Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL152W5.707ON23523510671e-149
Smik_9.175.707ON2512357961e-107
Skud_9.165.707ON2262357521e-101
Suva_9.365.707ON2242357065e-94
TPHA0E001805.707ON1651021168e-07
ZYRO0B16434g5.707ON2371181072e-05
TBLA0I016905.707ON3201001074e-05
NDAI0F002705.707ON2981131002e-04
NCAS0G002105.707ON288135950.001
TDEL0B021305.707ON208102900.003
Kpol_1043.745.707ON17724760.19
KAFR0D022005.707ON182107691.7
SAKL0E15026g5.707ON290104647.3
YNR060W (FRE4)na 1ON719103658.8
Skud_11.1292.483ON3811436410.0
NOTE: 5 genes in the same pillar as YIL152W were not hit in these BLAST results
LIST: KLTH0E00946g Kwal_55.19675 KLLA0A00506g KNAG0L02160 Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL152W
         (235 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...   415   e-149
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)    311   e-107
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)    294   e-101
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)    276   5e-94
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    49   8e-07
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    46   2e-05
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    46   4e-05
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    43   2e-04
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    41   0.001
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    39   0.003
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    34   0.19 
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    31   1.7  
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    29   7.3  
YNR060W Chr14 (739951..742110) [2160 bp, 719 aa] {ON}  FRE4Ferri...    30   8.8  
Skud_11.129 Chr11 (242789..243934) [1146 bp, 381 aa] {ON} YKL098...    29   10.0 

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score =  415 bits (1067), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 211/235 (89%), Positives = 211/235 (89%)

Query: 1   MSHKRRGLVIYXXXXXXXXHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60
           MSHKRRGLVIY        HPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP
Sbjct: 1   MSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60

Query: 61  NVQHDGNHMPISLLVLKQEHHKXXXXXXXXXXXXXXXXTPPLRQLVQESQWTSSASNSSL 120
           NVQHDGNHMPISLLVLKQEHHK                TPPLRQLVQESQWTSSASNSSL
Sbjct: 61  NVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQLVQESQWTSSASNSSL 120

Query: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180
           KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK
Sbjct: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180

Query: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
           LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI
Sbjct: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score =  311 bits (796), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 183/235 (77%), Gaps = 2/235 (0%)

Query: 1   MSHKRRGLVIYXXXXXXXXHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60
           MSHKRRGLVIY         P GQS+SSISWSP +RPHHPLKQQSTN+F+ ILSKS+VQ 
Sbjct: 19  MSHKRRGLVIYQDQKQQQ-RPSGQSISSISWSPKQRPHHPLKQQSTNNFTAILSKSTVQQ 77

Query: 61  NVQHDGNHMPISLLVLKQEHHKXXXXXXXXXXXXXXXXTPPLRQLVQESQWTSSASNSSL 120
           +VQ D +H+PIS LVLKQE                    PPLR+LVQESQWTSS S+   
Sbjct: 78  DVQQDRSHLPISSLVLKQEQ-HQQNEEQRRRNMQQQNSGPPLRKLVQESQWTSSTSHCHS 136

Query: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180
           +KQEK PQ FY++DSKLVSQLHSSVKDLDAIIQTHKPKFDTII D S+ TILSSNELLIK
Sbjct: 137 RKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIK 196

Query: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
           LP ++TIILHSR P IN EWL NKV++P ASLVIDSRSFL LCNNIKWYLHWKFI
Sbjct: 197 LPMEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 181/235 (77%), Gaps = 9/235 (3%)

Query: 1   MSHKRRGLVIYXXXXXXXXHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60
           MSHKRRGLVIY         P GQSLSSISWSPTRR HHPLKQQS+NSF+EILSKSSVQ 
Sbjct: 1   MSHKRRGLVIYQDQKQQQQ-PSGQSLSSISWSPTRRHHHPLKQQSSNSFTEILSKSSVQQ 59

Query: 61  NVQHDGNHMPISLLVLKQEHHKXXXXXXXXXXXXXXXXTPPLRQLVQESQWTSSASNSSL 120
           +V+ D +H+PIS LVLKQ+  +                 PPLR++VQ+SQWTSS  +   
Sbjct: 60  DVRQDSSHLPISSLVLKQQQQRRNMPSQNS--------GPPLRKVVQDSQWTSSTIHCPS 111

Query: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180
           +KQEKQ  TFY TDSKLVSQLH+SVKDLD I+QTHKP+FDTII D S   ILSSNELLIK
Sbjct: 112 RKQEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIK 171

Query: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
           LP + TIILHSR PKINAEWL NK +DPSASLVIDSRSFL LCNNIKWYLHWKFI
Sbjct: 172 LPMNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score =  276 bits (706), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 175/235 (74%), Gaps = 11/235 (4%)

Query: 1   MSHKRRGLVIYXXXXXXXXHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60
           M HKRRGLVIY        H PG+S+SS++WS  ++  HPLKQQSTNSF+ ILSKS ++ 
Sbjct: 1   MGHKRRGLVIYQDQKQQQ-HSPGKSISSLAWSAAQQ--HPLKQQSTNSFTAILSKSCLRQ 57

Query: 61  NVQHDGNHMPISLLVLKQEHHKXXXXXXXXXXXXXXXXTPPLRQLVQESQWTSSASNSSL 120
           +VQ D +H+PIS LVLKQ+                    PPLR+LVQ SQWTSSA++   
Sbjct: 58  DVQQDSSHLPISSLVLKQQ--------QQQQQHPSQSSGPPLRKLVQNSQWTSSATHRPS 109

Query: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180
            KQEKQP+ FY+TDS+LVSQLHSSVKDLD I+QTHKP+FDTII D S  TILS NELLIK
Sbjct: 110 WKQEKQPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIK 169

Query: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
           L  + TIILHSR P INAEWL+NKV++  ASLVIDSRSFL LC+NIKWYLHWKFI
Sbjct: 170 LHTEDTIILHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 14/102 (13%)

Query: 138 VSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIKLPKDQTIILHSRAPKIN 197
           VS L  S+   + +++    K+D I  D +    LS NE ++     +T+ILHS      
Sbjct: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNE---- 113

Query: 198 AEWLQNKVNDPSASL-----VIDSRSFLTLCNNIKWYLHWKF 234
               +N VN  + +L      I+S+ +L+L N++ WYL WKF
Sbjct: 114 ----KNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 16/118 (13%)

Query: 124 EKQPQTFYNTDSKLVSQLHSSVKDLDAIIQT--HKPKFDTIIRDFSQATILSSNELLI-- 179
           EK   +     + LV+QL  ++ D + +++T      +D ++ D   A  LS  E+++  
Sbjct: 130 EKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLSPFEIMVIS 188

Query: 180 KLPKDQTIILHS--RAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
             P+ +  ILHS    PK         VN PS  L I S+  LTL N++ WYL WKF+
Sbjct: 189 DDPRVKRAILHSHKAIPKF--------VNSPS-RLAICSKCCLTLYNDMNWYLKWKFL 237

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 56/100 (56%), Gaps = 5/100 (5%)

Query: 137 LVSQLHSSVKDLDAIIQTHKP-KFDTIIRDFSQATILSSNELLIKLPKDQTIILHSRAPK 195
           LV+ LH+ + +L+  I + +  KFD I +  S+ T LS  ELL+    + +++LHS +  
Sbjct: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDSTI 283

Query: 196 INAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
             +E+    + +  A+   +S S L +  ++ WYL WKFI
Sbjct: 284 GQSEFNNYTLKEKVAT---NSISILKITEDLNWYLKWKFI 320

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 13/113 (11%)

Query: 132 NTDSKLVSQLHSSVKDLDAIIQTHKP-KFDTIIRDFSQATILSSNELLIKLPK------- 183
           N  S L+  L  S+ DLD  ++T     +DT++   +   +LS +E+ I   K       
Sbjct: 190 NKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLT-VTSFEMLSDHEIKINSVKNYTAGFT 248

Query: 184 -DQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
            D T++LHS+   +N     N   D    L +DS+ +L L  N+KWYL WKFI
Sbjct: 249 TDVTMLLHSKIS-LNVPLPNNLHKD--YKLALDSKVYLELAPNVKWYLVWKFI 298

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 112 TSSASNSSLKKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATI 171
           TS++  SS      +P+ F       V+ L   + DLD +++T K      +   +  T 
Sbjct: 159 TSTSDVSSRDNSNNEPKIF-------VTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITK 211

Query: 172 LSSNELLIKLPKD-QTIILHSRAPKINAEWLQNKVNDPSAS----------LVIDSRSFL 220
           LS  EL +      Q IILH++   IN   +   ++D S +          L I+S+SF+
Sbjct: 212 LSDFELQVTTQMSPQLIILHNKT-SINNIPILKFIHDVSINTKIQVTESLKLAINSKSFI 270

Query: 221 TLCNNIKWYLHWKFI 235
            + ++I WY+ WKFI
Sbjct: 271 KVSDDINWYIDWKFI 285

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 52/102 (50%), Gaps = 6/102 (5%)

Query: 134 DSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIKLPKDQTIILHSRA 193
           D  L + +  ++  L+  IQ    + D ++  F +  +LS +ELL+ + + +  +LHS  
Sbjct: 113 DKSLSTAVSVALSHLNTRIQVLSGELDQLM-AFERLVLLSQHELLV-VTQRKIFVLHSVI 170

Query: 194 PKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
           P +  E +       +  L ++S+ +  L N++ W++ WKF 
Sbjct: 171 P-LTREGVSR---FGALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 210 ASLVIDSRSFLTLCNNIKWYLHWK 233
           A + I+S SF+ L  N+ WYLHW+
Sbjct: 152 AKIAINSNSFVHLYGNVNWYLHWR 175

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 17/107 (15%)

Query: 137 LVSQLHSSVKDLDAIIQTHK--PKFDTIIRDFSQATILSSNELLIKLPKDQTI--ILHS- 191
           L   L  S+ DL+A++   K   K+D +I+  + A  LSS E+LI    D+ +  ILH  
Sbjct: 84  LAISLQKSLWDLNALVTVSKNNKKYDLLIK-VASARRLSSTEMLIIPSTDEAMRYILHKP 142

Query: 192 ---RAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235
              R   ++        N   A L ++S+    L + + W L+WK +
Sbjct: 143 LTFRTNSVD--------NFTGAHLALNSKISFRLDDTLIWCLNWKLL 181

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 137 LVSQLHSSVKDLDAIIQ----THKPKFDTIIR-DFSQATILSSNELL-IKLPKDQTIILH 190
           ++ +L  S+ D + + +      KP +D ++  D +Q   LS +ELL I       I+LH
Sbjct: 188 MLFRLQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQ--LSPDELLVISSECAHAIVLH 245

Query: 191 SRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKF 234
               K      +++V      L +DSRS + L   + WY +W F
Sbjct: 246 RFKNKAFPRTEKHRV----LKLHLDSRSEIELYPGLYWYSNWYF 285

>YNR060W Chr14 (739951..742110) [2160 bp, 719 aa] {ON}  FRE4Ferric
           reductase, reduces a specific subset of
           siderophore-bound iron prior to uptake by transporters;
           expression induced by low iron levels
          Length = 719

 Score = 29.6 bits (65), Expect = 8.8,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 45/103 (43%), Gaps = 7/103 (6%)

Query: 106 VQESQWTSSASNSSLKKQEKQPQTFYNTDSKLVSQLHSSVKDLD-AIIQTHKPKFDTIIR 164
           V+  + T+  + SSL   EK P    NT+  L S   +S+ DL+ A     +P  + I+ 
Sbjct: 613 VKNGETTAEKAPSSLSNSEKAPSESENTELPL-SLNDTSISDLEFATFHVGRPNVEEILN 671

Query: 165 DF-----SQATILSSNELLIKLPKDQTIILHSRAPKINAEWLQ 202
           +      S A +     + +   ++QT     R P    E+L+
Sbjct: 672 ESVNHSGSLAVVCCGPPIFVDTARNQTAKAVIRNPSRMIEYLE 714

>Skud_11.129 Chr11 (242789..243934) [1146 bp, 381 aa] {ON} YKL098W
           (REAL)
          Length = 381

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 60/143 (41%), Gaps = 11/143 (7%)

Query: 103 RQLVQESQWTSSASNSSLKKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTI 162
           R+ V E    SS   +   + ++   + Y      V+ ++S+   LD++  TH   F+ +
Sbjct: 51  RESVAEGTLASSIPTACDMQLKRAIDSIYPDGGIKVTVMNSTTASLDSLATTHVQDFEIV 110

Query: 163 IRDFSQATILSSNELLIKLPKDQTIILH-SRAPKINAEWLQNKVNDPSASLVID------ 215
           I     + +      L+K+ +D  + L  +++ +I    L      PS+S   D      
Sbjct: 111 IIPDINSLLQPDQAKLVKVMRDSEMALQKAQSGRIFIGVLHWNNATPSSSAAKDGDNASK 170

Query: 216 ----SRSFLTLCNNIKWYLHWKF 234
               +R FL  C +I  +L  KF
Sbjct: 171 SAPKTRIFLPACIHIGAWLKHKF 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.127    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,878,575
Number of extensions: 850608
Number of successful extensions: 3906
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4020
Number of HSP's successfully gapped: 35
Length of query: 235
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 129
Effective length of database: 41,326,803
Effective search space: 5331157587
Effective search space used: 5331157587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)