Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL153W (RRD1)5.709ON39339321260.0
Smik_9.165.709ON39339318940.0
Skud_9.155.709ON40239318690.0
Suva_9.355.709ON39339318480.0
TDEL0B021105.709ON38935910951e-148
NCAS0G002005.709ON43841310791e-145
SAKL0E15070g5.709ON38536910661e-144
NDAI0F002405.709ON46432810631e-142
ZYRO0B16478g5.709ON39135210491e-141
KLTH0E00880g5.709ON37139810411e-140
Kpol_2001.775.709ON41334710071e-134
Kwal_55.196615.709ON37137710011e-134
Ecym_40125.709ON3953769701e-129
KAFR0D021905.709ON4264139631e-127
TBLA0E016905.709ON4883359501e-124
TPHA0D046505.709ON4213369391e-124
CAGL0H06655g5.709ON4243489151e-120
AFR293C5.709ON3653249051e-119
KNAG0L021705.709ON3963969001e-118
KLLA0A00462g5.709ON3533578961e-118
NCAS0C016908.674ON3593034255e-48
TPHA0D012408.674ON3593034133e-46
NDAI0E024108.674ON3592474124e-46
KAFR0H024408.674ON3532484055e-45
Kpol_1013.48.674ON3582474021e-44
CAGL0M02255g8.674ON3582464012e-44
ZYRO0F07326g8.674ON3522443993e-44
Ecym_23998.674ON3512533985e-44
Smik_6.3498.674ON3582703933e-43
TDEL0A062008.674ON3552583915e-43
ACR139C8.674ON3592683916e-43
KNAG0J016908.674ON3632513891e-42
YPL152W (RRD2)8.674ON3582693872e-42
SAKL0H06622g8.674ON3552473821e-41
KLTH0D11176g8.674ON3532553792e-41
Skud_16.1308.674ON3582463793e-41
KLLA0F11187g8.674ON3602503775e-41
TBLA0C018608.674ON3562973776e-41
Suva_16.1588.674ON3582523769e-41
Kwal_26.87838.674ON3552483643e-39
TDEL0H021607.228ON304127694.1
Suva_11.922.433ON46382686.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL153W
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   823   0.0  
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   734   0.0  
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   724   0.0  
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   716   0.0  
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   426   e-148
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      420   e-145
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   415   e-144
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      414   e-142
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   408   e-141
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   405   e-140
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   392   e-134
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   390   e-134
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   378   e-129
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   375   e-127
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   370   e-124
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   366   e-124
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   357   e-120
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   353   e-119
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   351   e-118
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   349   e-118
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   168   5e-48
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   163   3e-46
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   163   4e-46
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   160   5e-45
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   159   1e-44
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   159   2e-44
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   158   3e-44
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   157   5e-44
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   155   3e-43
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   155   5e-43
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   155   6e-43
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   154   1e-42
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   153   2e-42
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   151   1e-41
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   150   2e-41
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   150   3e-41
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   149   5e-41
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   149   6e-41
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   149   9e-41
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   144   3e-39
TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.22...    31   4.1  
Suva_11.92 Chr11 complement(177904..179295) [1392 bp, 463 aa] {O...    31   6.3  

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/393 (100%), Positives = 393/393 (100%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
           ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180
           YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360
           VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360

Query: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
           GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR
Sbjct: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/393 (91%), Positives = 370/393 (94%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           MSLD VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTL+SHC+DPDP A 
Sbjct: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
           ASSI M NGLM VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWL+EMLP E
Sbjct: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATV ALD+LGMFPH+RG DVFLLFNKY
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           EYK+TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360
           VVQHFWFGTGFFPWVNIQNGT+LPVFEEKEEE+IEQANAG PG E TSTRFP S SMPPP
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360

Query: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
             P SG+NINYLLSHQN S RNQ S  RDRLRR
Sbjct: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/393 (90%), Positives = 371/393 (94%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           MSLD VDW HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTL+SHC DPD HA 
Sbjct: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
           +SSIAMVNGLMGVLDKLA LIDETPPLPGPRRYGNLACREWH+KLDE L QWLQEMLP+E
Sbjct: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALD+LG+FPH+RG DVFLLFNKY
Sbjct: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKY 189

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA+APLQPRE+LDKSLV 
Sbjct: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249

Query: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           +YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 250 DYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309

Query: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360
           VVQHFWFGTGFFPWVNIQNGTDLPVFEEKE+E+IEQANA SPG   TSTRFP S SMPPP
Sbjct: 310 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRFPGSLSMPPP 369

Query: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
             PPSG++INYLLSHQN SHRNQ S S+DRLRR
Sbjct: 370 MGPPSGSSINYLLSHQNSSHRNQASSSKDRLRR 402

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/393 (87%), Positives = 369/393 (93%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           MSLD VDWPHA FSTPVKRIFDTQTT DFQSSLAIHRIKYHLHKYTTL+SHC+DPDPHAT
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
           ASSI MVNGLM VLD+ A LID+TPPLPGPRRYGNLACREWH+KLD  L QWL+E+LP++
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALD+LG+FPH+RG DVFLLF+KY
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           Y IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPR++LDKSLVR
Sbjct: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240

Query: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           EY+DTNFYCQGINFIN+VKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL+KFP
Sbjct: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300

Query: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360
           VVQHFWFGTGFFPW+N+QNGTDLPVFEEKEEESI+QANA S   ++TSTRFP STSMPPP
Sbjct: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFPASTSMPPP 360

Query: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
             PPS NN+N LLSHQN +HRNQTS SRDRLRR
Sbjct: 361 MAPPSANNVNSLLSHQNHTHRNQTSSSRDRLRR 393

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  426 bits (1095), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/359 (57%), Positives = 258/359 (71%), Gaps = 5/359 (1%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           +S  R+D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  +I     P  H  
Sbjct: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIH--GQPIVHE- 58

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
            S I +VN ++ +L +L+ L+DETPP  GPRRYGNLACR+WH KLD  L + LQ++LP +
Sbjct: 59  PSGIEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQD 118

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNK 179
           YH+ +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALDMLG++     G DV LLF+ 
Sbjct: 119 YHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDT 178

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLV 239
           YY ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PR++ +K LV
Sbjct: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWS-SDPAVPMTPRDVKNKVLV 237

Query: 240 REYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKF 299
           ++Y DTN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVLKKF
Sbjct: 238 QDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKF 297

Query: 300 PVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMP 358
           PVVQHFWFG GF+PW++ +NG  LP++E  E E  +  +  +     T+    T+  +P
Sbjct: 298 PVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIP 356

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  420 bits (1079), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 214/413 (51%), Positives = 276/413 (66%), Gaps = 32/413 (7%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65
           +D     FS P KRIFD+QTT DFQSS+A++R+++ L KY +++++   P P  T SS+ 
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91

Query: 66  MVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEML-------- 117
           +VN ++ +L+ L+ LIDETPPL GPRRYGNLACR+WH K++ +LP  L E+L        
Sbjct: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 118 --PSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPH-MRGADVF 174
              S  H  + EL YY+ N+FGSSTRLD+GTGHELSFMA +AA+DMLG++   M+G D+ 
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211

Query: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234
           LLFN YY ++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PR++ 
Sbjct: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268

Query: 235 DKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           D SLV++Y  +N YCQ I FI +VK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328

Query: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEE-------KEEESIEQ-------ANAG 340
           VLKKFPVVQHFWFG GF+PW+N   G  LP++E        ++E  I+Q        NA 
Sbjct: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAH 388

Query: 341 SPGREQTSTRFPTSTSMPPPGVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
               +   T  P+ T+      PPS   +N   SH           +RD+ RR
Sbjct: 389 VRTAKPGITAMPSVTNTRTNMAPPSSRMMN---SHDPTISSLLKRSTRDQARR 438

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/369 (54%), Positives = 262/369 (71%), Gaps = 10/369 (2%)

Query: 5   RVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSI 64
           ++D  H  F+ PVK+IFDTQ T DFQSS+ ++R++ +LHKY TL+   + P    + S+ 
Sbjct: 9   KIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP----STSNN 64

Query: 65  AMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
             VN    ++D L+  IDETPPLPGPRR+GN ACR WH K+   L   LQ  +P +YH  
Sbjct: 65  DAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVC 124

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNKYYTI 183
           + E++YYLGN+FGS  RLDYGTGHELSF+A V+A+DML ++  +  G D+  LFN YYT+
Sbjct: 125 IVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTL 184

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243
           +++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P +ILD+  V +Y 
Sbjct: 185 VKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYA 243

Query: 244 DTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303
            TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQ
Sbjct: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303

Query: 304 HFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTR----FPTSTSMPP 359
           HFWFGTGFFPWVN+++G  LP +E  +EE+   ++  S     T+T+      +ST+MPP
Sbjct: 304 HFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTTMPP 363

Query: 360 PGVPPSGNN 368
           P + PS N+
Sbjct: 364 PTILPSRNS 372

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  414 bits (1063), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 192/328 (58%), Positives = 245/328 (74%), Gaps = 5/328 (1%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCS-DPDPHATASSI 64
           +D     FS PVKRIFD+QTT DFQSS+A+ R+++ L +Y  L+++    P P +  S I
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 65  AMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPS-EYHE 123
            MVN ++ +L++L+ ++ +TPPL GPRRYGNLACR+WH K++  LP+ L++ +PS +   
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTI 183
            + EL YY+ NSFGSSTRLDYGTGHELSFMA +AALDMLG+FP + G D+ ++FN YY++
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243
           +R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+EI +  LV++Y 
Sbjct: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKDYS 250

Query: 244 DTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303
             N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 304 HFWFGTGFFPWVNIQNGTDLPVFEEKEE 331
           HFWFGTGF+PW+N Q   +LPV+E   E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 258/352 (73%), Gaps = 10/352 (2%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72
           F+TPVKRIFD+Q TL+FQ+S+AI R+KY + KY  +I+  + P      S I++VN  +G
Sbjct: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQ---GPSRISVVNEFVG 67

Query: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYL 132
           VL+ ++ L+D+TPPL GPRRYGNLACR+WH K+DE++P   +++LP  +H  + EL +YL
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127

Query: 133 GNSFGSSTRLDYGTGHELSFMATVAALDMLGMFP-HMRGADVFLLFNKYYTIMRRLILTY 191
           GNSFGS+TRLDYGTGHELSF+A V A+DMLG+F    +G D  L+ N YY ++R+LILTY
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 192 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFYCQG 251
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW     +APL+PR+IL+  LV+EY   N YCQ 
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246

Query: 252 INFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGF 311
           I FI +VK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306

Query: 312 FPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPPGVP 363
           +PWV+ Q G  L +++  +    ++ N  S G +  +  F +S + P P  P
Sbjct: 307 YPWVDNQTGKQLLIYDPADA---DRRNTSSTGGKYAA--FVSSINSPVPHFP 353

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  405 bits (1041), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 207/398 (52%), Positives = 266/398 (66%), Gaps = 33/398 (8%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           MSL+R+D   ATF+ P KRIFD++ +  FQSS+A+ R+K +LHKY + +S    P+    
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
            S+   V     +L  L+ L+D TP LPGPRRYGNLACR WH K+DE L   L + LP  
Sbjct: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNK 179
            H+ + ELQYYLGN+FGS  RLDYGTGHELSF A + ALDMLG++    + +DV  LF+K
Sbjct: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ-APLQPREILDKSL 238
           YY ++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PRE+ DK +
Sbjct: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234

Query: 239 VREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298
           V EY  TNFYCQ I+FI +VK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 299 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEE---ESIEQANAGSPGREQTSTRFPTST 355
           FPVVQHFWFGTG FPW ++ +G  LP +E  +E   + ++   A +P    ++ R     
Sbjct: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARR----- 349

Query: 356 SMPPPGVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
            M PP +      IN L              S+DR RR
Sbjct: 350 QMNPPNL----RGINRLT-------------SQDRFRR 370

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  392 bits (1007), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 246/347 (70%), Gaps = 11/347 (3%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD  +  S I  VN L+ 
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73

Query: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEML-------PSEYHEVV 125
           ++ +L+ L+DETPP PGPRR+GNL+CREWH K+D  L   L +ML        S+  + V
Sbjct: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFP-HMRGADVFLLFNKYYTIM 184
            EL YYLGNSFGSSTRLDYGTGHELSF+A +A +DMLG++  +++G D+ ++FN+YY +M
Sbjct: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKD 244
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P +I++K LV EY +
Sbjct: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252

Query: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312

Query: 305 FWFGTGFFPWVNIQNGTDLPVFEEKEEESIE-QANAGSPGREQTSTR 350
           FWFGTG FPW++      LP++E   +++      + SP     STR
Sbjct: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTR 359

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  390 bits (1001), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 197/377 (52%), Positives = 256/377 (67%), Gaps = 14/377 (3%)

Query: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60
           M  D++D    TF+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P   + 
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60

Query: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120
            + I+    L  +L   + L+DETP LPGPRRYGNLACR+WH K++E++ + LQE LP +
Sbjct: 61  PNVIS----LRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNK 179
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALDMLG++    +  D+  LFN+
Sbjct: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQW-QLLDAQAPLQPREILDKSL 238
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW    DA+A   PREI  K +
Sbjct: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEA--SPREIQSKMI 234

Query: 239 VREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298
           V EY  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 299 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMP 358
           FPVVQHFWFGT  FPW +   G  LP +E  +E   +   A  P   Q     P+ T + 
Sbjct: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDTQ---AQLPRMTQHQ---PSMTKLR 348

Query: 359 PPGVPPSGNNINYLLSH 375
            P  PP   N++  ++H
Sbjct: 349 HPMNPPHLRNVSRFIAH 365

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  378 bits (970), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 244/376 (64%), Gaps = 24/376 (6%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P      S  +
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 66  MVNGLMGVLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLQEMLPSE---- 120
            V+     LD+   LIDETPP    PRR+GN+ACR+WH K+ E +    +  LP E    
Sbjct: 63  FVSIF---LDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119

Query: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPH------MRGADVF 174
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+DMLG++        + G D+ 
Sbjct: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179

Query: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234
            L+NKYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  +IL
Sbjct: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239

Query: 235 DKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           D   + +Y+DTN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299

Query: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTS 354
           VL KFPVVQHFWFGTGFFPWV+++ G  LP +E   + + ++        E ++T  PT+
Sbjct: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359

Query: 355 T----------SMPPP 360
           T          +MPPP
Sbjct: 360 TGSSGKLTTSAAMPPP 375

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  375 bits (963), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 204/413 (49%), Positives = 255/413 (61%), Gaps = 33/413 (7%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65
           VD   + FS P KRIFD+QTT  FQ S+A +R+KY  +KY  L+     P P +   ++ 
Sbjct: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV--PLPVSRNITMT 67

Query: 66  MVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPS----EY 121
           +   ++ +LDK +  IDETPPL  PRR+GNL+CR WH K++  LP  L+ ++ +    E 
Sbjct: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127

Query: 122 HEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYY 181
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +DM+ M   M   D  L++  YY
Sbjct: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P++IL K +V E
Sbjct: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245

Query: 242 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
           +K+ N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305

Query: 302 VQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQA-NAGSPGREQTSTRFPTSTSMP-- 358
           VQHFWFG GFFPW +  +G DLPVFE  E ES   A     P   +T   F  + S    
Sbjct: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSP 365

Query: 359 ------------PPGV--------PPSGNNINYLLS--HQNQSHRNQTSFSRD 389
                       PP +        PPS N IN  LS  H   S++N+ +   D
Sbjct: 366 IMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLSRPHSQSSNQNRNTSGSD 418

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  370 bits (950), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 176/335 (52%), Positives = 232/335 (69%), Gaps = 18/335 (5%)

Query: 10  HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNG 69
           +  FS P K+IFD+Q T  F  S+A HRI+Y + KYT LI   + P P    SS   ++G
Sbjct: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP-PTDYTSSNDTISG 70

Query: 70  LMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLP---SEYH--EV 124
           +  +++ L  L++ETPPLPGPRRYGNL+CR+WH ++D+ + +  ++ L    ++++  ++
Sbjct: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIM 184
             EL YY   S GS TRLDYGTGHELSF+A + ALDML +   + G D+  +FN+YY ++
Sbjct: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------QAPLQPRE 232
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P +
Sbjct: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250

Query: 233 ILDKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292
           IL+K+L+ ++K +NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310

Query: 293 VEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFE 327
           VEVL KFPVVQHFWFGTGF+PW+N      LP +E
Sbjct: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  366 bits (939), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/336 (52%), Positives = 233/336 (69%), Gaps = 14/336 (4%)

Query: 3   LDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATAS 62
           L  ++    +FS P+KRI+D+Q+T  FQSS+AI+R+KY+LHKY  ++ +   PD     S
Sbjct: 4   LSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDL-TYVS 62

Query: 63  SIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYH 122
            I +VN +  +L +L++ ID  PP  GPRRYGNLACR WH  +D ++P  L+++L    H
Sbjct: 63  EITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNH 122

Query: 123 E-----------VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFP-HMRG 170
                        + EL YYL NS GS+TRLDYGTGHELSF+A +AA+DMLG++  + +G
Sbjct: 123 ATEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKG 182

Query: 171 ADVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQP 230
            D+  +F+ YY ++++LI+TYTLEPAGSHGVWGLDDHFHL YILGSSQ    +   P  P
Sbjct: 183 VDLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSE-NPNPPFSP 241

Query: 231 REILDKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKM 290
            +I++K +V EY   NFYC  I+FI +VK GPF EHSPILYDI+ TV  W KV  GL+KM
Sbjct: 242 SDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKM 301

Query: 291 YSVEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVF 326
           Y VEVL KFPVVQHFWFG GF+PW N++    L V+
Sbjct: 302 YMVEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVY 337

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  357 bits (915), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 183/348 (52%), Positives = 237/348 (68%), Gaps = 17/348 (4%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D   +     +V     
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVK---- 57

Query: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEML----PSEYHEVVPEL 128
           VLD+L  L+ ETPP+PGPRRYGN+ACR+WH K++  +P  L++++    PSE   VV EL
Sbjct: 58  VLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116

Query: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMRRLI 188
           +YYL NSFGS+TRLD+GTGHELSF+ATVAALDMLG      G  V  +F++YY+++ RLI
Sbjct: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHRLI 174

Query: 189 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFY 248
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW      A ++P ++ D  LV +Y  TN +
Sbjct: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLA-MEPNDLSDPVLVEQYSRTNIF 233

Query: 249 CQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFG 308
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293

Query: 309 TGFFPWVNIQNGTDLPVFE-----EKEEESIEQANAGSPGREQTSTRF 351
           TGF+PWV+ +NG  LP +E     ++  +   QA A   G     +RF
Sbjct: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRF 341

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 219/324 (67%), Gaps = 8/324 (2%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P      + +  V     
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFVC---- 65

Query: 73  VLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYY 131
           +L++L  L+DETPP  G  RR+G+LACR+WH ++   L   L+ +LP        EL+YY
Sbjct: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125

Query: 132 LGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMR--GADVFLLFNKYYTIMRRLIL 189
           LG++FGS  RLDYGTGHEL+F+A V ALDMLG++   +  G D+  ++ +YY ++ RLIL
Sbjct: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185

Query: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFYC 249
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP +ILD   V  Y +TN YC
Sbjct: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244

Query: 250 QGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGT 309
             I F+  VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304

Query: 310 GFFPWVNIQNGTDLPVFEEKEEES 333
           GFFPWV++ +G  LP +E   E S
Sbjct: 305 GFFPWVDMAHGMSLPNYEAPSETS 328

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  351 bits (900), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/396 (46%), Positives = 248/396 (62%), Gaps = 23/396 (5%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  ++          +    A
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG------DTSGGISA 69

Query: 66  MVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVV 125
            V  ++ +LD+L  L+DETPPL GPRRYGNLACR+WH K+D  LP    ++         
Sbjct: 70  SVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMR 185
            E +YYL NSFGS  RLDYGTGHELSF+A VAALDM+     +   ++  L+++YY ++R
Sbjct: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189

Query: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSL-VREYKD 244
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPR++L   +  R+   
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247

Query: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307

Query: 305 FWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTST--RFPTST--SMP-- 358
           FWFGT FFPW ++++GT LPV+E+  +   E  ++G+P    T+T     TST  S+P  
Sbjct: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASVPSR 367

Query: 359 -PPGVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393
            P   PP+G  +N  + H   SH       RDRLRR
Sbjct: 368 RPAMGPPAGRQVNKFIQHTTASH-------RDRLRR 396

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  349 bits (896), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/357 (48%), Positives = 229/357 (64%), Gaps = 22/357 (6%)

Query: 7   DWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAM 66
           D+ +A FS P KRIFD+Q TLDFQ+S+A+ RI+YHL KY TL      PD   T      
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD---TIKESFF 60

Query: 67  VNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVP 126
            N ++ +L +L+ LIDETPP     RYGNL+ R+W  K   +L  WL E+LP +Y+  + 
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120

Query: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMRR 186
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LDML +   ++G  +   FN YY ++++
Sbjct: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179

Query: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTN 246
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P++I +  L+ +   +N
Sbjct: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237

Query: 247 FYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 306
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297

Query: 307 FGTGFFPWVNIQNGTDLPVF---EEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360
           FGT FFPW +  N   LP++   E  ++     AN               +T MPPP
Sbjct: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNA-------------TTKMPPP 341

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  168 bits (425), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 169/303 (55%), Gaps = 23/303 (7%)

Query: 67  VNGLMGVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +  L  +LD++  L+D+ P +   +  R+G +  R+++ +L+E+    ++    +   E 
Sbjct: 52  IASLSSLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+F+  +  L   G+F   + A   V ++F KY  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLN 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ LV  +
Sbjct: 172 IMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LVPHKHLKPMSIHNEELVELF 228

Query: 243 KDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
           KD   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY+ EVL K P+
Sbjct: 229 KDKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPI 287

Query: 302 VQHFWFG------TGFFPWVN--IQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPT 353
           +QHF+F        G  P  +  I NGTD      +++E +++ +  S   +    + P+
Sbjct: 288 MQHFYFSEFLKCPEGISPARSNHIHNGTD------EDDECLQEGHTHSTWGDCCGIKLPS 341

Query: 354 STS 356
           + +
Sbjct: 342 AIA 344

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  163 bits (413), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 158/303 (52%), Gaps = 24/303 (7%)

Query: 67  VNGLMGVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           V  +M +L K+  ++ + P +      R+G +  R+++  L  +    L+E  PS     
Sbjct: 52  VESMMKLLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
           + +L  Y+  S+G+  R+DYG+GHEL+FM  +  L    +F   R A   V  +F +Y  
Sbjct: 112 IEQLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           +MR L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  L+  +
Sbjct: 172 LMRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LSTHKHLKPSSIHNDDLIEMF 228

Query: 243 KDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
            D   Y   I FIN VK       HSP+L DI+  V +WSKV +G+ KMY  EV+KK P+
Sbjct: 229 ADKYLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPI 287

Query: 302 VQHFWFGTGFF--------PWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPT 353
           +QHF+F   F         P  +I +G +       E+E + + +A S   +    + P+
Sbjct: 288 MQHFYFNDMFLICPENVSPPREHIHDGGE-------EDECLAEGHAHSTYGDCCGIKVPS 340

Query: 354 STS 356
           + +
Sbjct: 341 AIA 343

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  163 bits (412), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 141/247 (57%), Gaps = 11/247 (4%)

Query: 67  VNGLMGVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +N L  +L  +  +ID+ P L      R+G    R ++ +++E   + + E  PS  HE 
Sbjct: 52  INTLEQILVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAAL---DMLGMFPHMRGADVFLLFNKYY 181
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   D+L +    R   V ++F KY 
Sbjct: 112 LEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNM-VLIIFIKYL 170

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ LV  
Sbjct: 171 DIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LATHKHLKPLSIHNEELVEM 227

Query: 242 YKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           +     Y   I FIN VK       HSP+L DI+  V RWSKV +G++KMY+ EVL K P
Sbjct: 228 FAKKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLP 286

Query: 301 VVQHFWF 307
           ++QHF+F
Sbjct: 287 IMQHFYF 293

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  160 bits (405), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 136/248 (54%), Gaps = 8/248 (3%)

Query: 65  AMVNGLMGVLDKLAHLIDETPPL-PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHE 123
           A V+  + +LD +  ++DE P L     R+G    R ++  +       L +   +    
Sbjct: 52  AEVSSTLALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTN 111

Query: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYY 181
            + +L  Y   S+G+  R+DYG+GHEL+F+  +  L    +F   R +   V L+F KY 
Sbjct: 112 QIEQLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYL 171

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            IMRRL   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V  
Sbjct: 172 KIMRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSNHKHLKPKSIHNDEIVDM 228

Query: 242 YKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           +KD   Y   I FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P
Sbjct: 229 FKDKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLP 287

Query: 301 VVQHFWFG 308
           V+QHF+F 
Sbjct: 288 VMQHFYFS 295

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 140/247 (56%), Gaps = 9/247 (3%)

Query: 67  VNGLMGVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +   MG+L  + ++ID+ P +   +  R+G +  R+++ +L  +    +    PS   + 
Sbjct: 52  IESFMGLLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   +     V  +F +Y  
Sbjct: 112 LDQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLR 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ LV  +
Sbjct: 172 VMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPLSIHNEELVEMF 228

Query: 243 KDTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
           +D   Y   + FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P+
Sbjct: 229 QDKYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPI 287

Query: 302 VQHFWFG 308
           +QHF+FG
Sbjct: 288 MQHFYFG 294

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  159 bits (401), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 67  VNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           V   + VL ++  LI   P +      R+G +  R+++  + E+    L    P+   E 
Sbjct: 52  VQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   R A   V +LF +Y  
Sbjct: 112 IEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I ++ LV  +
Sbjct: 172 IMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LAPHKHLKPKSIHNEELVEMF 228

Query: 243 KDTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
            D   Y   I FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P+
Sbjct: 229 ADKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPI 287

Query: 302 VQHFWF 307
           +QHF+F
Sbjct: 288 MQHFYF 293

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 139/244 (56%), Gaps = 9/244 (3%)

Query: 71  MGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVPEL 128
           M +L K+  LID+ P +      R+G +  R+++  L     + +    PS   + V EL
Sbjct: 56  MQLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEEL 115

Query: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMR-GADVFL-LFNKYYTIMRR 186
             YL  S+G+  R+DYG+GHEL+F+  +  L +  +F   R  AD+ L +F +Y  IMR 
Sbjct: 116 AVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRI 175

Query: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTN 246
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I ++ +V  + D  
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQ---LATHPHLRPKSIHNEEVVEMFMDKY 232

Query: 247 FYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHF 305
            Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++QHF
Sbjct: 233 IYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHF 291

Query: 306 WFGT 309
           +FG 
Sbjct: 292 YFGN 295

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  157 bits (398), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/253 (35%), Positives = 141/253 (55%), Gaps = 9/253 (3%)

Query: 65  AMVNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYH 122
           + +  L  +LD +A ++D+ P +   G  R+G +  R+++ ++ E   + +  +      
Sbjct: 50  SQIENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTD 109

Query: 123 EVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFL-LFNKYY 181
           E V EL  Y   S+G   R+DYG+GHEL+F+  +  L    +       ++ L +F KY 
Sbjct: 110 EQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYL 169

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V  
Sbjct: 170 DVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPKSIHNPEIVEV 226

Query: 242 YKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           ++    Y + + FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P
Sbjct: 227 FEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLP 285

Query: 301 VVQHFWFGTGFFP 313
           ++QHF+F T F P
Sbjct: 286 IMQHFFFST-FLP 297

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  155 bits (393), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 151/270 (55%), Gaps = 18/270 (6%)

Query: 67  VNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           ++ +M +L  +  +I + P +      R+G +  R+++ ++ +   ++L+   PS   E 
Sbjct: 52  ISRMMNLLSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLL--FNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L +   L+P  I +  LV  +
Sbjct: 172 IMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTSHKHLKPISIHNNELVEMF 228

Query: 243 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
            +   Y   I+FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 ANRYLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 302 VQHFWFGTGFFPW--------VNIQNGTDL 323
           +QHF+F + F P          +I +GTD+
Sbjct: 288 MQHFYF-SDFLPCPEGVSPPRGHIHDGTDV 316

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  155 bits (391), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 140/258 (54%), Gaps = 14/258 (5%)

Query: 61  ASSIAMVNGLMGVLDKLA--HLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLP 118
             SI  V  L+  +D+    H ++ T    GP R+G    R+ +  +  R    ++E   
Sbjct: 50  GGSIQSVEALIECVDQCIENHPVEST----GPSRFGKGEFRDLYDDISGRSSVLIKEKFG 105

Query: 119 SEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLL 176
           S   E V +L  Y   S+G  +R+DYG+GHEL+F+  +  L   G+F   +     V ++
Sbjct: 106 SLTDEQVAQLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIV 165

Query: 177 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDK 236
           F KY   MR +   Y LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ I + 
Sbjct: 166 FMKYLKTMRVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LSTHRHLKPKSIHNP 222

Query: 237 SLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEV 295
            +V  + +   Y   I+FIN VK       HSP+L DI+  V  W+KV +G++KMY  EV
Sbjct: 223 EVVEMFSEKYLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEV 281

Query: 296 LKKFPVVQHFWFGTGFFP 313
           L K P++QHF+F + F P
Sbjct: 282 LCKLPIMQHFYF-SEFLP 298

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  155 bits (391), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 146/268 (54%), Gaps = 12/268 (4%)

Query: 67  VNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +  L  +L+++  +    P L      R+G +  R++H ++  R    + ++ PS   E 
Sbjct: 60  IEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQ 119

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFP-HMRGADVFLLFNKYYTI 183
             EL  YLGN++G   R+DYG+GHEL+F+  +  L   G+   H     V  +F KY  +
Sbjct: 120 AQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDV 179

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243
           MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V  ++
Sbjct: 180 MRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHNPEVVELFE 236

Query: 244 DTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVV 302
           +   Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++
Sbjct: 237 NRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIM 295

Query: 303 QHFWFGTGFFPWVNIQNGTDLPVFEEKE 330
           QHF+F + F P   + +G   P   E+E
Sbjct: 296 QHFFF-SRFLP---VPDGVSPPRTSEEE 319

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  154 bits (389), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 136/251 (54%), Gaps = 13/251 (5%)

Query: 65  AMVNGLMGVLDKLAHLIDETPPLPG---PRRYGNLACREWHHKLDERLPQWLQEMLPSEY 121
           A V  LMG+L ++  +I+  P         R+G +  R+++ +L       +    P   
Sbjct: 53  ASVEALMGLLQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLT 112

Query: 122 HEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD----VFLLF 177
              V +LQ YL  S+G   R+DYG+GHEL+FM  +  L    +F  + G D    V   F
Sbjct: 113 QNQVRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFD-LGGTDRANLVLKPF 171

Query: 178 NKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKS 237
            +Y  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ 
Sbjct: 172 IEYLKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPLSIHNEE 228

Query: 238 LVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL 296
           +V  + D   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL
Sbjct: 229 VVELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVL 287

Query: 297 KKFPVVQHFWF 307
            K P++QHF+F
Sbjct: 288 SKLPIMQHFYF 298

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  153 bits (387), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 145/269 (53%), Gaps = 18/269 (6%)

Query: 67  VNGLMGVLDKLAHLIDETPPLPGP--RRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +N +M +L ++  +  + P +      R+G +  R+++ ++     + L+   PS   E 
Sbjct: 52  INSMMNLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   V  +F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  LV  +
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMF 228

Query: 243 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
                Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 AHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPI 287

Query: 302 VQHFWFGTGFFPWVN--------IQNGTD 322
           +QHF+F + F P  +        I +GTD
Sbjct: 288 MQHFYF-SEFLPCPDGVSPPRGHIHDGTD 315

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  151 bits (382), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 135/247 (54%), Gaps = 9/247 (3%)

Query: 67  VNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           ++ L  +LDK+  ++   P +      R+G +  R+++  L  R  + +  +        
Sbjct: 52  IDELCSLLDKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
           V EL  Y   S+G+ TR+DYG+GHEL+F+  +  L+    F   + A   V  +F KY  
Sbjct: 112 VDELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLD 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +K  V  +
Sbjct: 172 VMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHNKEFVEMF 228

Query: 243 KDTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
           +    Y   I FIN VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 EKRYLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPI 287

Query: 302 VQHFWFG 308
           +QHF+FG
Sbjct: 288 MQHFYFG 294

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 136/255 (53%), Gaps = 12/255 (4%)

Query: 60  TASSIAMVNGLMGVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLQEML 117
           T SSI     L   L+++A L ++ P        R+G +  R ++  L  +    +Q   
Sbjct: 48  TGSSIESCCQL---LEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAF 104

Query: 118 PSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF--PHMRGADVFL 175
            +       EL  Y   S+G  +R+DYG+GHEL+F+  +  L   G+F  P      V  
Sbjct: 105 DALDGTQCEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLK 164

Query: 176 LFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILD 235
           LF KY  +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +
Sbjct: 165 LFIKYLGVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHN 221

Query: 236 KSLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
             +V  +     Y   I+FIN+VK       HSP+L DI+  V  W+KV +G++KMY  E
Sbjct: 222 SEVVEMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAE 280

Query: 295 VLKKFPVVQHFWFGT 309
           VL K P++QHF+FG+
Sbjct: 281 VLNKLPIMQHFFFGS 295

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/246 (36%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 67  VNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +  +M +L ++  +I + P +      R+G +  R+++ ++ +   + L+   P    E 
Sbjct: 52  IISMMNLLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLL--FNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQ 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  LV  +
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMF 228

Query: 243 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
                Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY VEVL K P+
Sbjct: 229 AHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPI 287

Query: 302 VQHFWF 307
           +QHF+F
Sbjct: 288 MQHFYF 293

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  149 bits (377), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 140/250 (56%), Gaps = 12/250 (4%)

Query: 67  VNGLMGVLDKLAHLID--ETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPS-EYHE 123
           V  +  +L K+  +I   E        R+G +  R+++  + E   + + ++    E  +
Sbjct: 51  VQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPD 110

Query: 124 V--VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNK 179
              + ++  Y  NS+G  +R+DYG+GHEL+F+  +  L    +F     +   V +LF K
Sbjct: 111 TGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIK 170

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLV 239
           Y  IMR L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V
Sbjct: 171 YLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHNPEVV 227

Query: 240 REYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298
             ++D   Y   I FIN+VK       HSP+L DI+  V RWSKV +G++KMY  EVL+K
Sbjct: 228 EMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQK 286

Query: 299 FPVVQHFWFG 308
            P++QHF+FG
Sbjct: 287 LPIMQHFYFG 296

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  149 bits (377), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 155/297 (52%), Gaps = 16/297 (5%)

Query: 67  VNGLMGVLDKLAHLIDETPPLPG----PRRYGNLACREWHHKLDERLPQWLQEMLPSEYH 122
           +N    +L  +  +I+  P          R+G +  + ++  +++   + ++        
Sbjct: 51  INNAFSLLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDP 110

Query: 123 EVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKY 180
             + EL  YL  S+G+  R+DYG+GHEL+F+  +  L    +F  +  +   V  +F +Y
Sbjct: 111 NQIQELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEY 170

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
             IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ +V 
Sbjct: 171 INIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSKHKHLKPISIHNEEMVE 227

Query: 241 EYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKF 299
            +KD   Y   I+FIN +K       HSP+L DI+  V +WSKV +G++KMYS EVL K 
Sbjct: 228 MFKDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKL 286

Query: 300 PVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTS 356
           P++QHF+F + F P      G  LP    K + +IE+ +  S   +    + P++ +
Sbjct: 287 PIMQHFYF-SDFLP---CPQGVSLPHIHGK-DGNIEETHVHSTWGDCCGIQIPSAIA 338

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  149 bits (376), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 140/252 (55%), Gaps = 10/252 (3%)

Query: 67  VNGLMGVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +  ++ +L ++  +I++ P +      R+G +  R+++ ++ +   + L+        E 
Sbjct: 52  ITRMLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLL--FNKYYT 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLD 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  LV  +
Sbjct: 172 IMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNSELVEMF 228

Query: 243 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
            D   Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 SDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 302 VQHFWFGTGFFP 313
           +QHF+F + F P
Sbjct: 288 MQHFYF-SEFLP 298

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  144 bits (364), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 127/248 (51%), Gaps = 16/248 (6%)

Query: 74  LDKLAHLIDETPPLPGPR---------RYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124
           +DK   L+DE   +             R+G +  R ++  L  +    + +       + 
Sbjct: 52  IDKCCSLLDEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGAD--VFLLFNKYYT 182
             EL  Y   S+G   R+DYG+GHEL+F+  +  L   G+F   R     V  +F  Y  
Sbjct: 112 AEELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLE 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           +MR L  TY LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ I +  LV  +
Sbjct: 172 LMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LAPHKHLKPKSIHNNELVDMF 228

Query: 243 KDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
                Y   I+FIN VK       HSP+L DI+     WSKV +G++KMY  EVL K P+
Sbjct: 229 ASRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPI 287

Query: 302 VQHFWFGT 309
           +QHF FG+
Sbjct: 288 MQHFLFGS 295

>TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.228
           YER053C
          Length = 304

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 49/127 (38%), Gaps = 28/127 (22%)

Query: 177 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDK 236
           F K +T      + Y+L+ AG +G +    HF+                       +L  
Sbjct: 67  FGKVFTGFGATAIGYSLQGAGKYGGYEFFKHFY--------------------SNNVLSP 106

Query: 237 SLVREYKDTNFYCQG---INFINEVKMGPFEEHSPILYDIAVTVPRW-SKVCKGLLKMYS 292
            L   Y  T  Y        FI ++ + PFE    I      TVP + + V +GL K+YS
Sbjct: 107 ELASRY-TTGVYLAASATAEFIADIMLCPFEA---IKVRQQTTVPPFCNNVFQGLSKVYS 162

Query: 293 VEVLKKF 299
            E LK F
Sbjct: 163 TEGLKGF 169

>Suva_11.92 Chr11 complement(177904..179295) [1392 bp, 463 aa] {ON}
           YKL133C (REAL)
          Length = 463

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 33/82 (40%), Gaps = 2/82 (2%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65
           V WPH TF  PV +I       + +   A +R    LH Y   +  C   + H  +    
Sbjct: 71  VFWPHHTFPKPVAKILRKGLHAEIKKEGADYR--KSLHYYLEALEECKTENVHPLSDEYT 128

Query: 66  MVNGLMGVLDKLAHLIDETPPL 87
            +   +G + +   L+D+   L
Sbjct: 129 GIEIKIGEMYEKLDLLDDAVIL 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,697,901
Number of extensions: 2107903
Number of successful extensions: 6185
Number of sequences better than 10.0: 52
Number of HSP's gapped: 6238
Number of HSP's successfully gapped: 52
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)