA
Sbjct: 198 VHIEKMEGGFVKAMELISKKEDSSTSISSSGKEGD---SYILYTDLTSESTYALAYVLGA 254

Query: 233 AVNQGDTVYIVHWEPSKP--TDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTH 290
            VN GDT+Y+VHWE +      D++++ N+ RIRKHVMHL DC +           SLTH
Sbjct: 255 LVNNGDTLYVVHWEGNNTHGVTDTRIYDNIFRIRKHVMHLLDCSSAVIDRIDILLISLTH 314

Query: 291 PYPKHLLNEMIHGLKPVALCCSLSVIL--STLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           PYPKHLLNEMIHGLKP  LCCSLSV+L  S LQN+V S+P+             GI+E
Sbjct: 315 PYPKHLLNEMIHGLKPKTLCCSLSVVLSPSGLQNYVSSIPMLVIRKKLKRPRKKGINE 372

>KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5.710
           YIL154C
          Length = 439

 Score =  231 bits (590), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 146/220 (66%), Gaps = 5/220 (2%)

Query: 130 IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDG 189
           +END EIDE+F YDLG K LPNFC SINEV+ S++PWI +Y+    G   E + +  ++G
Sbjct: 222 VENDAEIDEKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDAD-HGESQEKIDVRDVEG 280

Query: 190 GYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPSK 249
           GYVRA++LLT+G GA +    ++I+Y+DLSSES YAL Y++G  V  GDTVY+VHW   +
Sbjct: 281 GYVRAVELLTRGKGA-SPQADTYIVYSDLSSESNYALLYVLGTLVGNGDTVYVVHWHSDR 339

Query: 250 ---PTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKP 306
                  S++ +NV  +R+  +HLFDC++           S THPYPKHLLNEMI+ L P
Sbjct: 340 GGGAVTHSEVRSNVRNLRRKALHLFDCLSATVDDLDIVLLSTTHPYPKHLLNEMINALHP 399

Query: 307 VALCCSLSVILSTLQNFVCSVPIXXXXXXXXXXXXXGISE 346
           VALCCSLS++LS LQNFVCSVP              GIS+
Sbjct: 400 VALCCSLSIVLSLLQNFVCSVPTFVIRKKLKRAKRKGISD 439

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/18 (100%), Positives = 18/18 (100%)

Query: 74  EEEFLKWTVLRQDPSMRL 91
           EEEFLKWTVLRQDPSMRL
Sbjct: 139 EEEFLKWTVLRQDPSMRL 156

>TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.710
           YIL154C
          Length = 375

 Score =  225 bits (573), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 104/201 (51%), Positives = 140/201 (69%), Gaps = 2/201 (0%)

Query: 130 IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDG 189
           IEN+ E+DEEF ++ G K+LPNFCT IN  L+  K WI  YE  ++G ENE ++L +LD 
Sbjct: 163 IENEAELDEEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYESQVKGKENEGINLIKLDN 222

Query: 190 GYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEP-S 248
           GY RA++  +KG G  A + +S++LY+DLSSESTYAL YL+G+ +  GD +Y+VHWE  +
Sbjct: 223 GYARAIEGYSKGKGCSA-DGKSYLLYSDLSSESTYALAYLIGSIIKNGDMIYLVHWEGNN 281

Query: 249 KPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKPVA 308
           K   + Q+  NV R+R+HV+HL D  +           SLTHPYPKH LNE+IHGL    
Sbjct: 282 KKIPEKQLSDNVFRMRRHVLHLLDAASTIIDDAEIMMVSLTHPYPKHFLNELIHGLDISM 341

Query: 309 LCCSLSVILSTLQNFVCSVPI 329
           LCCSL++ILS LQNFV S+P+
Sbjct: 342 LCCSLTMILSGLQNFVSSIPM 362

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 36/90 (40%), Gaps = 12/90 (13%)

Query: 3  KSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMXXXXXXXXXX-XXXXXXXXXXXXXXXX 61
          + ILLT P+GT            T V+FDSEQ+                           
Sbjct: 5  RGILLTTPEGT-----------GTAVQFDSEQIENDRGRSKKRFKDKTNTSRSATGGSSI 53

Query: 62 XXXXXXXXXXXXEEEFLKWTVLRQDPSMRL 91
                      +EEFLKWTVLR+DPSMRL
Sbjct: 54 SRSRSRASSRVRDEEFLKWTVLRKDPSMRL 83

>SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some
           similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 352

 Score =  213 bits (541), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 115/256 (44%), Positives = 156/256 (60%), Gaps = 10/256 (3%)

Query: 74  EEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEND 133
           +E +LKWTVLR+DPS RL                                      IEND
Sbjct: 88  DESYLKWTVLRRDPSERLHKNEENDRDESAIDDDDYDEDDVSDEEQISD-------IEND 140

Query: 134 LEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISI-RGHENEDVSLEQLDGGYV 192
            EID E  YDLG +VLPNF TSI+ VL+S+KPW  KY  ++ +  E   + L+ L GGY+
Sbjct: 141 QEIDSELDYDLGARVLPNFSTSISNVLESNKPWTKKYLQTVDQKAERAKIKLDSLPGGYM 200

Query: 193 RAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPSKPTD 252
           RAM L+T+G G  + +  S+ILY DLSSES YALTY +GA VN GDT+Y+VH E S  T 
Sbjct: 201 RAMSLVTRGKGGSSTHGSSYILYADLSSESMYALTYTLGAVVNSGDTLYVVHVESS--TT 258

Query: 253 DSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKPVALCCS 312
           ++++  N+ ++ +    L DC +G          SL+HPYPKHL+N+MIHGLKP+ L  S
Sbjct: 259 ETRLLQNIDKLTQQTAFLLDCTSGVVNDLSVVLLSLSHPYPKHLVNQMIHGLKPLLLVVS 318

Query: 313 LSVILSTLQNFVCSVP 328
           LS++L++LQN+VC++P
Sbjct: 319 LSLVLTSLQNYVCNIP 334

>TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}
           Anc_5.710 YIL154C
          Length = 440

 Score =  214 bits (546), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 173/330 (52%), Gaps = 58/330 (17%)

Query: 74  EEEFLKWTVLRQDPSMRL---RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 130
           +EEFLKWTVLR+DPSMRL   R                                     +
Sbjct: 112 DEEFLKWTVLRKDPSMRLKFRRANDGAHRDHSNEDLEDDDDEYFDEDDDEISDEEQVSDL 171

Query: 131 ENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHE---NEDVSLEQL 187
           EN+LEID+ F +DLGMKVLPN+C SINEVL+ SKPW + Y   +  ++   N +V + +L
Sbjct: 172 ENELEIDD-FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKIDPNANVLINEL 230

Query: 188 DGGYVRAMQLLTKG---------------AGAEAGNQRS--------------------- 211
           +GG+V+AM+L++K                + +E   Q S                     
Sbjct: 231 EGGFVKAMELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIASSNTNNTTSS 290

Query: 212 ---------FILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPSKPTDD----SQMFA 258
                    FILYTDLSSESTYALTY+MG  V   DT+YIVHWE S  +++     +M +
Sbjct: 291 SGSSDSGDSFILYTDLSSESTYALTYVMGTLVKNNDTLYIVHWEGSTTSNNDAMKKKMTS 350

Query: 259 NVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKPVALCCSLSVIL- 317
           N+ +IR++VM+L DC             S+THPYPKH LNEMI+GLKP +L CSL+++L 
Sbjct: 351 NLQKIRENVMYLNDCNNSIIDRLDVVVISMTHPYPKHFLNEMIYGLKPKSLICSLNIMLS 410

Query: 318 -STLQNFVCSVPIXXXXXXXXXXXXXGISE 346
            S LQN+VCS+P+             GI E
Sbjct: 411 PSGLQNYVCSIPVLVIRKKLKRTRRRGIDE 440

>Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}
           YIL154C (IMP2') - transcription factor [contig 159] FULL
          Length = 324

 Score =  192 bits (489), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 142/254 (55%), Gaps = 18/254 (7%)

Query: 77  FLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIENDLEI 136
           +LKWTVL  DPS RL+                                     ++N++ I
Sbjct: 69  YLKWTVLHHDPSERLQLSAQDGKDSSDDEEDVSDEEQVSD-------------VDNEINI 115

Query: 137 DEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDGGYVRAMQ 196
           D    YDLG +VLPNF  S+ +VL + KPWIAKY  ++    N DV L++L GGY RA+Q
Sbjct: 116 DAALGYDLGARVLPNFTNSLWDVLQTEKPWIAKYNETV-DENNTDVKLDELQGGYARAIQ 174

Query: 197 LL--TKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPSKPTDDS 254
           ++   K    E     S+I+Y DL+ ES YAL Y+ GA ++  DT+Y+VH  P  P+D  
Sbjct: 175 VMHSAKSQKTELKPGASYIVYLDLTPESFYALLYVFGAVLSPNDTLYVVHISPRVPSD-- 232

Query: 255 QMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKPVALCCSLS 314
           Q+ +NVAR+R    +L D  +           S++HPYPKHLLNEM+  LKP+ALC  LS
Sbjct: 233 QLRSNVARLRAQTAYLLDASSAALDSVSVVILSVSHPYPKHLLNEMVLALKPMALCVPLS 292

Query: 315 VILSTLQNFVCSVP 328
           ++LS LQN+VC +P
Sbjct: 293 LVLSVLQNYVCPIP 306

>KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}
           some similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage
          Length = 324

 Score =  192 bits (487), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 143/254 (56%), Gaps = 18/254 (7%)

Query: 77  FLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIENDLEI 136
           +LKWTVL+ DPS RL                                      +EN+++I
Sbjct: 69  YLKWTVLQHDPSERL-------------LLGTKEGAEASDDDEDVSDEEQVSDVENEIDI 115

Query: 137 DEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDGGYVRAMQ 196
           D    YDLG +VLPNF +S+ +V+ + KPW+AK+  S+ G ++  V LE L GGY RA++
Sbjct: 116 DAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEGKDS-GVKLEDLQGGYARAIK 174

Query: 197 LL--TKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPSKPTDDS 254
           ++      GAEA   RS+I+Y DL+ ES YAL Y+ GA +   DT+Y+VH     P +  
Sbjct: 175 IVHGKPQQGAEAREGRSYIIYLDLTPESFYALLYVFGAVLASNDTLYVVHISQRVPNE-- 232

Query: 255 QMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKPVALCCSLS 314
           Q+ ANV R+     +L D  +           S++HPYPKHLLNE++  LKP+ALC  LS
Sbjct: 233 QLRANVERLEAEAAYLLDASSAALNAVNVVLLSVSHPYPKHLLNELVIALKPMALCVPLS 292

Query: 315 VILSTLQNFVCSVP 328
           ++LS+LQN+VC +P
Sbjct: 293 LVLSSLQNYVCPIP 306

>KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON}
           similar to uniprot|Q753L8 Ashbya gossypii AFR294W
           AFR294Wp and weakly similar to YIL154C uniprot|P32351
           Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
           activator involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 355

 Score =  150 bits (380), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 131/277 (47%), Gaps = 24/277 (8%)

Query: 74  EEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXX------------XXXXXXXXXXXXXXXX 121
           ++ +LKWT+L +DPS RL                                          
Sbjct: 65  DQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQENGGDEDEDEDEEEFIEDREDDGEV 124

Query: 122 XXXXXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENED 181
                   +EN++EIDE   YDLG KVLPNF T I +VLDS KPW+AK        +  D
Sbjct: 125 SEEEQVSDVENEIEIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRD 184

Query: 182 VSLEQLDGGYVRAMQLLTKG---AGAEAGNQRSFILYTDLSSES----TYALTYLMGAAV 234
           + LE++  G  RA+  ++KG     A +    SF++Y D   ES     YAL Y  G+  
Sbjct: 185 IKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVF 244

Query: 235 NQGDTVYIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCV--AGXXXXXXXXXXSLTHPY 292
             GDT+YI++       D + M   + RI  H+ +LF+C    G          S+ HPY
Sbjct: 245 TNGDTLYIIN---QCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPY 301

Query: 293 PKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPI 329
           PK LL EM H L+P ++   L  +L++LQNF+ SVP+
Sbjct: 302 PKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPM 338

>AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL154C (IMP2')
          Length = 340

 Score =  131 bits (329), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 118/260 (45%), Gaps = 30/260 (11%)

Query: 74  EEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEND 133
           ++EFL+WT+LR DPS RL                                      +END
Sbjct: 88  DQEFLRWTILRADPSERLHLGAVEDEEDDDELSDEEQLSD----------------VEND 131

Query: 134 LEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEIS-IRGHENEDVSLEQLDGGYV 192
            ++D E  YDLG +VLPNF  SI +VLD    W+A+Y  S   G    DV    L     
Sbjct: 132 YDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDV----LQDTCT 187

Query: 193 RAMQLLTKGAGAEAGNQRSFILY-TDL---SSESTYALTYLMGAAVNQGDTVYIVHWEPS 248
           RA++   + +GA     ++F+ Y  DL   ++E  YALTY  GA +   DT+YI      
Sbjct: 188 RAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVL--- 244

Query: 249 KPTDDSQMFANVARIRKHVMHLFDCVAGXXXXXXXXXXSLTHPYPKHLLNEMIHGLKPVA 308
              D   + +++ R+ + V  L DC A           +L H YP+HLL E IH  +P  
Sbjct: 245 --CDAVDVESHLNRVAEQVAFLLDCSAAALDDLDVVVLALQHAYPRHLLTETIHAFRPAG 302

Query: 309 LCCSLSVILSTLQNFVCSVP 328
           L   L +   +L  +V SVP
Sbjct: 303 LIVPLQIATRSLAGYVSSVP 322

>Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON}
           similar to Ashbya gossypii AFR294W
          Length = 422

 Score =  121 bits (303), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 122/291 (41%), Gaps = 42/291 (14%)

Query: 74  EEEFLKWTVLRQDPSMRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--------- 124
           E E L+WT+LR DPS RL                                          
Sbjct: 120 EHELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPAGAAAGIAEDIEDVLSDE 179

Query: 125 XXXXXIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIR-GHENEDVS 183
                +END E+D    YDLG +VLPNF TSI + LDS   W+A Y   I    E + V 
Sbjct: 180 EQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQ 239

Query: 184 LEQLDGGYVRAMQLLTK----------------------GAGAEAGNQRSFILY-TDLS- 219
           ++ L+    RA+Q + K                       A  E   +++F+LY  DL+ 
Sbjct: 240 VDVLENCK-RAIQHIAKRALSPAPAGAAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNT 298

Query: 220 --SESTYALTYLMGAAVNQGDTVYIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGX 277
             SE  YALTY  GA +   DT+YIV        D + + A++ ++R+ V  L D  +  
Sbjct: 299 SHSEKLYALTYTFGAVLANRDTLYIV-----VQCDAADVEAHLVKVREQVAFLLDATSAA 353

Query: 278 XXXXXXXXXSLTHPYPKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVP 328
                    +L HPYP+HLL E+    +P AL   L +   +L  +V  VP
Sbjct: 354 LDHLDIIILTLHHPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVP 404

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,588,512
Number of extensions: 867739
Number of successful extensions: 1971
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1952
Number of HSP's successfully gapped: 43
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)