Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL151C5.706ON1118111857380.0
Smik_9.185.706ON1118111851930.0
Skud_9.175.706ON1118111850790.0
Suva_9.375.706ON1117111850430.0
ZYRO0B16412g5.706ON137297626000.0
TDEL0B021405.706ON1147118525890.0
KAFR0H001805.706ON124198225170.0
Smik_11.3605.706ON118094424450.0
Skud_11.3365.706ON118895624390.0
CAGL0G02541g5.706ON129594824110.0
Suva_11.3335.706ON118794923930.0
NCAS0A031705.706ON1319103023870.0
SAKL0E15004g5.706ON119697923540.0
Kpol_1043.735.706ON126096123510.0
YKR096W5.706ON119594623390.0
TPHA0E001905.706ON136198522770.0
Kwal_55.196785.706ON117897022570.0
KLTH0E00968g5.706ON114896722420.0
AFR290W5.706ON121797622480.0
Ecym_40155.706ON125797122100.0
KLLA0A00528g5.706ON122996421280.0
KNAG0C066305.706ON128172419750.0
CAGL0H06611g5.706ON128296517910.0
NDAI0E050705.706ON155637811621e-136
TBLA0E017105.706ON152640710411e-120
TPHA0D046405.706ON9629383946e-38
YML075C (HMG1)4.343ON1054117772.4
Suva_13.774.343ON1055110772.6
ADL298C3.321ON1476118737.6
TDEL0F047108.347ON497166719.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL151C
         (1118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...  2214   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...  2004   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...  1961   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...  1947   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1006   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1001   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   974   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   946   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   944   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   933   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   926   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   924   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   911   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   910   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   905   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   881   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   874   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   868   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   870   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   855   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   824   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   765   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   694   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   452   e-136
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   405   e-120
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   156   6e-38
YML075C Chr13 complement(115734..118898) [3165 bp, 1054 aa] {ON}...    34   2.4  
Suva_13.77 Chr13 complement(117204..120371) [3168 bp, 1055 aa] {...    34   2.6  
ADL298C Chr4 complement(174374..178804) [4431 bp, 1476 aa] {ON} ...    33   7.6  
TDEL0F04710 Chr6 (885854..887347) [1494 bp, 497 aa] {ON} Anc_8.3...    32   9.1  

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score = 2214 bits (5738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1073/1118 (95%), Positives = 1073/1118 (95%)

Query: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60
            MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120
            RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM
Sbjct: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120

Query: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180
            DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD
Sbjct: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180

Query: 181  IRRXXXXXXXXXXMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
            IRR          MIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 181  IRRAPVVAASPPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 
Sbjct: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  XXXXXXXXXXXXXXRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600
                          RSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD
Sbjct: 541  PKYLKLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660

Query: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720
            FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK
Sbjct: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720

Query: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780
            CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI
Sbjct: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780

Query: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFK                    TIEI
Sbjct: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEI 840

Query: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960
            NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF
Sbjct: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960

Query: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020
            AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF
Sbjct: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080
            TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080

Query: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
            DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 2004 bits (5193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 956/1118 (85%), Positives = 1016/1118 (90%)

Query: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60
            MVDLMVP NDDPSNETDY RSNNN++  V+DMRPT+ AFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120
            RRVPG+V+PVGKGFIDG+TN QISAQNTPSK DD SRRPSISRKVMESTPQ KT+SI TM
Sbjct: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120

Query: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180
            DVPKSPYYVNRT +ARNM+VVS+++Y++NANPQMR DE LVASNGIY+NSQPQSQVTL D
Sbjct: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180

Query: 181  IRRXXXXXXXXXXMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
            IR+          ++RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 181  IRKAPVVASSPPPVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIY +EKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDR S   NNNE AH+NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            +KFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 
Sbjct: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  XXXXXXXXXXXXXXRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600
                          RS ATET  Y DPF  + S ESYFQNIDAL+S+F+DIPTNLNIWL+
Sbjct: 541  PKYLKLKKDKREKKRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAP V+ALPHFLTWL+F+VAILK+LE +NSKQV+AFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660

Query: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720
            FLRRTMPWNS+V+L NVLVCYMLDNLHPFLKKELE FYS ELDDLIE++NENENLPEIWK
Sbjct: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720

Query: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780
            CWG+LWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDE+GE+FW+RSVRA+ LLKGI
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780

Query: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKV+FQA VFCRRNDIP DYFL+  TFK                    TIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE+I+ VN+D +ATPNLSVV GESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960
            NGV +DVS E IYDV +N+LSLHWEKIFFD+IAAA K  DEN NCT+YFV+DATSWLRHF
Sbjct: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960

Query: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020
            AHIFKLAKN+ L FAICLTTFQELRYLRGSKDD VVEAATRSVITIRQLYDE+KIIPMRF
Sbjct: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080
            TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQ FQ ER+  ENKNK K+FAVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080

Query: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
            DDDNMN+KAKD+MIKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 1961 bits (5079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/1118 (83%), Positives = 995/1118 (88%)

Query: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60
            MVD M P NDDPSN+TDY R N+++  +V+DMRPT+ A LHQKRHSSSSHNDTPESSF K
Sbjct: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60

Query: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120
            RRVPG+V+PVGKGFIDGI + Q+S QNTPSKTDD SRRPSISRK ME+TP+V T+SI T+
Sbjct: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120

Query: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180
            DVPKSPYY+N++ + RNM+VVSR  Y +N   QMR DE +  SNGIYSNSQPQSQVTLSD
Sbjct: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180

Query: 181  IRRXXXXXXXXXXMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
             R           + RQLPSAQPNQTFIKKLQEIY+IIVVQETELQQRCL+LTTSQTTEL
Sbjct: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVS+MLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQD FTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRSS   NNNE AHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            DKFGKDFNGND+FDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 
Sbjct: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  XXXXXXXXXXXXXXRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600
                          +S ATE   Y DPFD QISSESYFQNID+L S+F+DIPTNLNIWLD
Sbjct: 541  PKYLKLKRHKREKKKSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLE VNSK V  FWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660

Query: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720
            FLRRTMPWNS+V L NVLVCYMLDN+HPFL++ELE+FYSLELDDLIEY+NENENLPEIWK
Sbjct: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720

Query: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780
            CWG+LWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDE+GE+FW+RS+R +L+LKG+
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780

Query: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKV+FQA VFCRRNDI PDYFLKN TFK                    TIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEI 840

Query: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE+IE VN D +ATPNLSVVSGE+IFEYTGYTRL PDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960
            NG+ LDVS ES+YD ANNNLS HWEKIFFD+I  A    D+N NC++YFVIDATSWLRHF
Sbjct: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960

Query: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020
            AHIFKLAKNN LKFAICLTTFQELRYLRGSKDD VVEAATRSVITIRQLYDEKKIIP+RF
Sbjct: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080
            TGNIAT+VEENLEFEEQITW+THVDEFVIDAIAKLNQ FQ ERL D+NKNK   +AVLVT
Sbjct: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080

Query: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
            DDDNM+ KAKD+MIKTCNTKYLFSLGSK+GINSGLCTN
Sbjct: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score = 1947 bits (5043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1118 (82%), Positives = 992/1118 (88%), Gaps = 1/1118 (0%)

Query: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60
            MVD+M   NDDPSNETDYSRS+NN T +V+DMRPT+AAFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120
            RRVPG+V+PVGKGFIDGIT SQIS QN P K +D SRRPSISRK ME+TPQ+ TSS   M
Sbjct: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120

Query: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180
            D+PKSPYYVNRT + RNM+VVS++++++N  PQ RAD+ L  S GIY+NSQPQSQ+TLSD
Sbjct: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENG-PQTRADDSLTTSTGIYANSQPQSQITLSD 179

Query: 181  IRRXXXXXXXXXXMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
             R           + RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 180  TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 239

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIY+LNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 240  KSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 299

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLK+FSNFMDPEVCCQFI YAFI +SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 300  VLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 359

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIAT+QQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 360  DWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 419

Query: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRSSG+ NNNE AHRNSQLIDYLKHTEVMLLPSFLEN+DLQHVVL+YFK
Sbjct: 420  LIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFK 479

Query: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            DKFGKDFNGNDVF TKDMFCQNPESLRYYFRHAPAFAESQ+LQLIGFGNPKNPFALLFQ 
Sbjct: 480  DKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQL 539

Query: 541  XXXXXXXXXXXXXXRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600
                          +S A E   Y DPFD Q SSESYFQNID LNS FND PTN+ IWLD
Sbjct: 540  PKHLKFKKDKREKKKSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLD 599

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660
            SLN+INMTSIQCSI VLTKFLHAPL VALPHFL WLHFI+A+LKKLE +NS+QV AFWIH
Sbjct: 600  SLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIH 659

Query: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720
            FLRRTMPWNS+VT  NVLVCYMLDNLHPFL+K+LEKFYSLELDDLIEY+NENENLPE+WK
Sbjct: 660  FLRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWK 719

Query: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780
            CWG+LWFDA+KKCDVMEIPGVQDHLFFDSPLDGIVFD+KDE+GEKFW+RSVR +L LKGI
Sbjct: 720  CWGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGI 779

Query: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKV+FQASVFCRRNDI PDYFLKNLTFK                    TIEI
Sbjct: 780  AKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEI 839

Query: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE IE VN+D QATP LSVVSGESIFEYTGYTRL  DYHCFDKNGGFNSAFIY+QWSNVG
Sbjct: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899

Query: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960
            NGVTLDVS ES+YD   N+LSLHW KI FDK+    K +D++ +C++YFVIDATSWLRHF
Sbjct: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHF 959

Query: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020
            AHIFKLAKNN LKFAICLTTFQELRYLRGSKDD VVEAATRSVITIRQLYDEKKIIPMRF
Sbjct: 960  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRF 1019

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080
            TGNIATH+EENLEFEEQITWKTHVDEFVIDAIAKLNQ FQ ER  D+NK + KEFAVLVT
Sbjct: 1020 TGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVT 1079

Query: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
            DDDNMNQKAKD+MIKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1080 DDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/976 (51%), Positives = 670/976 (68%), Gaps = 66/976 (6%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +PS + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++N++LI NY
Sbjct: 408  VPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNY 467

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + F+ TALL +Q   D+++G+EI++IYRIE+RLWVYG ITFLD+ KNFSNFMDPEVCCQF
Sbjct: 468  VTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQF 527

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+SNML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ 
Sbjct: 528  ITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFT 587

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437
            Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R++G+
Sbjct: 588  YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGN 647

Query: 438  ANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKD 497
                   HRN+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  ++FDT+ 
Sbjct: 648  -------HRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRK 700

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSE 557
            MFCQNP+ LRY+FRHAPAFAES +LQL+GFG+PKNPFALLF+               R++
Sbjct: 701  MFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTK 760

Query: 558  ATETSSYT----------DPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINM 607
            +T  +  +          +  D   + E +F NI+ L   ++ +P+NL IW +SLN+INM
Sbjct: 761  STTVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYS-VPSNLEIWNESLNYINM 819

Query: 608  TSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMP 667
            TS++CS+ VL KFL  PLVVALPHF+ W +FI+++  K++ +N +    FW+ F+ R  P
Sbjct: 820  TSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFP 879

Query: 668  WNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTL 725
            WN+IV+  NVL+ YMLDN      +     ++ S+ L+DL++Y+N NE LPE+WKCWGTL
Sbjct: 880  WNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTL 939

Query: 726  WFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780
            WFD I        + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R + L KG+
Sbjct: 940  WFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGL 999

Query: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXX---------XXXXXXX 831
            A+ FP +G+ +S  A V+CRRND+ P + LK+ +FK                        
Sbjct: 1000 AENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDL 1058

Query: 832  XXXXXTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAF 891
                 T+EI EE    N+     P LSV+ GESIF+Y GY RL PDY  +DKNG F SA 
Sbjct: 1059 DHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSAS 1118

Query: 892  IYSQW------SNVG----NGVTLDVSGESIYDVA-----NNNLSLHWEKIFFDKIAAAS 936
            +Y+ W      +N G    +G  +D   +++  V      N  +   +   F D +    
Sbjct: 1119 LYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRD 1178

Query: 937  KGSDENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVV 996
                  ++ T YFV+D T+WLRHF HI+KLA +  LKFAICLTTF ELR+LR  KD+ VV
Sbjct: 1179 ALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVV 1238

Query: 997  EAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLN 1056
            EAATR++IT+RQLY E K++P+RFTGN+ATH+EE+LEFEE+ITW++HVDEFVI+A+ K  
Sbjct: 1239 EAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQ 1298

Query: 1057 QRFQ--------------AERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYL 1102
             +FQ                R  D+    G +F VLVTDD NM +KA+D+ ++T +TK++
Sbjct: 1299 SKFQEMNQLQLEQEEQQHQLRAHDD--RSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFV 1356

Query: 1103 FSLGSKLGINSGLCTN 1118
            FSL + +G+ S +CTN
Sbjct: 1357 FSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1185 (46%), Positives = 730/1185 (61%), Gaps = 105/1185 (8%)

Query: 1    MVDLMVPANDDPSNETDY----SRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPES 56
            M++     +D  +  TDY     R      H+   +    A+   QKRHSS+ +N + ES
Sbjct: 1    MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYN-SAES 59

Query: 57   SFAKRRVP----GIVDPVGKGFIDGITNSQISAQNTPSKTD---------------DASR 97
            +  KRRV     GI   +  G I      +  +   PS T                DAS 
Sbjct: 60   TGVKRRVANHDDGITQFLDNGAIPNTPCKEPVSSRRPSATRRTVNRTPRSTTSYVADASA 119

Query: 98   RP------SISRKVMESTPQVKTSSIPTMDVPKSPYYVNRTM-----------LARNMKV 140
             P      + + ++   +  V +S +   +V + P ++++             ++ N   
Sbjct: 120  SPYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLSKEAHIVSDGQDTGTISINSGE 179

Query: 141  VSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSDIRRXXXXXXXXXXMIRQLPS 200
            V+  + +++AN + R D     ++ I + +         +  +              +PS
Sbjct: 180  VNDQSQDNSANDEGRDDNN--ENDSIRNKNSNNDNDNNRENNKDNNGNVPSVV----VPS 233

Query: 201  AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF 260
             + +Q  ++KLQ+IYK+IV QE ELQ+RC  LT SQTTELK LW IY++N++LI NY+ F
Sbjct: 234  KKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTF 293

Query: 261  IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY 320
            I TALL  Q   DL +GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVC QFI +
Sbjct: 294  ITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITH 353

Query: 321  AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC 380
             FIS+SNML DIP +Y+I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MKYIYG 
Sbjct: 354  VFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGH 413

Query: 381  GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN 440
            GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ AF++R++G+   
Sbjct: 414  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGN--- 470

Query: 441  NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC 500
                HRNSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF+DKFG D N N++FDT+ MF 
Sbjct: 471  ----HRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFD 526

Query: 501  QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSEA-- 558
            QNP+ L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+               ++++  
Sbjct: 527  QNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSV 586

Query: 559  -TETSS--------YTD-PFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMT 608
             TETSS        Y D  F +    + +F NID+L S +   P +L +W  SL ++N+T
Sbjct: 587  TTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYL-FPPSLEVWNCSLKYLNIT 645

Query: 609  SIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPW 668
            S+ CS+ VL KFL  P+VVALPH L W +FI+A++ K++ +       FW+  + R  PW
Sbjct: 646  SLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPW 705

Query: 669  NSIVTLGNVLVCYMLDNLHPFLKKE--LEKFYSLELDDLIEYYNENENLPEIWKCWGTLW 726
            N+IV   NVL+ Y LDN+HP L  +   E+  ++ LD L+E++N NE+LPE+WKCWG LW
Sbjct: 706  NTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLW 765

Query: 727  FDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIA 781
            FDAI      + D  E  G++DH+F D P+DGI FD  DE G KFW R+ R + L K IA
Sbjct: 766  FDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIA 825

Query: 782  KKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEIN 841
            + F    L VS QA V CRR D P ++ LK+  FK                    TIE+ 
Sbjct: 826  ENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFK------LRDTFYNSNSVLQNTIEVF 877

Query: 842  EEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGN 901
            EE    N D Q TP LSV+  ESIF Y GY RL  D  C+D+ G F S  +Y+ W N  +
Sbjct: 878  EEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETS 937

Query: 902  GVTLDVSGESIYDVANN--------NLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDA 953
               +  S  +    AN         N SL    I F +     K +        +FV+DA
Sbjct: 938  KNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDT--------FFVLDA 989

Query: 954  TSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEK 1013
            TSWLRHFAH++KLA N  L+FAICLTTFQELR+LR SKD+ VVEAATR+VIT+RQLY E 
Sbjct: 990  TSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTEN 1049

Query: 1014 KIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGK 1073
            +I+P+RFTGN+ATH+EE+LEFEEQITW++HVDEFV +AI K   R   E       N+  
Sbjct: 1050 RILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE-------NRDF 1102

Query: 1074 EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
               VLVTDD NM +KA+   I T +T+++F+  + +G    +CTN
Sbjct: 1103 HHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/982 (52%), Positives = 653/982 (66%), Gaps = 80/982 (8%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            + + ++  I+KLQ IYKIIV QE ELQQRC  LTTSQTTELK+LW+IY+LNT+LI NYI 
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL +Q + D+ +G+EI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439
             GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR+    N
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNK---N 513

Query: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499
             N    RNS LIDYLKH+EVMLLPSFLEN DLQ VVL YF D+FG D+N N++F+T+DMF
Sbjct: 514  GNV---RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ------------------XX 541
             Q P SLR+YFRHAPAFAES +LQL+GFGNPKNPFALLF                     
Sbjct: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSS 630

Query: 542  XXXXXXXXXXXXXRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDS 601
                         R     TS+Y +  ++      YF NID+L     D P N+ +WL S
Sbjct: 631  TEISTMSIDTNDSRGPILNTSAYVNEGNI---VTEYFDNIDSLRLPI-DHP-NILVWLKS 685

Query: 602  LNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHF 661
            L H+NMTS++CS+ VL KFL  PL++ALPH L W +FI+A   K +   +   V FW   
Sbjct: 686  LEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIV 745

Query: 662  LRRTMPWNSIVTLGNVLVCYMLDNLHPF--LKKELEKFYSLE-LDDLIEYYNENENLPEI 718
            +RR +PWN++ +  NVL+ Y+LDN +    + K  E + + E   +L++Y+N NENLPEI
Sbjct: 746  MRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEI 805

Query: 719  WKCWGTLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRA 773
            WKCWGTLWFD I        D     G++DH+F D PLDGI FDE DE GE FW R++R 
Sbjct: 806  WKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRI 865

Query: 774  VLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXX 833
            V L KGIA+     GL+VS  A V CRR+DI P++ LK+ +FK                 
Sbjct: 866  VFLFKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTI 924

Query: 834  XXXTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY 893
                + + E I+  N+D  A P LSVV GE+IFEY GY +L  + H FD+NG   S+ IY
Sbjct: 925  NKL-LPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIY 983

Query: 894  SQW---------SNVGNGVTLDV-----------------------SGESIYDVANNNLS 921
            + W         ++ GN  T ++                       S E   D  N  L 
Sbjct: 984  TAWVIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELY 1043

Query: 922  LHWEKI--FFDKIAAASKGSDE-NYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICL 978
            ++ EK+    D+ +  +  +DE N N T YFV DATSWLRHFAHI+KL+ NN L FA+CL
Sbjct: 1044 MNPEKLNKNMDQASIWTTANDEINRNIT-YFVFDATSWLRHFAHIYKLSTNNVLNFAVCL 1102

Query: 979  TTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQI 1038
            TTFQELR+LR SKD+ VV AA R++IT+RQLY E K++P+RFTGN+AT +EE+LEFEEQI
Sbjct: 1103 TTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQI 1162

Query: 1039 TWKTHVDEFVIDAIAKLNQRFQA--ERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKT 1096
            TW++HVDEFVI+A+ K   +F +  E +T     KG    VLVTDD NM +KA+++ IKT
Sbjct: 1163 TWRSHVDEFVIEAVVKAQNKFISANESVT---LRKGFNHVVLVTDDINMKRKAQEQGIKT 1219

Query: 1097 CNTKYLFSLGSKLGINSGLCTN 1118
              T ++FS+  KLGI   +CTN
Sbjct: 1220 FTTHFIFSVCRKLGIQDNVCTN 1241

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 19  SRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIVDPVGKGFIDGI 78
           ++ NNN+  I   + P++A  L QKRH S+S+    +   A+     +   +   +ID  
Sbjct: 25  TQDNNNNIDIFRPISPSAA--LRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH- 81

Query: 79  TNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYV 129
            NS ++   TP K+   SRRPS+S+K    TPQ    S    + PKSP+YV
Sbjct: 82  -NSIVNENATPVKSV-LSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYV 127

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/944 (51%), Positives = 642/944 (68%), Gaps = 51/944 (5%)

Query: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266
             I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL+ NY+ FI TALL
Sbjct: 256  LIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTALL 315

Query: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326
             +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS+S
Sbjct: 316  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 375

Query: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386
             M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYYH
Sbjct: 376  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYYH 435

Query: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAHR 446
            ++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        R
Sbjct: 436  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL-------R 488

Query: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPESL 506
            NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+  
Sbjct: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548

Query: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ-----XXXXXXXXXXXXXXXRSEATET 561
            +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+                     S  TE+
Sbjct: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTES 608

Query: 562  SS-----YTDPFDVQISSESYFQNIDALNSSFNDI--------PTNLN--IWLDSLNHIN 606
            S+       +  D  +SS +   + D L   FNDI        P+ L    WL++L  +N
Sbjct: 609  STGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFLN 668

Query: 607  MTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTM 666
            MTS++C + VL KFLH PL VALPH L W++FI++I  K   +N      FWI  ++R  
Sbjct: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728

Query: 667  PWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGT 724
            PW+++VT  NVL+ Y+LDN   +  +     ++  L L +L+  +NENE+LPEIW CWGT
Sbjct: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGT 788

Query: 725  LWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLL 776
            LWFDAI + +   I         G++D++  DSP DGI+FD+KDE GEKFW R+ R + L
Sbjct: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848

Query: 777  LKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXX 836
             + +++ FP LG+ V     V C  + +  +  L++L +K                    
Sbjct: 849  FREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYK-LEPLTNIRSSVPVLSTLES 904

Query: 837  TIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW 896
              +I+E    +N D  A P LSV++G++IF Y GY +L PDY CFDKNG F SA +Y+ W
Sbjct: 905  IFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964

Query: 897  --SNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDAT 954
               N  N +  ++S  +  +  N  L L   K    +IA            T YFV DAT
Sbjct: 965  YVPNCNNNLETNISYAN--ERENEALFLECMKSVHPEIAYPEIDFK-----TTYFVFDAT 1017

Query: 955  SWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKK 1014
            SWLRH A IFKLA+N  L+FAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E K
Sbjct: 1018 SWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDK 1077

Query: 1015 IIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKE 1074
            ++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++ +  +  + + ++   
Sbjct: 1078 VLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFN- 1136

Query: 1075 FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
            + VL++DDD M +KA+++ I+T +T+++FSL +KLG    LCT+
Sbjct: 1137 YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/956 (51%), Positives = 652/956 (68%), Gaps = 58/956 (6%)

Query: 196  RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIK 255
            R   S + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTELI 
Sbjct: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317

Query: 256  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCC 315
            NY+ FI TALL +QP++DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCC
Sbjct: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377

Query: 316  QFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 375
            QFI + F+S+S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437

Query: 376  YIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSS 435
            YIY  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++
Sbjct: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497

Query: 436  GSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDT 495
            G+        RNS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF +KFG D NG ++F+ 
Sbjct: 498  GNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550

Query: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ-----XXXXXXXXXXX 550
            +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+                
Sbjct: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKK 610

Query: 551  XXXXRSEATETSSYTDPFDVQ-----ISSESYFQNIDALNSSFNDI--------PTNLN- 596
                 S  TE+S+     D       +SS +   + D L   FNDI        P+ L  
Sbjct: 611  SSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670

Query: 597  -IWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVV 655
              WL++L  +NMTS++C + VL KFLH PL +ALPH L W++FI+A   K   ++     
Sbjct: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730

Query: 656  AFWIHFLRRTMPWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENE 713
             FW+  ++R  PW++IVT  NVL+ Y+LDN  L+P + +   K+ +L L  L+E +NE+E
Sbjct: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790

Query: 714  NLPEIWKCWGTLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEVGEK 765
             LPEIW CWGTLWFD I + +   I         G++D++  D+P DGI+FD+KDE GEK
Sbjct: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850

Query: 766  FWMRSVRAVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXX 825
            FW R+ R + L + +++ FP +G+ VS    + C  +       L+NL +K         
Sbjct: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYK-LEPLSNIR 906

Query: 826  XXXXXXXXXXXTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNG 885
                       +++I+E     N+D  A P LSV SG++IF YTGY +L PDY CFD+NG
Sbjct: 907  SNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNG 966

Query: 886  GFNSAFIYSQWSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNC 945
             F SA +Y++W  + NG  +  +      + N+++    E +F + +     G D     
Sbjct: 967  EFLSASLYTRWY-LPNGNNISEA------LVNSDIEKGDEDLFLECMKPDCPGIDFE--- 1016

Query: 946  TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVIT 1005
            T YFV DATSWLRH A IFKLA+N  LKFAICLTTFQELR+LR SKD+ V+EAATR +IT
Sbjct: 1017 TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1076

Query: 1006 IRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQ---AE 1062
            IRQLY E K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++ +     
Sbjct: 1077 IRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQP 1136

Query: 1063 RLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
             +T  + N    + VL++DDD M +KA+++ IKT +TK++FSL +KLG    LCT+
Sbjct: 1137 HVTPRHSN----YVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/948 (50%), Positives = 641/948 (67%), Gaps = 44/948 (4%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            S +P Q  ++KLQ+IYK IV QE ELQ++C  LT+SQTT+L S+W+IYR+N EL+ NY+ 
Sbjct: 363  SNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVT 422

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL++Q   DL++GQEI++ YRI +RLWVYG ITFLDVLKNFS+FMDPEVC QFI 
Sbjct: 423  FISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFIT 482

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY +++KY YG
Sbjct: 483  HVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYG 542

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439
             GKLYYH++T+QQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+R S +  
Sbjct: 543  YGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNT- 601

Query: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499
                  RNSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF+ KFG D +  ++F  +D+F
Sbjct: 602  ------RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIF 655

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ----XXXXXXXXXXXXXXXR 555
             QNPE+L+Y+FRHAPAFAES +LQ +GFG+ KNPFALLF                     
Sbjct: 656  LQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS 715

Query: 556  SEATETSSYTD----PFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQ 611
             E T   S         D  ISS+ YF N++++   +   P   +IWL SL+++N+T++Q
Sbjct: 716  GEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLP-PPRYDIWLKSLSYLNLTAVQ 774

Query: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSI 671
            C + VL KFLH P VVALPH + W +FI+++  K E +  ++   FW  F+RR +P NSI
Sbjct: 775  CGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSI 834

Query: 672  VTLGNVLVCYMLDNLH--PFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDA 729
            V+  NVL+ Y LDN +    +    E+  S++L +L+  +N NE LPE+WKCWGTLWFDA
Sbjct: 835  VSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDA 894

Query: 730  I-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKF 784
            I        +  E  GV DHLFFDSP+DGIVFD KDE GEKFW R++R + L K IA+ F
Sbjct: 895  ITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF 954

Query: 785  PDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXX-XXXTIEINEE 843
             D+G+ +S  A V+CRR+D+  ++ L + +FK                      IE+ E 
Sbjct: 955  -DIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEM 1013

Query: 844  IEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW------- 896
               VN+   ATP +S+   E+IFEYTGY R+AP+   FDKNG   SA  Y+ W       
Sbjct: 1014 PNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIV 1073

Query: 897  ----SNVGNGVTLDVSGESI--YDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFV 950
                ++  N V     G S    DV  N  S     +F ++   ++   D     T  FV
Sbjct: 1074 PKSAASPENSVAGSSPGRSFQSQDVEENIFS-----VFTNEEENSTSLLDGLNLETTSFV 1128

Query: 951  IDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLY 1010
            +DATSWLRH AHI+KLA N+ L F+ICLTTFQELR+LR SKD+ V+EAA R++I IRQLY
Sbjct: 1129 LDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLY 1188

Query: 1011 DEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKN 1070
             + K+IP+RFTGNIATH+EE+LEFEEQITW++HVDEFVI++I+K  ++F    + +   N
Sbjct: 1189 SDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDN 1248

Query: 1071 KGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
              + F VLV+DD+NM +KA ++ I+T  T+++F+L S++G    +CTN
Sbjct: 1249 DSR-FFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/949 (50%), Positives = 638/949 (67%), Gaps = 64/949 (6%)

Query: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 499

Query: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPES 505
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDF 559

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSE-------- 557
             +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+               +S         
Sbjct: 560  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITE 619

Query: 558  --ATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPT----------NLNIWLDSLNHI 605
               + + +  D  D  +SS +     D+L   FNDI T              WL+SL  +
Sbjct: 620  SSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFL 679

Query: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRT 665
            NMTS++C + VL KFLH PL +ALPHFL W++FI++I  K   ++      FWI  ++R 
Sbjct: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739

Query: 666  MPWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWG 723
             PW+++VT  N+L+  +LDN    P +    +++  L L +L++ + E E LPEIW CWG
Sbjct: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799

Query: 724  TLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVL 775
            TLWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GEKFW R+ R + 
Sbjct: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859

Query: 776  LLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXX 835
            L + +++ F  +G+ ++ ++S+   R+ +  +  L NL++K                   
Sbjct: 860  LFRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYK-LEPLSTLGSSIPTLNTLE 915

Query: 836  XTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895
              I++ E     N+D  A P LSV+ G SIF YTGY +L P+Y CFDKNG F SA +Y+ 
Sbjct: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975

Query: 896  WSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATS 955
            W  V NG     +        N+N     E  F + + +  +  D N   T YFV DATS
Sbjct: 976  WY-VPNGSNNPETN------INSNCEKENEGQFLECLKSDDREIDLN---TTYFVFDATS 1025

Query: 956  WLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKI 1015
            WLRH A IFKLA+N  LKFAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E K+
Sbjct: 1026 WLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1085

Query: 1016 IPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGK-- 1073
            +P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++        EN N+    
Sbjct: 1086 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKL-------ENANQLPVS 1138

Query: 1074 ----EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
                 + +L++DDD M +KA+++ IKT +T+++FSL +KLG    LCT+
Sbjct: 1139 SCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1030 (47%), Positives = 657/1030 (63%), Gaps = 124/1030 (12%)

Query: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264
            +  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTT+LK+LW IY++N +LI NY+ FI TA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324
            LL++Q   DL +G+EI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384
            +S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444
            YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++G+       
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 530

Query: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG---------------KDFNG 489
            +RN QLI+YLKH+EVMLLP+FLEN +LQ VVL+YF++KFG                  N 
Sbjct: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590

Query: 490  N----DVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ------ 539
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+      
Sbjct: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650

Query: 540  --------------------XXXXXXXXXXXXXXXRSEATE---TSSYTDPFDVQISSES 576
                                                SE  E    + ++D    Q++SE 
Sbjct: 651  ERKDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710

Query: 577  YFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWL 636
            +FQNI+ L   +  IP +L IW+ SLNHIN+ S++CS+ VL KFLH PL++ALPH L W 
Sbjct: 711  FFQNIEQLRFDYF-IPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 637  HFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCYMLDN----------- 685
            +FI++IL K E +  +    FWI  L+   PWN I+   NVL+ Y LDN           
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 686  -----LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKK-----CDV 735
                 ++ F+     K+ ++   DL++++NENE+LPE+WKCWGTLWFD I        D 
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGLKVSFQA 795
             E  G++DH+F D P+DGI +  +DE GE FW R++R + L KGIA+ F  LGLKVS+ A
Sbjct: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949

Query: 796  SVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXT----------IEINEEIE 845
                R N++P D  LK  +FK                    T          ++I E I 
Sbjct: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009

Query: 846  AVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVTL 905
              N++ +  P  S+++ E IF+YTGY +L P+   FDKNG F+S  IY+ W    + + L
Sbjct: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069

Query: 906  -------DVSGESIYDVANNNLS---LHWEKI----FFDKIAAASKGSDENYN-CTLYFV 950
                     + + + D+    LS   L + ++    F DK    S  S E +N    YFV
Sbjct: 1070 AQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129

Query: 951  IDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLY 1010
             DATSWLRHFAHI+KLA N+ LKFA+CLTTFQELR+LR SKD  VVEA+TR++IT+RQLY
Sbjct: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189

Query: 1011 DEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLT----- 1065
             +  ++P+RFTGN+AT +EE+LEFEEQITW++HVDEFVI+A+ K  ++F   +       
Sbjct: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249

Query: 1066 -----------------DENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSK 1108
                             +E K+   ++ VL+TDDD+M  KA+ + I T  T+ +FS+ S 
Sbjct: 1250 TSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309

Query: 1109 LGINSGLCTN 1118
            +GI+ G+CTN
Sbjct: 1310 MGIDEGVCTN 1319

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 12/106 (11%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVPGIVDPVGKGFIDGI--------TNSQISAQNTPSK 91
           + QKRHSS+S+++   +   KRR+    + V   +ID +         NS I  Q TPSK
Sbjct: 52  IRQKRHSSNSYSNAKNNPAVKRRIAK-PEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110

Query: 92  TDDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYVNRTMLARN 137
               SRRPS+ +K M STPQ  +  +   +VP SP+Y+     + N
Sbjct: 111 -GTLSRRPSLIKKQMNSTPQPMSYVVS--EVPASPFYLPANSFSNN 153

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/979 (48%), Positives = 660/979 (67%), Gaps = 71/979 (7%)

Query: 195  IRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELI 254
            I  +P    +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT++K+LW IY++N ELI
Sbjct: 234  IVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELI 293

Query: 255  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVC 314
             NYI+FI TALL +QP  DL++GQEI++IYR+E+RLWVYG ITFLDVLKNFSNFMDPEVC
Sbjct: 294  NNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVC 353

Query: 315  CQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 374
            CQFI + F+S+SNML D+P +YSI W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++
Sbjct: 354  CQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQAL 413

Query: 375  KYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRS 434
             Y YG GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF +RS
Sbjct: 414  IYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERS 473

Query: 435  SGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFD 494
             GS+       RN  +++YLKH+EVMLLPSFLE+ +LQ VVL +F+ +FG   N  D FD
Sbjct: 474  GGSS-------RNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFD 526

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXX 554
             K +F Q+ E LRY+F HAPAFAES +LQL+GFG+P+NPFA+LF+               
Sbjct: 527  HKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERR 586

Query: 555  RSEAT---ETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQ 611
            RS+++    T+         IS + YF+NID+    ++  P ++ IW  SL+++N+TS++
Sbjct: 587  RSKSSPPLPTNLDDGNGSSSISVDHYFENIDSHRVPYS-FPQDIQIWQQSLSYLNLTSME 645

Query: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSI 671
            CS+ VL KFLHAPL+ ALPH L W HF+V++  ++  ++S  +  FW+ F+RR  PWNS+
Sbjct: 646  CSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSL 705

Query: 672  VTLGNVLVCYMLDNLHPF--LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDA 729
            V+  N L+ ++LDN      ++K  E++  ++L  L+E++  +E LPE+WKCWGTLWFD 
Sbjct: 706  VSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDT 765

Query: 730  IK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKF 784
            I      K   ++  G++DHLF D+P+DGI FD+ DE G KFW R+ R + + KG+AK+F
Sbjct: 766  ISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF 825

Query: 785  PDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEINEEI 844
               G++VS   +    R D+   + LK  +FK                     I++ E I
Sbjct: 826  -HYGIRVS--DTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNF--IKVFEPI 880

Query: 845  EAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-------- 896
              +N + +A P+LS++ GESIFE+ GY R+ PDY+CF+KNG   +  +Y+          
Sbjct: 881  SPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQ 940

Query: 897  --------SNVGNGVTL----------DVSGESIYDVANNN-LSLHWEKIFFD-----KI 932
                     +V NGV L          + + E++ + A    L++  +  F +     + 
Sbjct: 941  GGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRF 1000

Query: 933  AAASKGSDENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKD 992
                   + + N T YFV+DATSWLRHFAH++KLA NN LKFAICLTTFQELR+LR SKD
Sbjct: 1001 PHGDLACNADSNVT-YFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKD 1059

Query: 993  DTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAI 1052
            ++VVEAATR+VIT RQLY E+K++P+RFTGNIATH+EE+LEFEEQITW++HVDEFVI+A+
Sbjct: 1060 ESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAV 1119

Query: 1053 AKLNQRFQAERLTDENKNKGKE-------------FAVLVTDDDNMNQKAKDRMIKTCNT 1099
             K  ++F+   L  + +++G+E             F VLVTDD NM  KA+   I   ++
Sbjct: 1120 YKSQRKFKGLNL--QARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSS 1177

Query: 1100 KYLFSLGSKLGINSGLCTN 1118
            +++F+  ++LG N  +C N
Sbjct: 1178 RFMFAFCNQLGYNQKVCIN 1196

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 13/128 (10%)

Query: 30  SDMRPTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIVDPVGKGFIDGITNSQ---ISAQ 86
           S ++  S   LHQKRH+S+S+ D  +S +AKRR   +   V +   D +  S    + + 
Sbjct: 20  SRIQMASHPTLHQKRHNSNSY-DYYDSGYAKRRPNTLSQNVSQN--DELAASAACFLDSN 76

Query: 87  NTPSKTDDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYVNRTMLARNMKVVSRDTY 146
            TPSK  + +  PS  ++  + TPQ         D P+SP+Y+  T  + N++  S+   
Sbjct: 77  LTPSKHQECT--PSSFQRATDETPQ----PFYPADTPQSPFYLPTTS-SSNLEAASKVIT 129

Query: 147 EDNANPQM 154
            DN++ Q+
Sbjct: 130 NDNSSVQL 137

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/961 (49%), Positives = 641/961 (66%), Gaps = 71/961 (7%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P  + +Q  ++KLQ+IYKII+ QE ELQ+RC  LT SQTTE+K+LW IY+LN +LI NY
Sbjct: 309  VPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNY 368

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + FI TAL  +Q  +DL++G+EI+DIY+IE+RLWVYG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 369  VTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 428

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S+ML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y 
Sbjct: 429  ITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYS 488

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437
            YG GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR+S S
Sbjct: 489  YGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSS 548

Query: 438  ANNNEIAHRNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDV--FD 494
             +      RN Q L+DYLKH+EVMLLP+F+E+ DLQ VVL+YF +KFG D+N N+V  F 
Sbjct: 549  NS------RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQ 602

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXX 554
             + MF QN + L++YFRHA AFAE+Q+LQL+G+GNPKNPFALLF                
Sbjct: 603  PRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKR 662

Query: 555  R------SEATETSSYTD----------PFDVQISSESYFQNIDALNSSFNDIPTNLNIW 598
            +       E   +++++             +V + SE +F NID L  + N +P ++++W
Sbjct: 663  KPKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAIN-NFMPNSISLW 721

Query: 599  LDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFW 658
             DSL + N T+ +CS+ VL KFL+ PL+VALPH L W++F+++I  ++E      ++ FW
Sbjct: 722  NDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFW 781

Query: 659  IHFLRRTMPWNSIVTLGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLP 716
              F++R  PWNS+V   NVL+ YM+DN   +  L +  +++ SL L++L+  +N NE+LP
Sbjct: 782  YAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLP 841

Query: 717  EIWKCWGTLWFDAI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRS 770
            E+WKC G+LWFD I      + CD     G++D+ F D P+DGI FDE DE+G KFW RS
Sbjct: 842  EVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRS 901

Query: 771  VRAVLLLKGIAKKFPDLG-LKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXX 829
            VR + L +GI ++F   G L +S+ A V  RR  +  +  L   +FK             
Sbjct: 902  VRVIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFDDM 960

Query: 830  XXXXXXXTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNS 889
                        EEI++ N D  A P LS++ GE+IFEY GY R+  DY+ FDKNG   S
Sbjct: 961  LVSNF-------EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLIS 1013

Query: 890  AFIYSQWS-NVGNGVT---------------LDVSGE-----SIYDVANNNLSLHWEKIF 928
               Y+ WS N   GV                 D   E       +D   +++   W K  
Sbjct: 1014 TSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNKEI 1073

Query: 929  FDKIAAASKGSDENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLR 988
            +D I    K   E Y  T YF++DATSWLRHFAH++K+A N+ LKF+ICLTTFQELR+LR
Sbjct: 1074 YDDI--GRKFGMELYEDT-YFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLR 1130

Query: 989  GSKDDTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFV 1048
             SKD+ VVEAATR++IT+RQL+ E K++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFV
Sbjct: 1131 KSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFV 1190

Query: 1049 IDAIAKLNQRFQAERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSK 1108
            I+A+ K     + +R   E  N      VLVTDD NM  KA ++  KT +T+++F++ + 
Sbjct: 1191 IEAVIKA----ETKRKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNY 1246

Query: 1109 L 1109
            L
Sbjct: 1247 L 1247

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 57/116 (49%), Gaps = 14/116 (12%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVP-GIVDPVGKGFIDGITNS------QISAQNTPSKT 92
           L QKRH SSS+  TP  ++ K+RV     +     F+D  +N       Q S QNTP   
Sbjct: 63  LGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLDSGSNGGGDISNQTSLQNTPL-- 118

Query: 93  DDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYVNRTMLARNMKVVSRDTYED 148
             AS +PSI++  + +T      +  T D   SP+ +N   L  N+ +VS +  ED
Sbjct: 119 --ASPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSN-LPSNLDIVSNENLED 171

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/946 (50%), Positives = 632/946 (66%), Gaps = 57/946 (6%)

Query: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NT+L+ NY+ FI TAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 506

Query: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPES 505
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ-----XXXXXXXXXXXXXXXRSEATE 560
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+                     S  TE
Sbjct: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTE 626

Query: 561  TSSYTDPFDVQ-----ISSESYFQNIDALNSSFNDI--------PTNLN--IWLDSLNHI 605
            +S+     D +     +SS +   + D L   FNDI        P+ L    WL++L  +
Sbjct: 627  SSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686

Query: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRT 665
            NMTS++C I VL KFLH PL +ALPH L W++FI++I  K   ++      FW+  ++R 
Sbjct: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746

Query: 666  MPWNSIVTLGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWG 723
             PW+++VT  NVL+ Y+LDN   +  +    + +  L L +L+E +NE E LPEI  CWG
Sbjct: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWG 806

Query: 724  TLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVL 775
            TLWFD I + +   I         G++D++  DSP DGI+FDEKDE GEKFW R+ R + 
Sbjct: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866

Query: 776  LLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXX 835
            L + +++ FP +G+ +     ++  R+       L +L FK                   
Sbjct: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFK-LEPLCNIHNNIPVLGALE 922

Query: 836  XTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895
              I+I+E     N D  A P LSV  G++IF Y GY +L  DY CFDKNG F SA +Y+ 
Sbjct: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982

Query: 896  WSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATS 955
            W  V N    ++     Y+    N  L  E I  D      K        T YFV DATS
Sbjct: 983  WY-VPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEIDFK--------TTYFVFDATS 1033

Query: 956  WLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKI 1015
            WLRH A IFKLA+N  L+FAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E K+
Sbjct: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093

Query: 1016 IPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAE---RLTDENKNKG 1072
            +P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI+++ K  ++ ++    RL+    N  
Sbjct: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFN-- 1151

Query: 1073 KEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118
              + VL++DDD M +KA+++ IKT +T+++FSL +KLG    LCT+
Sbjct: 1152 --YVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/985 (47%), Positives = 637/985 (64%), Gaps = 88/985 (8%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P  + +Q  ++KLQ+IYK IV QE ELQ+RC  LT SQTTELK+LW IYR+N+EL+ NY
Sbjct: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            I FI TA+  TQP +D  +G+EI++IY+IE+RLWVYG ITFLD+LKNFSNFMDPEVCCQF
Sbjct: 435  ITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+SNML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437
            YG GKLYYH++TVQQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D  S +
Sbjct: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD--SNN 612

Query: 438  ANNNEIAHRNSQL-IDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFN--GNDVFD 494
            +NN     RN QL +DY+KH EV LLP+F E+ +LQ VVLMYF DKFG D+N   N++F 
Sbjct: 613  SNNG----RNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFI 668

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXX 554
            ++ MF QN +  + ++R++ AFAESQ+LQ++G+GN K+PF+LLF+               
Sbjct: 669  SRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKR 728

Query: 555  RSEATETSSYTDPF----------------DVQISSESYFQNIDALN-SSFNDIPTNLNI 597
            + +       T P                 +V +++E +F+NID +N  SF  +P +++I
Sbjct: 729  KPKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSF--MPNSVDI 786

Query: 598  WLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAF 657
            W  SL + N  SI+CS+ V  KFLHAP ++ALPH L W +FI++I+ +L+   +  +  F
Sbjct: 787  WNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEF 846

Query: 658  WIHFLRRTMPWNSIVTLGNVLVCYMLDNL-HPFLKKELEKFY-SLELDDLIEYYNENENL 715
            W+ F+RR  PWNSIV   NVL+ YM+DN     +  EL  FY S+ LD+L+ Y+NENE L
Sbjct: 847  WVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEEL 906

Query: 716  PEIWKCWGTLWFDAI---------KKCDVMEIP----------GVQDHLFFDSPLDGIVF 756
            PE+WKC G+LWFD I         K  +V+             GV+D+ FFD P+DG  F
Sbjct: 907  PEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDF 966

Query: 757  DEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLG-LKVSFQASVFCRRNDIPPDYFLKNLTF 815
            DE DE+GE+FW R+ R + L K +A+ +  LG L +S++A VF RR     D +  N   
Sbjct: 967  DESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRR----KDEYKVNTVC 1022

Query: 816  KXXXXXXXXXXXXXXXXXXXXTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLA 875
            +                     IE  E  + VN D   TP LS+V G+SIF+Y GY R+ 
Sbjct: 1023 QELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVC 1082

Query: 876  PDYHCFDKNGGFNSAFIYSQWS----------NVGNGVTLDV----SGESIYDVANNNLS 921
            P+++ FDKNG F S   ++ WS          N  + +T D     SG      + NN  
Sbjct: 1083 PNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDP 1142

Query: 922  LHWEKIF----------FDKIAAASKGSDENYNCTL----YFVIDATSWLRHFAHIFKLA 967
            ++   +F           ++  +     D   N +L    YF++DATSWLRHFAHI+K+A
Sbjct: 1143 MNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIA 1202

Query: 968  KNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATH 1027
             +  LKFAICLTTFQELRYLR SKD  VVEAATR++IT+RQLY E  ++P+RFTGN+ATH
Sbjct: 1203 TSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATH 1262

Query: 1028 VEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDEN-----KNKGKEFAVLVTDD 1082
            +EE+LEFEEQITW++HVDEFVI+A+ K  ++ + +RL D N     K K     +LVTDD
Sbjct: 1263 IEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTDEKEKSIFGIILVTDD 1321

Query: 1083 DNMNQKAKDRMIKTCNTKYLFSLGS 1107
              M  KA DR IKT +T+++FS+ +
Sbjct: 1322 ITMKNKAMDRKIKTFSTRFIFSMAN 1346

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/970 (48%), Positives = 645/970 (66%), Gaps = 76/970 (7%)

Query: 199  PSAQP-NQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            PS+ P +Q  ++KLQ+IY+ IV QE ELQ+RC  LTTSQTT+LK+LW IY++N ELI NY
Sbjct: 235  PSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNY 294

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 295  VAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQF 354

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I
Sbjct: 355  ITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHI 414

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437
            +G GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R+ G+
Sbjct: 415  FGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGN 474

Query: 438  ANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKD 497
                   HRNS +++YLKH+EVMLL SFLE+ +LQ VVL +F+ KFG   +  D F+ +D
Sbjct: 475  -------HRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRD 527

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSE 557
            MF Q+ E ++Y+FRHAPAFAES +LQ +GFG+PKNPFALLF+               +S+
Sbjct: 528  MFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSK 587

Query: 558  ------ATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQ 611
                  + ET+S+  P         Y +N+D+   ++ + P +L IW +SL+HIN+TS +
Sbjct: 588  SSHSFTSIETTSHLSP-------SEYLENVDSPRYAY-EFPEDLAIWRESLSHINITSAR 639

Query: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSI 671
            CS  V  KFL  PLVVA+ H L W +F++++  K++ + S ++ +FWI  +R+  PWNSI
Sbjct: 640  CSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSI 699

Query: 672  VTLGNVLVCYMLDN---LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFD 728
            V   N+L+ ++LDN     P +    E+  S++   L+E+++E+E+LPEIW+CWG LWFD
Sbjct: 700  VDFLNMLMAFVLDNNWKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFD 758

Query: 729  AI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAK 782
             I      +  DV+   G +DH F+D P DGI FDE DEVGEKFW R+ R + + KGIA+
Sbjct: 759  VIADKSNGEDGDVIN-SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ 817

Query: 783  KFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEINE 842
            +F  LGL +S  A     R  +   + L+N +F                      I + E
Sbjct: 818  EF-SLGLTLSAFAPQ--SRRPMTAGHPLQNFSFNFEEIPAQSQIQSFVRNQ----IPLFE 870

Query: 843  EIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWS----- 897
            EI   N+DP   P  S++ GESIF++ GY ++  DY CF+K+G   S  +Y+        
Sbjct: 871  EIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGP 930

Query: 898  -NVGNGVTLDVSGESIYDVANNNLSL----HWEKIFFDK------IAAASKG----SDEN 942
               G+    +  G S       N  +      E+ + D       I  A +      D +
Sbjct: 931  IQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLS 990

Query: 943  YNC---TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAA 999
             NC     YFV+DATSWLRHFAH+FKLA NN L+F ICLTTFQELR+LR SKD++VVEAA
Sbjct: 991  CNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAA 1050

Query: 1000 TRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRF 1059
            TR+VIT+RQLY +KK++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  ++F
Sbjct: 1051 TRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKF 1110

Query: 1060 QAERLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSK 1108
            +A  +  + K  G +           F  LV+DD NM  KA  + I+T +T+++F++ ++
Sbjct: 1111 EA--INAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQ 1168

Query: 1109 LGINSGLCTN 1118
            +G+    CTN
Sbjct: 1169 IGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/967 (47%), Positives = 638/967 (65%), Gaps = 73/967 (7%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+SNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+ G+  
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN-- 444

Query: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499
                  RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D F  + +F
Sbjct: 445  -----QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSE-- 557
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNPFALLF+               +S+  
Sbjct: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559

Query: 558  ----ATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCS 613
                + E  S T P +       Y +++D+    + + PT+L IW  SL+HIN TSI+CS
Sbjct: 560  NSFTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611

Query: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVT 673
              VL KFLH PLV A  H L W +F++++  +++ + S ++  FWI   R+  PWNSIV 
Sbjct: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671

Query: 674  LGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIK 731
              N+++ + LDN      +    E+F S+++  L++++++NE+LPE+WKCWG LWFD I 
Sbjct: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731

Query: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPD 786
             K DV++       VQDH+F D P+DGI FDE DE G +FW R+ R V + KGIA++F +
Sbjct: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790

Query: 787  LGLKVSFQASV-FCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEINEEIE 845
            +GL +   ASV    R  +   + L+N  FK                     +   E I 
Sbjct: 791  MGLTL---ASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQ----MPAFENIS 843

Query: 846  AVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWS----NVGN 901
              N+DP A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +Y+  S     +  
Sbjct: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903

Query: 902  GVTLDVSGESIYDVAN--NNLSL----HWEKIFFDKIAAAS----------KGSDENYNC 945
            G   +    S  D  N  +N  +      E+++ D                   D + NC
Sbjct: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963

Query: 946  ---TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRS 1002
                 YFV DATSWLRHFAH++KLA N  L+FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023

Query: 1003 VITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAE 1062
            VIT+RQLY EK+++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K   +F+A 
Sbjct: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEA- 1082

Query: 1063 RLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGI 1111
             L  + K  G +           F  LV+DD NM  KA  + I+T +++++F++ +++G+
Sbjct: 1083 -LNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGL 1141

Query: 1112 NSGLCTN 1118
                CTN
Sbjct: 1142 AHHACTN 1148

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/976 (47%), Positives = 640/976 (65%), Gaps = 93/976 (9%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            + Q +Q  ++KLQEIY+ IV QETELQQRC  LTTSQTT+LK+LW IY++N ELI NY  
Sbjct: 278  AKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFM 337

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL TQP  DL++G+EI+++YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFII
Sbjct: 338  FITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFII 397

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            Y FIS+SNML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY +G
Sbjct: 398  YVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFG 457

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439
             GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+SG   
Sbjct: 458  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGH-- 515

Query: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499
                 HRN+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  D FD + +F
Sbjct: 516  -----HRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVF 569

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSEAT 559
             Q+ E L+++FRHA  +AES LLQL+GFG+P+NPFALLF+               +S+++
Sbjct: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS 629

Query: 560  ETSSYTDPFDVQI---SSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV 616
             ++ Y    D      +   +F+ ID+    +   P ++NIW +SL++ N+T+++CS+ V
Sbjct: 630  TSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYK-FPDDINIWKESLSYANVTAMKCSMIV 688

Query: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN 676
            L KFLH PL+ ALPH L W +F+ A   ++  +   ++  FW+  +R+  P+N+I+T  N
Sbjct: 689  LRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLN 748

Query: 677  VLVCYMLDNLH---PFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKKC 733
            VL+ YM +      PF  +  E+F  + L DL+ Y+ ENE LPE+W+CWGTLWFDA+   
Sbjct: 749  VLLLYMNNQTQANFPF-DEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTK 807

Query: 734  DVMEI-----PGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLG 788
             +  +      GV+DH+F DSP+DGI FD  DE GEKFW R  R +LL + +A + P +G
Sbjct: 808  HITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECP-VG 866

Query: 789  LK-----VSFQASVFCRRNDIPP----DYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIE 839
            L+      ++++ VF  + + PP    D +L+  T                        +
Sbjct: 867  LREISGGRNWRSLVF--KFEEPPSEWCDMYLEPFTL---------------------VFD 903

Query: 840  INEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNV 899
              E+I  VN+D +ATP   +     I    GY  L PDY+CF++NG   +  +Y+  +  
Sbjct: 904  TFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLE 963

Query: 900  GNGVTL--DVSGESIYDVAN---------NNLSLHWEKIFFDKIAAASKGSDE------- 941
             +G+    D +G+ + +            N+L    E+   D+    +   ++       
Sbjct: 964  SSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQML 1023

Query: 942  ---NYNC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDD 993
               + +C       YFV+DAT+WLRHF H++KLA NN LKFAICLTTFQELR+LR SKD+
Sbjct: 1024 PRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDE 1083

Query: 994  TVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIA 1053
            +V+EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+AI 
Sbjct: 1084 SVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIH 1143

Query: 1054 KLNQRFQAERLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYL 1102
            K   +F A  L D+ K   ++           F  LVTDD NM  KA  + IK  +T+++
Sbjct: 1144 KAQDKFNA--LNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFM 1201

Query: 1103 FSLGSKLGINSGLCTN 1118
            FS+ ++LG    +CTN
Sbjct: 1202 FSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/971 (47%), Positives = 633/971 (65%), Gaps = 77/971 (7%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +PS   +QT ++KLQEIYK IV QETELQ+RC  LTTSQTT+LK+LW IY+LN ELI NY
Sbjct: 314  VPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNY 373

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
              FI TALL TQP  DL++GQEI+++YRIE+RLW+YG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 374  FTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQF 433

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I+Y FIS+SN+L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY 
Sbjct: 434  IVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYN 493

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437
            +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+SG 
Sbjct: 494  FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGH 553

Query: 438  ANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKD 497
                   HR S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  FD   
Sbjct: 554  -------HRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFDPSL 605

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSE 557
            +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+               +S+
Sbjct: 606  IFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSK 665

Query: 558  ATETSSYTDPFDVQISSE--SYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIH 615
            +T ++      D     +   +F+ +++  +++     +LNIW +SLN++N TS++CS+ 
Sbjct: 666  STASNQSDMSIDDTFLGDPVQFFETLNSTKTAYR-FSQDLNIWKESLNYVNKTSMRCSMV 724

Query: 616  VLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLG 675
            VL KFL++ L+ ALPH L W +F+VA+  +L+ + ++    FWI F+R+  PW SI    
Sbjct: 725  VLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFL 784

Query: 676  NVLVCYMLDNLHPF---LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKK 732
            NVL+ Y+ D   P    + + +  + ++ L +L+EY+ ENE+LPE+W CWGTLWFD I  
Sbjct: 785  NVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINS 843

Query: 733  CDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDL 787
              V  +      GV+DH+F D+P+DGI FD  DE GEKFW R VR +LL +GIA +FP  
Sbjct: 844  KHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFP-- 901

Query: 788  GLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEINEEIEAV 847
                 F  + F   +D       K+L FK                      E  E I  V
Sbjct: 902  -----FGFTEFNGSDD------WKSLVFKFNEPPAEWKEQYLGSFSKEYG-EF-ESISFV 948

Query: 848  NMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY-SQWSNVGNGVTLD 906
            N D Q+ P+  +V G  I    GY +L PDY CF+KNG   +  +Y S  S  G+GV  D
Sbjct: 949  NTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPND 1008

Query: 907  VS--GESIYDVAN-----------NNLSLHWEKIFFDKI-------------AAASKGSD 940
                G +   + N           NNL    E    D+                  +G  
Sbjct: 1009 SEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDL 1068

Query: 941  ENYNCT--LYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA 998
            + +  T   YFV+DAT+WLRHF H++KLA +N LKFAICLTTFQELR+LR SKD++V+EA
Sbjct: 1069 QYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEA 1128

Query: 999  ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR 1058
            ATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+AI K   +
Sbjct: 1129 ATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSK 1188

Query: 1059 FQAERLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107
            F   +L  + K  G+E           F  LVTDD NM  KA+ + I+  +TK++F++  
Sbjct: 1189 FN--QLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICH 1246

Query: 1108 KLGINSGLCTN 1118
            ++G++  +CT+
Sbjct: 1247 EIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/964 (47%), Positives = 614/964 (63%), Gaps = 70/964 (7%)

Query: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266
             ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI FI TALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326
             +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y FI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386
            NMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G GKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAHR 446
            ++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S         +R
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS-------GNR 516

Query: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPESL 506
             + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F Q+ E L
Sbjct: 517  TNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFIQDAERL 575

Query: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSEATETSSYTD 566
            +++FRH+  F++S +LQL GFG+PKNPFA+LF+               +S  + +    D
Sbjct: 576  KHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLD 635

Query: 567  PFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLH 622
            P +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + VL +FL+
Sbjct: 636  PVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLY 694

Query: 623  APLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCY- 681
             P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N L+ Y 
Sbjct: 695  GPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYC 754

Query: 682  MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKCDV---- 735
            M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK D+    
Sbjct: 755  MVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTT 814

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGLKVSFQA 795
            +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G       
Sbjct: 815  LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHG--- 871

Query: 796  SVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXX-XXXXXXTIEINEEIEAVNM-DPQA 853
               C++ + P     KNL F+                       E  E I  +N  D   
Sbjct: 872  ---CKKLN-PEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQ 927

Query: 854  TPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SNVGNG------- 902
              + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N+  G       
Sbjct: 928  DGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANK 987

Query: 903  ----VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENYNC-----TLYF 949
                  L V     Y  A + L   W + F    F +    ++    N NC       +F
Sbjct: 988  ILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFF 1047

Query: 950  VIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQL 1009
            V+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EAATR+VI +RQL
Sbjct: 1048 VLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQL 1107

Query: 1010 YDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENK 1069
            Y E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +F    L ++  
Sbjct: 1108 YYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNV--LNNDAI 1165

Query: 1070 NKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSG 1114
             KGK+               F  LVTDD NM  KA+   I+T +T+++F++  +LG  +G
Sbjct: 1166 EKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETG 1225

Query: 1115 LCTN 1118
            +CTN
Sbjct: 1226 VCTN 1229

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 15/114 (13%)

Query: 32  MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS 81
           M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct: 1   MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL 59

Query: 82  QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT 132
             S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct: 60  DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT 112

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/724 (53%), Positives = 502/724 (69%), Gaps = 45/724 (6%)

Query: 202 QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261
           + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++NT+LI NY  FI
Sbjct: 286 KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345

Query: 262 ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321
            TALL +QP  D+++G+EI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVC QFI + 
Sbjct: 346 TTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405

Query: 322 FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381
           FIS+S +L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  G
Sbjct: 406 FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465

Query: 382 KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441
           KLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR++G     
Sbjct: 466 KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGG---- 521

Query: 442 EIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQ 501
              +RN  LIDYLKH+EVMLLPSFL + DLQ VVL YF+D+FG D++ N++FDT+DMF Q
Sbjct: 522 --NYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQ 579

Query: 502 NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSEATET 561
            P  LR++FRHAPAFAES +LQL+GFGNPKNPFALLF+               +S++T T
Sbjct: 580 PPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTST 639

Query: 562 S--SYTDPFDVQ--------------------ISSESYFQNIDALNSSFNDIPTNLNIWL 599
           +  S T P  V                     +S   Y  NI+ L  +  + P ++  W+
Sbjct: 640 ADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAI-ETP-DICTWI 697

Query: 600 DSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWI 659
            SL+ INMTS++CS+ VL KFLH PL++ALPHFL W  FI+A   K+  + +++   FW 
Sbjct: 698 KSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWR 757

Query: 660 HFLRRTMPWNSIVTLGNVLVCYMLDNL-HPFLKKELEKFYS-LELDDLIEYYNENENLPE 717
             ++R  PW++I +  NVL+ Y+LDN  +  + +EL   YS ++LDD++ ++N++E+LPE
Sbjct: 758 ILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPE 817

Query: 718 IWKCWGTLWFDAIKK-----CDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVR 772
           +WKCWGTLW+DAI        D     G+ DH+F D P+DGI FD +DE G KFW R++R
Sbjct: 818 VWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALR 877

Query: 773 AVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXXXXXX 832
            + L KGI+KKF D GLK+S +A V+C RN+   D  L+  TFK                
Sbjct: 878 VIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEPTSSKFNEF- 934

Query: 833 XXXXTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFI 892
                I + EE+ A+N D  ATP+LSVV GE+IFEY GY  L  D + FDKNG   S+ I
Sbjct: 935 -----IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSI 989

Query: 893 YSQW 896
           Y+ W
Sbjct: 990 YTSW 993

 Score =  214 bits (546), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 137/191 (71%), Gaps = 12/191 (6%)

Query: 940  DENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAA 999
            DE      +F+ DATSWLRHFAHI+K+A N  LKF +CLTTFQELR+LR SKD+ VVEAA
Sbjct: 1091 DELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAA 1150

Query: 1000 TRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRF 1059
             R++IT+RQLY E +++P+RFTGN+A  +EE+LEFEEQITW++HVDEFVI+A+ K   +F
Sbjct: 1151 ARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKF 1210

Query: 1060 QAERLTDENKNKGK------------EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107
                 T + + +G              +  LVT+D NM +KA+D+ IKT +T ++FSL S
Sbjct: 1211 TTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCS 1270

Query: 1108 KLGINSGLCTN 1118
            KLG++  LCTN
Sbjct: 1271 KLGMSLDLCTN 1281

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/965 (39%), Positives = 555/965 (57%), Gaps = 111/965 (11%)

Query: 34  PTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIVD--PVGKGFIDGIT--NSQISAQNTP 89
           P     LHQKRH+SS++N T ++   KRR+P   D  P+G  F+D  +  +S +    TP
Sbjct: 40  PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97

Query: 90  SKTDDASRRPSISRKV--MESTPQVKTS-------------------------------- 115
                 SR  S+++K   +++T  V  S                                
Sbjct: 98  -----GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGN 152

Query: 116 --------SIPTMDVPKSPYYVNRTMLARNMK----------VVSRDTYEDNANPQMRAD 157
                   S   +D+P SP+Y+     +  ++          V S +  +++  P++   
Sbjct: 153 SLLDNIANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLI 212

Query: 158 EPLVASN----GIYSNSQ----------PQSQVTLSDIRRXXXXXXXXXXMIRQLPSAQP 203
           E    SN     I  N++            + VT ++  +           I      + 
Sbjct: 213 EEQYNSNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRS 272

Query: 204 NQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIIT 263
            Q  I KLQ+IYK I+VQE ELQ  C  +T+SQTT+LK +W +Y++N EL+ NY+ FI T
Sbjct: 273 TQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITT 332

Query: 264 ALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFI 323
           ALL +Q   DL++GQEI+D+Y+IE+RLWVYG ITFLDVLK+FSNFMDPE+CCQFII+ FI
Sbjct: 333 ALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFI 392

Query: 324 SVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKL 383
           S++NM + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKL
Sbjct: 393 SIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKL 452

Query: 384 YYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEI 443
           YYH+ATVQQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I R   S++    
Sbjct: 453 YYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSS---- 508

Query: 444 AHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNP 503
              N Q++DYLKH E+M+LP+F+EN +LQ +  +YF +KFG+DF GN+ FDT+ MF QN 
Sbjct: 509 ---NVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNL 565

Query: 504 ESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSEATETSS 563
           ES+++YFRH+P FA++ +LQ++G+GN  N FALL++               +S+    + 
Sbjct: 566 ESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNM 625

Query: 564 YTDPFDVQISSE------SYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVL 617
             D    Q+S         YF +++ ++  F  +P N++IW+ SL + N T I C + VL
Sbjct: 626 SIDTLSFQVSGNEIHDVGEYFNSLENIDKEFT-LPPNVDIWIQSLQYTNTTGIFCGMMVL 684

Query: 618 TKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNV 677
            KFL  P V ALPH L W++F++++  K+E +       FW  F+RR  PWN+I+   NV
Sbjct: 685 QKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNV 744

Query: 678 LVCYMLDNLH--PFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIK-KCD 734
           L+ ++ DN      + +  E +  L LD+++  ++ENE LPE+W CWG+LWFD IK K +
Sbjct: 745 LIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSE 804

Query: 735 V----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGLK 790
                ++  G++D  F D+P DGIVFDE+D+ G KFW R+ R + L KG A+KF D GL+
Sbjct: 805 TSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLR 863

Query: 791 V-------SFQASVFCRRNDIPP-DYFLK-NLTFKXXXXXXXXXXXXXXXXXXXXTIEIN 841
           +       S + ++F ++ +    D+  K + T+                      +   
Sbjct: 864 LTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAF 923

Query: 842 EEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW---SN 898
           E I   N+   A P LSV+ GESIF+Y GY +L P Y+ +DKNG  N   IYS W   + 
Sbjct: 924 ESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQ 983

Query: 899 VGNGV 903
           +GNG+
Sbjct: 984 LGNGL 988

 Score =  212 bits (540), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 142/199 (71%), Gaps = 26/199 (13%)

Query: 946  TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVIT 1005
            + YF+ DAT+WLRHFAHI+K+A +  L F ICLTTFQELR+LR S+D+ V+EAATR+VI 
Sbjct: 1084 STYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIV 1143

Query: 1006 IRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR------- 1058
            IR LY  KK+IP+RF G IA+H+EE+LEFEEQITW++HV+EFVI+A+AK  +        
Sbjct: 1144 IRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELH 1203

Query: 1059 -------FQAERL----TDENKNKG--------KEFAVLVTDDDNMNQKAKDRMIKTCNT 1099
                   F AE +    + + K +G        K  +VLVTDD NM+ KAK+R I+TC+T
Sbjct: 1204 NESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCST 1263

Query: 1100 KYLFSLGSKLGINSGLCTN 1118
            +++FS+ S+LG+  G+CTN
Sbjct: 1264 RFIFSICSQLGMKYGICTN 1282

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  452 bits (1162), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/378 (60%), Positives = 285/378 (75%), Gaps = 50/378 (13%)

Query: 205 QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264
           Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IY++N +LI NYINFI  A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 265 LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324
           LL TQ  NDL +G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFI + FI+
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 325 VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384
           +S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 385 YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444
           YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++G+       
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 628

Query: 445 HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG-------------------- 484
           HRN QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG                    
Sbjct: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688

Query: 485 -----------------------KDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQL 521
                                  + F   D+F  +DMF QNP+ L+Y+FRH+  FA+S +
Sbjct: 689 NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748

Query: 522 LQLIGFGNPKNPFALLFQ 539
           LQL+GFG+PKNPFALLF+
Sbjct: 749 LQLVGFGDPKNPFALLFE 766

 Score =  413 bits (1062), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 231/591 (39%), Positives = 326/591 (55%), Gaps = 95/591 (16%)

Query: 572  ISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPH 631
            I  E +F+NID L   +  IP  + IWL+SL +IN+ S++CSI VL KFL+ P+++ALPH
Sbjct: 863  ILCEEFFENIDLLQFPY-KIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPH 921

Query: 632  FLTWLHFIVAILKKLE-MVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCYMLDNLHP-- 688
             LTW+HFI++IL K+E  +   Q   FW  FL+  +PWNSIV   NVL+ Y+LDN++   
Sbjct: 922  LLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN 981

Query: 689  -----FLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKKCDV-------- 735
                  L  +     S  L+++++++N+NENLPEIWKCWGTLWFD I   ++        
Sbjct: 982  FKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLN 1041

Query: 736  ---------------------------MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWM 768
                                       +   G++DH   D PLDGI F   DE G  F+ 
Sbjct: 1042 QNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYK 1101

Query: 769  RSVRAVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKXXXXXXXXXXXX 828
            RS+R + L K + + FP+LGLK+S + S +CR   IP ++ L N  FK            
Sbjct: 1102 RSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII 1161

Query: 829  XXXXXXXXT----------------------IEINEEIEAVNMDPQATPNLSVVSG-ESI 865
                                            +I+E IE +N++ Q  P LS++ G E+I
Sbjct: 1162 PQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221

Query: 866  FEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-----------------SNVGNGVTLDVS 908
            F Y GY RL  +   F +NG   S  IYS W                  ++ N  T+   
Sbjct: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNE 1281

Query: 909  GESIYDVANNNLSL-HWEKIFFD-KIAAASKGSDENYNCTL---------YFVIDATSWL 957
              ++ D+   + S   + K+ F  K++  S  S       +         +FV DATSWL
Sbjct: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWL 1341

Query: 958  RHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIP 1017
            RHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD  VVEA+TR++IT+RQLY E K++P
Sbjct: 1342 RHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLP 1401

Query: 1018 MRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDEN 1068
            +RFTGN+AT +EE+LEFEEQITW++HVDEFVI+AI +  +RF+ + + + N
Sbjct: 1402 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN 1452

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 60/154 (38%), Gaps = 47/154 (30%)

Query: 22  NNNHTHIVSDM-RPTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIVDPVGK-------- 72
           NNN T+ + ++ RP        KRHSS+S+N+     F KRR+     P+          
Sbjct: 68  NNNITNSIGNIARP--------KRHSSNSYNNYKTIPFTKRRIAACT-PININNNNDNYN 118

Query: 73  -------------------GFIDGI---------TNSQISAQNTPSKTDDASRRPS-ISR 103
                               FID +         TN    AQ TPSK    SRRPS I R
Sbjct: 119 NNENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIR 178

Query: 104 KVMESTPQVKTSSIPTMDVPKSPYYVNRTMLARN 137
           K  +   Q   ++  T+  P +   VN T  A N
Sbjct: 179 KQQQQQQQSHFTTATTIKSPSNHTSVNITPQASN 212

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  405 bits (1041), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/407 (51%), Positives = 275/407 (67%), Gaps = 69/407 (16%)

Query: 202 QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261
           + NQ  I+KLQ IYK+IV QE ELQ +C  L+TSQ+T+LK LW+IY+LN +LI NYI FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 262 ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321
           +T+L  +Q IND ++G+EIL+IY+IE+RLW+YG ITFLD+LKNF+NFMDPE+  QFI + 
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 322 FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381
           F S+SNM+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  G
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 382 KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441
           KLYYHI+TVQQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R+S S+++N
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 442 EIAH-------------RNSQ---LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGK 485
                            +N Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF + FGK
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 486 ----------------------------------------------------DFNGNDVF 493
                                                                 N  ++F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 494 DTKDMFCQ-NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 539
           + +++F Q N + L+Y+F+++  FAES +LQLIGFG+PKNPFALLFQ
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQ 670

 Score =  222 bits (566), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 138/329 (41%), Positives = 182/329 (55%), Gaps = 71/329 (21%)

Query: 848  NMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY-----------SQW 896
            N D    P LS++  ES+FEY GY R  PD+  FDKNG   S  +Y           S  
Sbjct: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSSN 1216

Query: 897  SNVGNGVTL------------------DVSGESIYDVANNNLSLHWEKIFFDKIAAASKG 938
            +N+ N  T                     S  S  ++ N  L L  ++IF   +    K 
Sbjct: 1217 ANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKN 1276

Query: 939  SDENYNCTL-----------YFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYL 987
             DE +   +           YFV+DATSWLRHFAH++KLA N  LKFAICLTTFQELR+L
Sbjct: 1277 IDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFL 1336

Query: 988  RGSKDDTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEF 1047
            R SKD+ V+EAATR++IT+RQLY EK+++P+RFTGNIATH+EE+LEFEEQITW++HVDEF
Sbjct: 1337 RKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1396

Query: 1048 VIDAIAKLNQRFQAERLTDENKNKGKEFA-----------------------VLVTDDDN 1084
            VI+AI    +R Q +R  + N+      +                       VLVTDD +
Sbjct: 1397 VIEAI----KRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDDIS 1452

Query: 1085 MNQKAK----DRMIKTCNTKYLFSLGSKL 1109
            M +K +    D  I T +TK++FSL + L
Sbjct: 1453 MIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  202 bits (513), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 158/255 (61%), Gaps = 11/255 (4%)

Query: 572  ISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPH 631
            +S + +F N+++L  SF  +P +L IW +SL +IN+ S+ CSI VL KFL+ PL V+LPH
Sbjct: 786  LSPQDFFNNLESLKLSF-FLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPH 844

Query: 632  FLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCYMLDNLH--PF 689
             L W +FI+++  ++E + + +   FW+ F+R+  PWNSIV+  NV++  +LDN +    
Sbjct: 845  MLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSM 904

Query: 690  LKKELEKFYSLELDDLIEYYNENE-NLPEIWKCWGTLWFDAIKKC------DVMEIPGVQ 742
            + K +  + +  LD+L+  +NENE  LPE+WKC+G+LWFD I +       D  +   ++
Sbjct: 905  ITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMK 964

Query: 743  DHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDL-GLKVSFQASVFCRR 801
            D    + P+DG+ FDE +E G  FW RS R + L K +  +F    GL +S   SV+C R
Sbjct: 965  DTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNR 1024

Query: 802  NDIPPDYFLKNLTFK 816
            +DIP ++ L+   FK
Sbjct: 1025 SDIPNNHILRTFAFK 1039

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  156 bits (394), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 200/938 (21%), Positives = 379/938 (40%), Gaps = 166/938 (17%)

Query: 227  QRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRI 286
            Q  L+L  ++      L  +++L+T+++  Y  FI  AL       DLI G+E +   R+
Sbjct: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187

Query: 287  EKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFIIYAFISVSNMLEDIPLKY 336
             +RL  + +   L++++N+ N M          + +   +FI    I +++MLE+IPLK+
Sbjct: 188  NERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKF 247

Query: 337  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 382
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307

Query: 383  -LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441
              Y++++ VQ +SL   V L K +  ++     +   QL I+ I         +   N  
Sbjct: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL----NKQVNLK 363

Query: 442  EIAHRNSQLIDYLKHTEVMLLPSFLENMD-LQHVVLMYFKDKFGKDFNGNDVFDTKDMFC 500
            +     + L+ Y     +    +    +  ++   L YF ++F  +++ N     K + C
Sbjct: 364  QSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423

Query: 501  QNPES----LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRS 556
            +  +       +YF +AP F+   +++ I      NPF  +++                 
Sbjct: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKS---------------- 467

Query: 557  EATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV 616
                    +D F+++                      +L+ W   +  ++ T +  +  +
Sbjct: 468  --------SDDFEIK--------------------SVSLSNWKILIEQMDDTLLHSNKLL 499

Query: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN 676
              KFL   + ++ P  L WL F +++  ++  V  + V+  W   L+  +PW+ IVT  N
Sbjct: 500  FKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLN 559

Query: 677  VLVCYMLDNLHPF----LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDA--- 729
              +  +  N H      L+  ++   S  L DL+ Y     N  EI  C G +WFD+   
Sbjct: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617

Query: 730  -IKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLG 788
             IK+  +     +     +++  D +++D+ D+V  K W R++  +LL+K +   +P+L 
Sbjct: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPEL- 676

Query: 789  LKVSFQASVF----CRRN--DIPPDYFLKNLTFKXXXXXXXXXXXXXXXXXXXXTIEINE 842
            + VS +        C +N   +  DY                              E+N 
Sbjct: 677  IDVSIRGQSLTNSSCIKNSDSLTNDYLFD------------------------WGFELNN 712

Query: 843  EIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNG 902
               AV +D       ++     IF+++      PD+  FDKNG     + YS  SN    
Sbjct: 713  N-NAVIIDD------TLHGRNRIFKFS----YIPDFQDFDKNGDI--TWGYSLISNYDYI 759

Query: 903  VTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTL---YFVIDATSWLRH 959
             + D + E      + N    + +         S+   + Y   L   YF++D  +WL+H
Sbjct: 760  YSNDFNSEE-----DGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKH 814

Query: 960  FAHIFKLAKNNTLKFAICLTTFQELRYLRG-SKDDTVVEAATRSVITIRQLYDEKKIIPM 1018
               + +      +K  + ++   +L  L+  S+ ++V  +A+R +I I  LY   +I  +
Sbjct: 815  SNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINIL 874

Query: 1019 RFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEF--- 1075
            +             EFE  I+    +       I   N +F+ + LT EN   G++    
Sbjct: 875  K-------------EFESPIS--KALKNIDGSQILNFNGKFKNDLLTKEN-GPGQQLNMI 918

Query: 1076 ------AVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107
                   V+V+DD       K +     +TK LFS+ S
Sbjct: 919  ELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>YML075C Chr13 complement(115734..118898) [3165 bp, 1054 aa] {ON}
           HMG1One of two isozymes of HMG-CoA reductase that
           catalyzes the conversion of HMG-CoA to mevalonate, which
           is a rate-limiting step in sterol biosynthesis;
           localizes to the nuclear envelope; overproduction
           induces the formation of karmellae
          Length = 1054

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 47/117 (40%), Gaps = 14/117 (11%)

Query: 559 TETSSYTDPFDVQISSESYFQNIDALNSSFNDI-PTNLNIWLDSLNHINMTS-------- 609
           +E  +  DPFDV I   +Y      +   FND+  T  N WL +   +N  S        
Sbjct: 179 SENVTQADPFDVLIMVTAYLMMFYTIFGLFNDMRKTGSNFWLSASTVVNSASSLFLALYV 238

Query: 610 IQC----SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVN-SKQVVAFWIHF 661
            QC     +  LT F   P +V +  F   +      L+K E V  SK++    I F
Sbjct: 239 TQCILGKEVSALTLFEGLPFIVVVVGFKHKIKIAQYALEKFERVGLSKRITTDEIVF 295

>Suva_13.77 Chr13 complement(117204..120371) [3168 bp, 1055 aa] {ON}
           YML075C (REAL)
          Length = 1055

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 45/110 (40%), Gaps = 14/110 (12%)

Query: 566 DPFDVQISSESYFQNIDALNSSFNDI-PTNLNIWLDSLNHINMTS--------IQC---- 612
           DPFDV I   +YF     +   FND+  T  N WL +   +N  S         QC    
Sbjct: 186 DPFDVLIIVTAYFMMFYTIFGLFNDMRKTGSNFWLSASTVVNSASSLFLALYVTQCVLGK 245

Query: 613 SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVN-SKQVVAFWIHF 661
            +  LT F   P +V +  F   +      L+K E V  SK++    I F
Sbjct: 246 EVSALTLFEGLPFIVVVVGFKHKVKIAQYALEKFERVGLSKRITTDEIIF 295

>ADL298C Chr4 complement(174374..178804) [4431 bp, 1476 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL034C
           (STU1)
          Length = 1476

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 60/118 (50%), Gaps = 6/118 (5%)

Query: 194 MIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTEL 253
           +I+++   QP +    +++++ +++++QE +LQ+R ++      + +KSL AIY    + 
Sbjct: 74  LIKRVAMQQPGRFQGARIRDLVRVVLLQE-QLQERKVW-----GSAVKSLEAIYLCKPQA 127

Query: 254 IKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDP 311
            +  +  I  A   +     L+   E++ + ++  R  +  +  F+D+  +  N  DP
Sbjct: 128 FEAELASICAATRGSDRTKCLLFMDELIQLQQMNNRNPMEVVNRFVDLWVDVLNESDP 185

>TDEL0F04710 Chr6 (885854..887347) [1494 bp, 497 aa] {ON} Anc_8.347
           YLR141W
          Length = 497

 Score = 32.0 bits (71), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 71/166 (42%), Gaps = 17/166 (10%)

Query: 645 KLEMVNSKQVVAFWIHFLRRT--MPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLEL 702
           K E++   +V+   ++ L+R+    +  I++   + + Y +D      ++E+     LE 
Sbjct: 134 KFEIMVYYKVLQDNLNLLKRSDMKRFGGILSRTELPIAYEMDEFFIDFEEEMSARIRLEA 193

Query: 703 DDLIEYYNENENLPEIWKCWGTLWFDAIKKCDVMEI-PGVQDHLFFDSPLDGIVFDEKDE 761
           D       E++ L  + + W   W     +  + E+ P  ++ L F    D IVF  K  
Sbjct: 194 DKKYTEEEESDGLISL-ENWNKRWLPIYSRTAIEELSPVCKEPLPFSQ--DAIVFLTK-- 248

Query: 762 VGEKFWMRSVRAVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPD 807
              K + + V    LL G+ K        VS   ++FC + D+P D
Sbjct: 249 -CCKDYTKRVLTSALLNGLEK--------VSVPTAMFCEKEDLPND 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,840,168
Number of extensions: 5525254
Number of successful extensions: 18933
Number of sequences better than 10.0: 74
Number of HSP's gapped: 19315
Number of HSP's successfully gapped: 103
Length of query: 1118
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 998
Effective length of database: 39,721,479
Effective search space: 39642036042
Effective search space used: 39642036042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)