Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL150C (MCM10)5.703ON57157128850.0
Smik_9.195.703ON57257225500.0
Suva_9.385.703ON56957124760.0
Skud_9.185.703ON57157124120.0
NCAS0G002205.703ON59259816070.0
KAFR0D022105.703ON58458714980.0
TDEL0B021705.703ON56757614740.0
Kpol_1043.715.703ON58558714140.0
ZYRO0G06578g5.703ON56957914070.0
NDAI0F002805.703ON61061213990.0
KNAG0L021505.703ON61661613950.0
CAGL0H06589g5.703ON58359613660.0
TPHA0E002105.703ON54455412911e-172
TBLA0G010205.703ON59460012861e-171
SAKL0E14938g5.703ON57458711741e-154
KLTH0E01034g5.703ON58358811681e-153
Kwal_55.196915.703ON46647410171e-132
AFR287W5.703ON6116149881e-126
KLLA0A00572g5.703ON5775909401e-119
NCAS0H010906.173ON460159890.035
CAGL0D04994g3.479ON692182880.053
Ecym_64102.86ON48779850.11
KAFR0B060308.372ON238144810.22
SAKL0H14234g8.372ON249147810.22
ZYRO0B01320g2.503ON268162800.32
KAFR0H021808.346ON698203810.36
KLTH0E08118g4.120ON624155800.47
YNL167C (SKO1)2.86ON64749800.47
TBLA0E030806.42ON68973800.48
NCAS0G020002.86ON551171790.59
CAGL0K05555g5.687ON230169770.65
TBLA0H003002.409ON1275113771.2
Smik_6.298.4ON714110761.4
ZYRO0F16368g1.96ON344274751.5
YJL049W1.334ON45090751.7
NCAS0I029301.163ON848228751.9
TBLA0B07220singletonON987114752.0
NDAI0E018302.409ON1270137752.0
KLLA0F06116gna 1ON1285145752.0
NCAS0J006508.85ON32899732.6
Kthe_YGOB_CWC158.345ON23179722.7
NCAS0C058404.17ON267121723.0
Suva_14.1712.86ON65249733.2
Skud_2.3008.587ON751147733.3
CAGL0F02255g8.95ON14671693.9
Skud_14.1642.86ON64950724.2
ABL180W2.29ON681146724.3
YFL047W (RGD2)8.4ON714110724.3
KNAG0D025508.78ON1233133724.6
NCAS0A041102.409ON124791724.6
KNAG0A060202.409ON125281724.6
NCAS0C027308.423ON77544664.7
TBLA0D053301.294ON1493109724.7
Ecym_20966.322ON46879715.1
Suva_14.1172.16ON58176715.4
Kwal_56.226463.100ON68046715.6
SAKL0C09746g3.100ON72148715.7
TBLA0E035802.202ON1218117716.0
CAGL0J01892g7.160ON137488716.1
YLR086W (SMC4)8.259ON1418143716.1
ZYRO0G21318g1.294ON1454160716.1
TPHA0F004004.50ON191754716.3
TBLA0B048708.85ON46999706.8
SAKL0A00352g6.378ON490174706.9
Kwal_27.11814singletonOFF25780696.9
YJR002W (MPP10)5.221ON593178707.2
NDAI0D010502.247ON625147707.3
SAKL0G15818g4.268ON647218707.3
Kpol_1025.484.96ON710130707.4
TBLA0D032208.834ON1139133707.9
NDAI0F015006.234ON118374707.9
Smik_13.3262.409ON1263156708.0
Skud_13.2882.409ON1272156708.0
TDEL0H037707.74ON131247708.0
NDAI0G009503.490ON213166688.0
CAGL0L04708g3.456ON41973618.1
Suva_10.5464.310ON2223157708.3
Smik_15.3858.609ON470155698.9
Skud_14.2082.146ON484129699.0
TPHA0C032202.261ON255124689.2
Smik_14.1602.86ON65049699.6
Kpol_1056.49singletonON28072689.7
TBLA0E040608.604ON804114699.9
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= YIL150C
         (1716 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...  1115   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   986   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   958   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   933   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   623   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   581   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   572   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   549   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   546   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   543   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   541   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   530   0.0  
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   501   e-172
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   499   e-171
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   456   e-154
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   454   e-153
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   396   e-132
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   385   e-126
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   366   e-119
NCAS0H01090 Chr8 complement(205335..206717) [1383 bp, 460 aa] {O...    39   0.035
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    39   0.053
Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar t...    37   0.11 
KAFR0B06030 Chr2 (1247049..1247765) [717 bp, 238 aa] {ON} Anc_8....    36   0.22 
SAKL0H14234g Chr8 complement(1216484..1217191,1217259..1217300) ...    36   0.22 
ZYRO0B01320g Chr2 (111463..112269) [807 bp, 268 aa] {ON} highly ...    35   0.32 
KAFR0H02180 Chr8 (414111..416207) [2097 bp, 698 aa] {ON} Anc_8.3...    36   0.36 
KLTH0E08118g Chr5 (745621..747495) [1875 bp, 624 aa] {ON} simila...    35   0.47 
YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON} ...    35   0.47 
TBLA0E03080 Chr5 (774631..776700) [2070 bp, 689 aa] {ON} Anc_6.4...    35   0.48 
NCAS0G02000 Chr7 complement(360567..362222) [1656 bp, 551 aa] {O...    35   0.59 
CAGL0K05555g Chr11 (543605..544297) [693 bp, 230 aa] {ON} simila...    34   0.65 
TBLA0H00300 Chr8 complement(51145..54972) [3828 bp, 1275 aa] {ON...    34   1.2  
Smik_6.29 Chr6 (55868..58012) [2145 bp, 714 aa] {ON} YFL047W (REAL)    34   1.4  
ZYRO0F16368g Chr6 complement(1342457..1343491) [1035 bp, 344 aa]...    33   1.5  
YJL049W Chr10 (345973..347325) [1353 bp, 450 aa] {ON} Putative p...    33   1.7  
NCAS0I02930 Chr9 (541697..544243) [2547 bp, 848 aa] {ON} Anc_1.1...    33   1.9  
TBLA0B07220 Chr2 complement(1707881..1710844) [2964 bp, 987 aa] ...    33   2.0  
NDAI0E01830 Chr5 complement(363691..367503) [3813 bp, 1270 aa] {...    33   2.0  
KLLA0F06116g Chr6 (592103..595960) [3858 bp, 1285 aa] {ON} conse...    33   2.0  
NCAS0J00650 Chr10 (99780..100766) [987 bp, 328 aa] {ON} Anc_8.85       33   2.6  
Kthe_YGOB_CWC15 Chr7 complement(983375..984070) [696 bp, 231 aa]...    32   2.7  
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    32   3.0  
Suva_14.171 Chr14 complement(315525..317483) [1959 bp, 652 aa] {...    33   3.2  
Skud_2.300 Chr2 complement(546556..548811) [2256 bp, 751 aa] {ON...    33   3.3  
CAGL0F02255g Chr6 (221723..222163) [441 bp, 146 aa] {ON} similar...    31   3.9  
Skud_14.164 Chr14 complement(310167..312116) [1950 bp, 649 aa] {...    32   4.2  
ABL180W Chr2 (66980..69025) [2046 bp, 681 aa] {ON} Syntenic homo...    32   4.3  
YFL047W Chr6 (40421..42565) [2145 bp, 714 aa] {ON}  RGD2GTPase-a...    32   4.3  
KNAG0D02550 Chr4 complement(446875..450576) [3702 bp, 1233 aa] {...    32   4.6  
NCAS0A04110 Chr1 complement(829352..833095) [3744 bp, 1247 aa] {...    32   4.6  
KNAG0A06020 Chr1 complement(905792..909550) [3759 bp, 1252 aa] {...    32   4.6  
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     30   4.7  
TBLA0D05330 Chr4 complement(1306412..1310893) [4482 bp, 1493 aa]...    32   4.7  
Ecym_2096 Chr2 complement(172230..173636) [1407 bp, 468 aa] {ON}...    32   5.1  
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    32   5.4  
Kwal_56.22646 s56 complement(218373..220415) [2043 bp, 680 aa] {...    32   5.6  
SAKL0C09746g Chr3 (880534..882699) [2166 bp, 721 aa] {ON} weakly...    32   5.7  
TBLA0E03580 Chr5 (897438..901094) [3657 bp, 1218 aa] {ON} Anc_2....    32   6.0  
CAGL0J01892g Chr10 (187614..191738) [4125 bp, 1374 aa] {ON} simi...    32   6.1  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...    32   6.1  
ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa...    32   6.1  
TPHA0F00400 Chr6 (91892..97645) [5754 bp, 1917 aa] {ON} Anc_4.50...    32   6.3  
TBLA0B04870 Chr2 (1146824..1148233) [1410 bp, 469 aa] {ON} Anc_8...    32   6.8  
SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON...    32   6.9  
Kwal_27.11814 s27 complement(955243..956016) [774 bp, 257 aa] {O...    31   6.9  
YJR002W Chr10 (438865..440646) [1782 bp, 593 aa] {ON}  MPP10Comp...    32   7.2  
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    32   7.3  
SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} simi...    32   7.3  
Kpol_1025.48 s1025 complement(124224..126356) [2133 bp, 710 aa] ...    32   7.4  
TBLA0D03220 Chr4 complement(785837..789256) [3420 bp, 1139 aa] {...    32   7.9  
NDAI0F01500 Chr6 complement(369071..372622) [3552 bp, 1183 aa] {...    32   7.9  
Smik_13.326 Chr13 (506186..509977) [3792 bp, 1263 aa] {ON} YMR12...    32   8.0  
Skud_13.288 Chr13 (497303..501121) [3819 bp, 1272 aa] {ON} YMR12...    32   8.0  
TDEL0H03770 Chr8 (632675..636613) [3939 bp, 1312 aa] {ON} Anc_7....    32   8.0  
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    31   8.0  
CAGL0L04708g Chr12 (541185..542444) [1260 bp, 419 aa] {ON} simil...    28   8.1  
Suva_10.546 Chr10 (948276..954947) [6672 bp, 2223 aa] {ON} YLR43...    32   8.3  
Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {...    31   8.9  
Skud_14.208 Chr14 (383074..384528) [1455 bp, 484 aa] {ON} YNL124...    31   9.0  
TPHA0C03220 Chr3 complement(707955..708705,708802..708818) [768 ...    31   9.2  
Smik_14.160 Chr14 complement(298499..300451) [1953 bp, 650 aa] {...    31   9.6  
Kpol_1056.49 s1056 complement(123255..124097) [843 bp, 280 aa] {...    31   9.7  
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    31   9.9  

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
            MCM10Essential chromatin-associated protein involved in
            the initiation of DNA replication; required for the
            association of the MCM2-7 complex with replication
            origins
          Length = 571

 Score = 1115 bits (2885), Expect = 0.0
 Identities = 556/571 (97%), Positives = 556/571 (97%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA
Sbjct: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 181  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 360
            IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA
Sbjct: 61   IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 361  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 540
            KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH
Sbjct: 121  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 541  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 721  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 901  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1081 KVDSQPSLYKAKGENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDM 1260
            KVDSQPSLYKAKGENGFNIIKGT               HNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361  KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 1261 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 1440
            LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI
Sbjct: 421  LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 1441 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 1621 RSHREEVWQKHFGSKETKETSDGSASDLEII 1713
            RSHREEVWQKHFGSKETKETSDGSASDLEII
Sbjct: 541  RSHREEVWQKHFGSKETKETSDGSASDLEII 571

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
            YIL150C (REAL)
          Length = 572

 Score =  986 bits (2550), Expect = 0.0
 Identities = 488/572 (85%), Positives = 520/572 (90%), Gaps = 1/572 (0%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            M+DPREILAVDPYN++TSDEEDEQAIA+ELEFMERKRQAL+ERLKRKQ FKKP DPNFEA
Sbjct: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 181  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 360
            IEVPQSPTK+RVK GS NA +Q T+ E SN NE  LSQ+Q+QP+ P +TTTYFM+KFQNA
Sbjct: 61   IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 361  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 540
            KK+ED+QIAKFESMM+ARVHTF TD KKY PII NELE FSNLWVKKRYIPEDDLKR+LH
Sbjct: 121  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 541  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRLGKLFAK+RPPKFQ PEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 721  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            TLDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 901  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVN KTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1081 KVDSQPSLYKAKGENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDM 1260
            KV+SQPSLYKAKGEN FNII+                 HNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361  KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 1261 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 1440
            LANLDNKRRKI +TKKS AL+REL KIMRR+ESSGLEDKS GE+QKMK+TTE+ALQTGLI
Sbjct: 421  LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 1441 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHG+IS+VLKSSV G E KNNLL  KKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 1621 RSHREEVWQKHFGSK-ETKETSDGSASDLEII 1713
            R+HREEVWQ+HFG K E +E SD SASDLEII
Sbjct: 541  RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
            YIL150C (REAL)
          Length = 569

 Score =  958 bits (2476), Expect = 0.0
 Identities = 472/571 (82%), Positives = 511/571 (89%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            M+DPREILAVDPYNN+TSDEEDEQAIA+ELEFMERK+QAL+ERLKRKQ+FKKP+DPNFEA
Sbjct: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 181  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 360
            +EVPQSP K  +   S +A +Q  +   SNINE  LSQ  Q+   P++TTTYFM+KFQ+A
Sbjct: 61   VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES--PSNTTTYFMQKFQDA 118

Query: 361  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 540
            K+NEDKQIAK+E MMNARVHTF TD K+Y PIITNELESFSNLWVKKRYIPE+DLKRALH
Sbjct: 119  KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178

Query: 541  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRL KLFAKIRPPKFQEP+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 179  EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238

Query: 721  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            +LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 239  SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298

Query: 901  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVNKKTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 299  GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358

Query: 1081 KVDSQPSLYKAKGENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDM 1260
            KVDSQPSLY+AKGEN FNI++ T               HNFTNSNSAKAFFDEKFQNPDM
Sbjct: 359  KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418

Query: 1261 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 1440
            LANLD+KRRKII+TKKSTALSRELGKIMRR++SSGLEDKS GE+QKMK+TTESALQTGLI
Sbjct: 419  LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478

Query: 1441 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHGKIS+VLKSSV G E   N +  KKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 479  QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538

Query: 1621 RSHREEVWQKHFGSKETKETSDGSASDLEII 1713
            RSHREEVWQ+HFGSKET+  SD S SDLEI+
Sbjct: 539  RSHREEVWQRHFGSKETEVASDASGSDLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
            YIL150C (REAL)
          Length = 571

 Score =  933 bits (2412), Expect = 0.0
 Identities = 452/571 (79%), Positives = 508/571 (88%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            M+DPRE L  DPYNN+TSDE+DEQ IA+ELEFMERK+QALVERLKRKQEFK+ +DPNFEA
Sbjct: 1    MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 181  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 360
            IEVPQSP KNR  + S N  ++  +   SNIN+++LSQLQQ+ + P++TT YFM+KFQNA
Sbjct: 61   IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 361  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 540
            K+NE+KQ AK+E+MMNARVHTF TD+K+Y   I NELE FSN+WVKKRYIPEDDLKRALH
Sbjct: 121  KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 541  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRLGKLFAKIRPPKFQEP+YANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 721  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            TLDVYIFGKK VERYYNLRLGDVIAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 901  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVN+K ++ CGSPINI+LHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1081 KVDSQPSLYKAKGENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDM 1260
            KVD+QP+LY+AKGEN FN+++                 HNF NSNSAKAFFDEKFQNPDM
Sbjct: 361  KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 1261 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 1440
            LANLD+KRRKII++KKSTALSRELGKIMRR+ SSGLEDK   E+QK+K+TTESALQTGL+
Sbjct: 421  LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 1441 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHGKIS+VLKSSV G EP+N ++G KKTVI+DLL+YKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 1621 RSHREEVWQKHFGSKETKETSDGSASDLEII 1713
            RSHREEVWQKHFGSK+T E SD S SDLEI+
Sbjct: 541  RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
            Anc_5.703 YIL150C
          Length = 592

 Score =  623 bits (1607), Expect = 0.0
 Identities = 323/598 (54%), Positives = 423/598 (70%), Gaps = 27/598 (4%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            MNDPRE+L  DPY+N++SDE+DE+AI R+LE +ERKRQ L+ R+K KQE KK  DPNF+ 
Sbjct: 1    MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 181  IEVPQSP---TKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKF 351
            ++VP SP   T+  V V    +T +  +    N NE+R+ +   Q   P++TTTYFMEKF
Sbjct: 61   LQVPCSPVKKTETNVPVAMKKSTNE-MEIPHENPNELRIREKSGQL--PSNTTTYFMEKF 117

Query: 352  QNAKKNEDKQIAKFESMMNARVHTFSTD--EKKYVPIITNELESFSNLWVKKRYIPEDDL 525
            Q +KK E+ +I K E+MMNARVHTF     ++++ PI  NE+E +SN+W+KKRYIP+ +L
Sbjct: 118  QKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSEL 177

Query: 526  KRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 705
            ++ LH IKILRL KLFAK+RPPKF EP+Y+NWA +G+IS K D KFT+++KP K+  FT+
Sbjct: 178  RKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTM 237

Query: 706  TDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFK 885
            TDFQH LDVYIFGK GVERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDFK
Sbjct: 238  TDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFK 297

Query: 886  CILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYA 1065
            CILEIGSS+DLG+C  V  +    C +PIN+S    CDYH+E++FR  ++KRIELNG +A
Sbjct: 298  CILEIGSSKDLGFCK-VTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFA 356

Query: 1066 LGAPTKVDSQPSLYKAKG-------ENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAK 1224
            LGAPTKV++ P+LY+ K        +N  N                    H F+N+NSAK
Sbjct: 357  LGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRH-FSNNNSAK 415

Query: 1225 AFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMK 1404
            AFFDEKFQNPDML NL++KRRKI + KK T + +EL K +  R S  L ++S  E ++MK
Sbjct: 416  AFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMK 475

Query: 1405 RTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNL---LGKKKTVINDLLHYKK 1575
            R TE+ LQ+G+IQRLGFDPTHGKI+ VL+++ S  E K+ L   +  KK  +NDLLH++K
Sbjct: 476  RATETTLQSGVIQRLGFDPTHGKIANVLRTTHS-KEEKDTLSEQMSGKKDKVNDLLHFRK 534

Query: 1576 EKVILAPSKNEWFKKRSHREEVWQKHFGSK------------ETKETSDGSASDLEII 1713
              VILAP++NE  ++R  RE +WQ++FG K            E   +   S S+LEII
Sbjct: 535  SHVILAPTRNELIERRDRRERIWQENFGQKRKPISANDLLAIEGSSSDSSSDSELEII 592

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
            Anc_5.703 YIL150C
          Length = 584

 Score =  581 bits (1498), Expect = 0.0
 Identities = 297/587 (50%), Positives = 405/587 (68%), Gaps = 16/587 (2%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            M+DPREI   D Y NIT D+ED + I  ELE +E  ++ L+ERL RK+   + +DPNF  
Sbjct: 1    MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 181  IEVPQSPTKN---RVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPA------STTT 333
            ++VP SP K    ++        +   +FE SN N   L   Q+  K  A      ++T 
Sbjct: 61   VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 334  YFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKK--YVPIITNELESFSNLWVKKRY 507
            YFMEKF++AK+ E   I K ESMM +RVHTF+  E K  Y  +I +ELE +SNLW+ KRY
Sbjct: 121  YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 508  IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVK 687
             P  +LK  LHE+KILRL KLFAK+RPPKF+EP+Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 181  TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 688  FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLR 867
            +  FT+TDF+H +D YIFGK+GVERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 241  YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 868  ISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIE 1047
            ISH +KCILEIG SRDL  CPIV + T K+CG PIN  + +CC+YHRE++ R   +KR++
Sbjct: 301  ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 1048 LNGGYALGAPTKVDSQPSLYKAKGE-----NGFNIIKGTXXXXXXXXXXXXXXXHNFTNS 1212
            L+G YALGAPTK++SQP+LY+           F +                     F+N 
Sbjct: 361  LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 1213 NSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGER 1392
            N+AKAFFD++FQNPDM++NLDNKRRKI+E +KS  L+REL +++R+ +   LE K+  E 
Sbjct: 421  NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQD--LEGKTREEV 478

Query: 1393 QKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYK 1572
            +KMK+TT+  LQ+GL Q++GFDPT GKIS++LK+     + +   L +K   ++DL+ +K
Sbjct: 479  EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538

Query: 1573 KEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 1713
            KE +ILAPSK +   K++ RE+VWQ++FG  ++ + S+ S SDLEI+
Sbjct: 539  KEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSE-SDSDLEIV 584

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
            Anc_5.703 YIL150C
          Length = 567

 Score =  572 bits (1474), Expect = 0.0
 Identities = 287/576 (49%), Positives = 399/576 (69%), Gaps = 5/576 (0%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            MNDPRE++  DP+  +TSDEED++ +  ++  +ER+++ LVERLK K++ K  +DPNF+A
Sbjct: 1    MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59

Query: 181  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 360
            I+V  SP K   +      ++     +  N+NE    +++ + + PA+TT+YF++ F+N+
Sbjct: 60   IQVESSPVKKPAESIKVEPSRTKRVLDIENLNE---KKVESRSQIPANTTSYFIDNFRNS 116

Query: 361  KKNEDKQIAKFESMMNARVHTFS--TDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRA 534
            KK E K   + + +++ RVHTF       K+  +   E+E +S+LWVK+RYI +DDL++ 
Sbjct: 117  KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 535  LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 714
            LHE+KILRL KLFAKI+PPKF EP+Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177  LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 715  QHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 894
            Q+ LDVY+FGKKGVERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237  QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 895  EIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 1074
            EIG SRD+ WC   NK  +K CG+PIN +  KCCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297  EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 1075 PTKVDSQPSLYKAK---GENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAKAFFDEKF 1245
            PTKVDS P+LY+ K       F ++                   +F+N N+AKAFF+++F
Sbjct: 357  PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGI--HFSNGNAAKAFFNDEF 414

Query: 1246 QNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESAL 1425
            QNPD+L NLD+KRRK  + KKS  L ++L +I  R  +  +E K   + +++  TTE+ L
Sbjct: 415  QNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEATL 473

Query: 1426 QTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKN 1605
            Q+GLIQ LGFDPTHG+I  VLK +    +  N  L KK+  ++ LL +KKE V L P+K 
Sbjct: 474  QSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532

Query: 1606 EWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 1713
               +++  RE  WQ++FG K    +SD S SD+EI+
Sbjct: 533  VLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
            (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  549 bits (1414), Expect = 0.0
 Identities = 286/587 (48%), Positives = 396/587 (67%), Gaps = 16/587 (2%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            MNDPRE    D Y+N++SDE ++  I+ +L+ +ER++Q L+ERLK+K+E K   DPNF  
Sbjct: 1    MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 181  IEVPQSPTKNRVKV--GSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQ 354
            ++VP SP K+RV     +        + E  N NEV L     +      TT+YFMEKF 
Sbjct: 59   VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVAL---MTKDDSNYGTTSYFMEKFY 115

Query: 355  NAKKNEDKQIAKFESMMNARVHTFST--DEKKYVPIITNELESFSNLWVKKRYIPEDDLK 528
            N+KK+ ++++  + SMM++RVHTFS    +K++ P   +EL+ +SNLW++ RYIP D+L 
Sbjct: 116  NSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELN 175

Query: 529  RALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTIT 708
              L +IKILRL KLFAK+RPPKF EP+Y+NW   G+I+ K DIK+TSS KP K+F FTI+
Sbjct: 176  LMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTIS 235

Query: 709  DFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS----GRGNFIKSFNLRISH 876
            DFQH LDV+IFG KGVE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSFNLRISH
Sbjct: 236  DFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISH 295

Query: 877  DFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 1056
             F CILEIG+SRDLGWCPI N   +  C +PIN S    C YHRE+QFR T++ R+EL+G
Sbjct: 296  KFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSG 355

Query: 1057 GYALGAPTKVDSQPSLYKAKG-------ENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSN 1215
             YALGAPTKVD++P+LY+ +G       +  +N++  +               H+F+  N
Sbjct: 356  TYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMN 415

Query: 1216 SAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQ 1395
            SAKAFFDE FQNPD+L NLD+KRRKI    K + + R L K ++        DK     +
Sbjct: 416  SAKAFFDEDFQNPDILNNLDSKRRKI----KDSKMERNLVKALK-----NTVDKESKNFK 466

Query: 1396 KMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKK 1575
             +K  T++ LQTG++QRLGFDPT GK+S V+++S S +E  N    +KK  ++DL+ ++K
Sbjct: 467  NLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRK 526

Query: 1576 EKVILAPSKNEWFKKRSHREEVWQKHFGSKETK-ETSDGSASDLEII 1713
            + V L PSK++  K+R  R+  W+K FG +++  + +D S SDL+I+
Sbjct: 527  DTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
            similar to uniprot|P32354 Saccharomyces cerevisiae
            YIL150C MCM10 Essential chromatin-associated protein
            involved in the initiation of DNA replication required
            for the association of the MCM2-7 complex with
            replication origins
          Length = 569

 Score =  546 bits (1407), Expect = 0.0
 Identities = 281/579 (48%), Positives = 392/579 (67%), Gaps = 8/579 (1%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            M DPRE+L  D Y+ +TS+ E+E  I  ++  +ER+++ L++RL  K+   KP DPN   
Sbjct: 1    MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 181  IEVPQSPTKNRVKVGSHNATQQGTKFE--GSNINEVRLSQLQQQPKPPASTTTYFMEKFQ 354
            I+V  SP K    V      QQ  + E    N+NE++    Q Q + PA+TT++F+EK+ 
Sbjct: 61   IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKA---QSQEQIPANTTSFFIEKYS 117

Query: 355  NAKKNEDKQIAKFESMMNARVHTF--STDEKKYVPIITNELESFSNLWVKKRYIPEDDLK 528
             +K+ +D ++   E +++ RVHTF  +  + +Y PI TNELE FSNLW+ KRYIP+++ +
Sbjct: 118  TSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQR 177

Query: 529  RALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTIT 708
                 IKILRL KLFAK++PPKF EP Y+NWA +GLIS+K ++KFTS+  P K+F FT+T
Sbjct: 178  SIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLT 237

Query: 709  DFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKC 888
            +FQ+++D YIFGK+GVERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+C
Sbjct: 238  NFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFEC 297

Query: 889  ILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYAL 1068
            ILEIG+SRDLGWCP+ NK  ++ C +PIN     CC+YHRE++FR T+AKR+EL+G YAL
Sbjct: 298  ILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYAL 357

Query: 1069 GAPTKVDSQPSLYKAKGEN---GFNII-KGTXXXXXXXXXXXXXXXHNFTNSNSAKAFFD 1236
            GAPT++D+QP+LY+         +NII  G                 +F+N N+AKAFFD
Sbjct: 358  GAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFD 417

Query: 1237 EKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTE 1416
            E+FQNP+ L NL+NKRRK+ + +KS  L+REL    ++     ++ KS  E  ++KRTTE
Sbjct: 418  ERFQNPETLRNLENKRRKLRDNRKSNILNREL----KKNSELDIKHKSAEEIDEIKRTTE 473

Query: 1417 SALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAP 1596
            S + +G+++ LGFDPT GKI+ V K   S S+ K   L +K + +  LL +KK+ V L P
Sbjct: 474  STMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVASLLSFKKDNVKLKP 531

Query: 1597 SKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 1713
            SK    K++  RE VW++HFGS    +  D S SDLEI+
Sbjct: 532  SKEILIKQKRRRERVWKEHFGS--GGDEKDDSDSDLEIV 568

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
            Anc_5.703 YIL150C
          Length = 610

 Score =  543 bits (1399), Expect = 0.0
 Identities = 289/612 (47%), Positives = 399/612 (65%), Gaps = 41/612 (6%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            MNDPRE    DP+ +++  EE+E A+  ELE ++R++  L+ RLK  +E +K +DPNF+ 
Sbjct: 1    MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 181  IEVPQSPTKNRVKVGSHNAT-----------QQGTKFEGS---NINEVRLSQLQQQ-PKP 315
            +++P +P +    + +   T            +  +F G    N NE+++ + ++   K 
Sbjct: 61   VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 316  PASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK-------KYVPIITNELE 474
            P++TT+YFMEKFQ+ KK E+ +  + E M+ ARVH F    K       +Y P   NE+E
Sbjct: 121  PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 475  SFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSD 654
             +S L ++KRYIP+ +L      IKILRL KLFAK+RPPKF+EP+Y+NW T+G+I+ K  
Sbjct: 181  EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 655  IKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 834
            IKFTSS+KP K+F FTI+DF++ +D++IF K  VERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 241  IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 835  --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHK-KCGSPINISLHKCCDYH 1005
               G  IKSFNLRI+H++ CI+E+G S+DLG+CPI NK      C +PI+IS    C YH
Sbjct: 301  NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 1006 REVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKG--------ENGFNIIKGTXXXX 1161
            +E++FR   +KRIELNG +ALGAP KV +QP LY+            N FN++KG+    
Sbjct: 361  QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 1162 XXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKI 1341
                         F+++NSAKAFFDEKFQNPDML NLD KRRKI + K+S  L +EL K 
Sbjct: 421  NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 1342 MRRRESSGLE-DKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSV-SGSEP 1515
            +  + S+ L  +K+  E  KMK  TE+ LQTG+IQRLGFDPTHGKI++VL++   SG + 
Sbjct: 481  IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDN 540

Query: 1516 KNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS------KETKE 1677
             +N    K   + DLL +KK KV+LAP+K E  K+++ REEVWQKHFGS      +   +
Sbjct: 541  VHNT--HKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLND 598

Query: 1678 TSDGSASDLEII 1713
              D S SDLEI+
Sbjct: 599  DVDTSESDLEIV 610

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
            YIL150C
          Length = 616

 Score =  541 bits (1395), Expect = 0.0
 Identities = 284/616 (46%), Positives = 403/616 (65%), Gaps = 47/616 (7%)
 Frame = +1

Query: 7    DPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA-I 183
            DPR+++  DPY+NITSDE++E  I RELE MER+++ L +RLK K+   KP D N +  +
Sbjct: 4    DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 184  EVPQSPTKNRVK--------------VGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPA 321
            +VP SP K  V               +   N +      +  N+NE R +QL       +
Sbjct: 64   QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 322  --STTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWV 495
              +TT+YF+EKFQ +KK E  +I   E+M++ARVHTF   +K++     NELE FS+LW+
Sbjct: 124  VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183

Query: 496  KKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSE 675
             KRYIP+  L+ +L ++K+LRL KLFAK+RPPKFQEP+Y+NWA + +IS KS++KFT+S+
Sbjct: 184  SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243

Query: 676  KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG---RGNF 846
             P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GD++A+LNPE+LPWRPSG   +   
Sbjct: 244  NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303

Query: 847  IKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRG 1026
            IKSFNL+I+H FKCILEIG SRDLG+CP+  K +++KCGS IN++  + C+YHRE+Q R 
Sbjct: 304  IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363

Query: 1027 TSAKRIELNGGYALGAPTKVDSQPSLYK-AKG-------------------ENGFNIIKG 1146
             S+KR++LNGG+ALGAPTKV +QP L++ A G                   E  +N   G
Sbjct: 364  NSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSRHG 423

Query: 1147 TXXXXXXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSR 1326
                              FT+SN+AKAFFD++FQNPDML NLD KRRK+ ++KKS  L R
Sbjct: 424  QGGSSEENYGLKGKF---FTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR 480

Query: 1327 ELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLK--SSV 1500
            +L +++ + E     DK+  E   +KRTTE+AL TGLIQRLGFDPTHG+ + V+K   S 
Sbjct: 481  KLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540

Query: 1501 SGSEPKNNL-LGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK---- 1665
             GS    ++ L +K+ ++N+LL +K++K  L PS+ +   ++ HR EVW++ FG K    
Sbjct: 541  RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPV 600

Query: 1666 ETKETSDGSASDLEII 1713
            +++   +  + DLEI+
Sbjct: 601  DSQPVDNDDSDDLEIV 616

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar to
            uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  530 bits (1366), Expect = 0.0
 Identities = 282/596 (47%), Positives = 394/596 (66%), Gaps = 26/596 (4%)
 Frame = +1

Query: 4    NDPREILAVDPYNNITSDEEDEQA-IARELEFMERKRQALVERLK--RKQEFKKPQDPNF 174
            NDPRE+  +DPY +++ D++++++ I RELE +ERK+Q L+ RLK  +++   K  DPN 
Sbjct: 7    NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 175  EAI------EVPQSPTKNRVKVGS---HNATQ----QGTKFEGSNINEVRLSQLQQQPKP 315
            + I      EVP+SP +  +       HN  Q    Q    + +N NE     + ++   
Sbjct: 67   KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNE---EDIVRKELD 123

Query: 316  PASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTF--STDEKKYVPIITNELESFSNL 489
              +TT+YF  KF+N+K +E++ +  ++ MM+AR HTF  ST       I  +ELE +SN 
Sbjct: 124  VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183

Query: 490  WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 669
             +KKRYIP+D++ + LH IKILRL KLFAK+RPP F EP+Y+NW  +G IS K D+K T+
Sbjct: 184  HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243

Query: 670  SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 849
            + KPVK+F FT+TDF+H LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N I
Sbjct: 244  AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303

Query: 850  KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGT 1029
            KSFNLRI HDF CILEIG+SRDLGWC +VN    K C SPIN    +CC++HRE+Q R T
Sbjct: 304  KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363

Query: 1030 SAKRIELNGGYALGAPTKVDSQPSLYKAK--------GENGFNIIKGTXXXXXXXXXXXX 1185
            ++KRIEL+G YALGAPTKV +QPS+YK           ++    I G             
Sbjct: 364  ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKHE 423

Query: 1186 XXXHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSG 1365
               H+F+N  +AKAFFD+ FQ+P +LANL++KRRKI    K++ + R L K +   ++S 
Sbjct: 424  IEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDASQ 479

Query: 1366 LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 1545
             ++K     Q++K  TE  LQTG+IQRLGFDP+ G+I++VL  S  G++  +  + KK  
Sbjct: 480  SKNK-----QQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKS-RGTKTDDPTISKKMG 533

Query: 1546 VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 1713
            +INDL+H+KK+K+ L PS+    +KR  RE +W+KHF     ++T+D S SDLEI+
Sbjct: 534  LINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF-----QDTND-SDSDLEIV 583

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
            Anc_5.703 YIL150C
          Length = 544

 Score =  501 bits (1291), Expect = e-172
 Identities = 270/554 (48%), Positives = 355/554 (64%), Gaps = 23/554 (4%)
 Frame = +1

Query: 121  VERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSH-NATQQGTKFEGSNINEVRLSQL 297
            ++RLK K+E +K  DPNF  I++ +SP K +    +  N        E  N NE ++   
Sbjct: 1    MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVS- 59

Query: 298  QQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNEL 471
                  PA+TT+YFM+ F  AKK E KQ+ +++  M++RVH+F+     KKY  II  EL
Sbjct: 60   --NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117

Query: 472  ESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKS 651
            E +S   + KRY+P++++ + LH IKILRL KLFAKIRPPKF EP+YANWA  G+I  K 
Sbjct: 118  EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177

Query: 652  DIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 831
            DIK TSS+ PVKFF FTIT+FQHTLD++IFG  GVE+YYNLR+GD+I ILNPEVLPWRP 
Sbjct: 178  DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237

Query: 832  GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHRE 1011
             +GN IKSFNLRISH F CILEI  S+D+ WC  +N+KT  KC +PIN S    CDYH+E
Sbjct: 238  FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297

Query: 1012 VQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGE------NGFNIIKGTXXXXXXXX 1173
            +QFR  +AKR+EL+G YALGAPT++DS+P+LY++K        N FNI+           
Sbjct: 298  MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357

Query: 1174 XXXXXXXHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRR 1353
                   H+F++SNSAKAFFDE FQNPDML NL+NKRRKI + K+   L R L      R
Sbjct: 358  DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRAL------R 411

Query: 1354 ESSG-----LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPK 1518
            ES G     L+DKS  E Q M+ TT++ LQ G IQ+LGFDPT G+I  VL+ S   S  +
Sbjct: 412  ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKS-TQ 470

Query: 1519 NNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS---------KET 1671
            + L  +K   + +L+ +KK  V L PS+    +K  HRE+ + ++  S         K  
Sbjct: 471  SKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSA 530

Query: 1672 KETSDGSASDLEII 1713
               +D  + DLEII
Sbjct: 531  STKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
            YIL150C
          Length = 594

 Score =  499 bits (1286), Expect = e-171
 Identities = 260/600 (43%), Positives = 384/600 (64%), Gaps = 29/600 (4%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNF-- 174
            MNDPRE+   D ++NI+ DE++E  + +++E +ER+++ L ERL+ K++  +  DPNF  
Sbjct: 1    MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 175  ----------EAIEVPQSPTKNRVKVGSHNATQQGTKFEG--SNINEVRLSQLQQQPKPP 318
                        I+VP SP K + K     AT    K  G   N NE++L    +    P
Sbjct: 61   TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 319  ASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFS--TDEKKYVPIIT-NELESFSNL 489
            A +T YFM  F ++KK E ++I  +E++M+ARVH+F   T+ +K   II   E E +S L
Sbjct: 121  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 490  WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 669
            W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P+Y+NW  VG+I+ KS  K TS
Sbjct: 181  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 670  SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 849
            S  P K+F FTI DFQ  + +++F ++ + +YYNLR+GD+I ILNP + PWRPS    +I
Sbjct: 241  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 850  KSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKKCGSPINISLHKCCDYHREVQFRG 1026
            KSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN +  KCC++HRE +FR 
Sbjct: 301  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 1027 TSAKRIELNGGYALGAPTKVDSQPSLYKAK-----GENGFNIIKGTXXXXXXXXXXXXXX 1191
             +AKRIELNG +ALGAPTK D+ PSLYK K      +N FN+++                
Sbjct: 361  AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR---RRNARKEGDSKLH 417

Query: 1192 XHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRE--SSG 1365
              NF ++N AKAFF+++FQNPD+++NLD+KRRK+ + K+ + L +EL K + + +  S  
Sbjct: 418  NSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 477

Query: 1366 LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 1545
            LE KS  + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S +G +P  +    +  
Sbjct: 478  LEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSN 534

Query: 1546 VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFG--SKETKE--TSDGSASDLEII 1713
             +NDLLH+KK+KV L P K++   K+  R+E+W ++FG  SK  ++   S G  SDLEI+
Sbjct: 535  AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
            required for the association of the MCM2-7 complex with
            replication origins
          Length = 574

 Score =  456 bits (1174), Expect = e-154
 Identities = 242/587 (41%), Positives = 372/587 (63%), Gaps = 16/587 (2%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            M DPRE   +D ++ ++ DE+D+  + + L+ +ER+++ L +RL+   + KK  DPNF  
Sbjct: 1    MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 181  IEVPQSPTKNR---VKVGSHNATQQGTKFEG-SNINEVRLSQLQQQPKPPASTTTYFMEK 348
            +EVP+SP+K++   VK  S +   + + F    N+NE+   Q+Q++    + +T YF + 
Sbjct: 59   VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNEL---QVQKKASLSSISTPYFAQN 115

Query: 349  FQNAKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNELESFSNLWVKKRYIPEDD 522
            F ++KK ++ +  +   M+N RVHTF   +  ++Y PI  NE E FS  W+ KRYI  + 
Sbjct: 116  FSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQ 175

Query: 523  LKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 702
             ++ L E K+LRL KLFAK+RPP F EP+Y+NW T+G+IS KS +K T+  KP ++F  T
Sbjct: 176  ARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLT 235

Query: 703  ITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS------GRGNFIKSFNL 864
            +TDF+HT+++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL
Sbjct: 236  LTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNL 295

Query: 865  RISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRI 1044
             I H+F  ILEIG+SRD G+C I NK   K CG+PIN S+   C YH+EVQFR  +AKR+
Sbjct: 296  CIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRL 355

Query: 1045 ELNGGYALGAPTKVDSQPSLYKAKGENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAK 1224
            ELNG  +L +PTK   +  LY       ++++                    F+N N+A+
Sbjct: 356  ELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQSKDSQNVLY--FSNPNAAR 413

Query: 1225 AFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMK 1404
            AFFD+ +QNPD L NLD+KRRK+   KK   L ++L +++ +  S+  ++++  ++ +++
Sbjct: 414  AFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIR 473

Query: 1405 RTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKV 1584
            R T++AL++GLI+++GFDPT G++S VLK++  G + +      K + + ++L  KKEK+
Sbjct: 474  RATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVEEILQIKKEKI 528

Query: 1585 ILAPSKNEWFKKRSHREEVWQKHFGSKETK----ETSDGSASDLEII 1713
             L PSK    +K   REEVW  HF  +E      E+SDG  S+LEI+
Sbjct: 529  ELKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp, 583
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 583

 Score =  454 bits (1168), Expect = e-153
 Identities = 243/588 (41%), Positives = 366/588 (62%), Gaps = 19/588 (3%)
 Frame = +1

Query: 7    DPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE 186
            DPRE+L +D ++ +TSDE+++  I ++L+ +ER+++ L +RL++K   KK Q  + E +E
Sbjct: 6    DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 187  VPQSPTKNRVKVGSHNATQQG---TKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQN 357
            VP SP + R    S  + +     T    SN + + +         P++TT+YF+E F N
Sbjct: 66   VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPW----KNGPSNTTSYFVENFVN 121

Query: 358  AKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNELESFSNLWVKKRYIPEDDLKR 531
            A+K E+++I    S+++ RVHTF   +  K   P+  +E E +S   + +RY+   +L  
Sbjct: 122  ARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDE 181

Query: 532  ALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITD 711
             + EIK+LRL KLF+K+RPPKF EP+YANW  +G+IS KS++K TSS KP K+F  T+TD
Sbjct: 182  IMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTD 241

Query: 712  FQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG------RGNFIKSFNLRIS 873
            F H LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS        G  +KSFNL I 
Sbjct: 242  FTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIR 301

Query: 874  HDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELN 1053
            H+F C+LEIG+S+DLG+C I NK T K CG+PIN +    C+YH++V+FR  +A+R+ELN
Sbjct: 302  HNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELN 361

Query: 1054 GGYALGAPTKVDSQPSLYKAKG-ENGFNIIKGTXXXXXXXXXXXXXXXHNFTNSNSAKAF 1230
            G  +L +P K   + +LY   G +    ++                    F+N N AKAF
Sbjct: 362  GSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNTLF--FSNPNYAKAF 419

Query: 1231 FDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRT 1410
            FD+ +QNPDML NL+NKRRK+ +++K   L  +L   + +       +KS  E+++MK  
Sbjct: 420  FDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDA 479

Query: 1411 TESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVIL 1590
            TE  L +GL++ +GFDP  GK+ +VLK      +  N+ L  K + + +++ +KK  V L
Sbjct: 480  TEQVLNSGLLRDIGFDPFRGKMREVLKF----GKNVNSGLNSKSSQVKEIMSFKKSNVSL 535

Query: 1591 APSKNEWFKKRSHREEVWQKHF-----GSKETKET--SDGSASDLEII 1713
            APSK E  K+   RE+VW++HF      +++ K+T  S+ S SDLEI+
Sbjct: 536  APSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
            YIL150C (DNA43) - (putative) involved in DNA replication
            [contig 159] FULL
          Length = 466

 Score =  396 bits (1017), Expect = e-132
 Identities = 211/474 (44%), Positives = 297/474 (62%), Gaps = 16/474 (3%)
 Frame = +1

Query: 340  MEKFQNAKKNEDKQIAKFESMMNARVHTF----STDEKKYVPIITNELESFSNLWVKKRY 507
            ME F N++K E+ +I     M+++RVHTF    +T  +K  PI   E E  S LWV +RY
Sbjct: 1    MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRK--PIAVEEKEPASGLWVSRRY 58

Query: 508  IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVK 687
            I  D+L   L +IKILRL KLF+K+RPPKF EP+YANW  VG++ HKS +K TSS KP K
Sbjct: 59   IASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTK 118

Query: 688  FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FI 849
            +F  TITDF H+LDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +
Sbjct: 119  YFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASV 178

Query: 850  KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGT 1029
            KSFNL I  ++ C+LEIG+SRDLG+C I NK   K CG+PIN +    CDYH+E++FR  
Sbjct: 179  KSFNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQV 238

Query: 1030 SAKRIELNGGYALGAPTKVDSQPSLYKAKG-ENGFNIIKGTXXXXXXXXXXXXXXXHNFT 1206
            +A+R+ELNG  +L +P K   + +LY + G +   N++                    F+
Sbjct: 239  NAQRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKHAPQQQDRESQNTLY--FS 296

Query: 1207 NSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVG 1386
            N N AKAFFD+ +QNPD+L NLD+KRRK+ +T+    L  +L + + +       +K+  
Sbjct: 297  NPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQ 356

Query: 1387 ERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLH 1566
            E+++MK+ TE  + +GL++ +GFDPT GK+  VLK    G   KN+    K   + +++ 
Sbjct: 357  EQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLK---VGKNSKNS-TDTKSIQVREIIE 412

Query: 1567 YKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK-----ETKETSDGSASDLEII 1713
             +K  V LAPSK +  K+   RE+VW++HF +K       +  SD S SDLEI+
Sbjct: 413  TRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  385 bits (988), Expect = e-126
 Identities = 222/614 (36%), Positives = 339/614 (55%), Gaps = 44/614 (7%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDE-----------------------QAIARELEFMERKR 111
            +NDPREI+    Y+ I SDEED                          +   L+ +E +R
Sbjct: 6    LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 112  QALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRV----KVGSHNATQQGTKFEGSNINE 279
              L+ RL+  +   K +      +EVP+SPTK +        S +A+    +    N NE
Sbjct: 65   SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 280  VRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK--KYVP 453
              L            TT+YF EKF  A+ +    + + + ++  RV+TFS  +   +Y  
Sbjct: 125  RYLLSAN------TPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTT 178

Query: 454  IITNELESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVG 633
               +E+E++SN+ + KRY+PE+DLKR LH+IK+LRL KLFAK+RPPKF EP+YANW T+G
Sbjct: 179  FAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLG 238

Query: 634  LISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEV 813
             IS+KSD+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+
Sbjct: 239  AISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEI 298

Query: 814  LPWRPSGR------GNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPIN 975
             PW+ S +          +SF L I H+  CILEIG S++LG+CP +NK     CG+PIN
Sbjct: 299  YPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPIN 358

Query: 976  ISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGENGFNIIKGTXX 1155
                + C YH+E   R  +AKR+ELNG  +L APT+   Q + Y  +  +G  I      
Sbjct: 359  KLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDV 418

Query: 1156 XXXXXXXXXXXXXHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELG 1335
                          +F ++N+ +A+FD  + NPD+L NL++KRRKI  +KK   ++++L 
Sbjct: 419  YAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLS 478

Query: 1336 KIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEP 1515
             ++ +  +   +  S    Q+ ++ T++ ++TG+++ +GFDPT G+++ VL     G  P
Sbjct: 479  LVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHG--P 536

Query: 1516 KNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHF---------GSKE 1668
             + +   ++  I+++L  KK  + L PSK    K+   R EV+   F         GS E
Sbjct: 537  ADTV---REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCE 593

Query: 1669 TKETSDGSASDLEI 1710
            T + S   +SD E+
Sbjct: 594  TAQLSSADSSDEEL 607

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp, 577
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 577

 Score =  366 bits (940), Expect = e-119
 Identities = 216/590 (36%), Positives = 340/590 (57%), Gaps = 19/590 (3%)
 Frame = +1

Query: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
            + DPREI A DPY  ++ DE + + + R +  ++ +++ L  RL   ++ +  +DPNF++
Sbjct: 5    LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 181  IEVPQSPTKNR-----VKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFME 345
            I+VP+SP K+      ++   H A     +    N+NE  + +  ++      TT+YF E
Sbjct: 65   IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK----LGTTSYFTE 120

Query: 346  KFQNAKKNEDKQIAKFESMMNARVHTFSTDE-KKYVPIITNELESFSNLWVKKRYIPEDD 522
            K ++   NE + I + + ++  RV+TF+ D   +Y PI  +E +  S L + +RY+P   
Sbjct: 121  KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 523  LKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 702
            L++    IK+LRL KLF+K+R PKF EP+Y NW  +G+IS K++ + T+S KPVKFF  T
Sbjct: 181  LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 703  ITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWR--PSGRGNFIKSFNLRISH 876
            I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 241  ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 877  DFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 1056
            D   ILE+G S++ G C    K   K CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 301  DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 1057 GYALGAPTKVDSQPSLYKAKGENGFNIIKGTXXXXXXXXXXXXXXXHN---FTNSNSAKA 1227
              A+ AP     Q ++ K++  NG   I+                  N   F+++N++ A
Sbjct: 361  SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420

Query: 1228 FFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGER----- 1392
            FFD+ ++NPD+LANLDNKRRKI E + +  L ++L          GL DK + ++     
Sbjct: 421  FFDDDYENPDILANLDNKRRKIQELRNNRNLEKKL---------KGLSDKLLSKKEDRVN 471

Query: 1393 QKMKRT-TESALQTGLIQRLGFDPTHGKIS-QVLKSSVSGSEPKNNLLGKKKTVINDLLH 1566
            Q+ K+T T S  Q GL  ++G+DPT GK S ++L+ S     PKN+    K+  I D+ +
Sbjct: 472  QEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND----KQLAITDICN 527

Query: 1567 YKKEKVILAPSKNEWFKKRSHREEVWQKHF-GSKETKETSDGSASDLEII 1713
             KK+ V L PSK +  +K   R  ++ +   GS+E  +  +GS+ DLEII
Sbjct: 528  IKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>NCAS0H01090 Chr8 complement(205335..206717) [1383 bp, 460 aa] {ON}
           Anc_6.173 YPL181W
          Length = 460

 Score = 38.9 bits (89), Expect = 0.035
 Identities = 42/159 (26%), Positives = 62/159 (38%), Gaps = 12/159 (7%)
 Frame = +1

Query: 4   NDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVER------------LKRKQE 147
           ND  + L  +  N      +DE+A     +  +RKR  LVER            LK  + 
Sbjct: 185 NDDLDPLTQETSNPTGEGNDDEEA----KKLQDRKRATLVEREEKQYQWMLEKALKESRR 240

Query: 148 FKKPQDPNFEAIEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPAST 327
              P++ N E   V QS      KV             G   N+V      +QP P    
Sbjct: 241 ISNPEENNPEDHGVTQSNDAEGAKVNL-----------GEQSNDVSQRTNSEQPIP---- 285

Query: 328 TTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKK 444
           +   + K  N+K+ E+KQ +K     +A   T S+ E+K
Sbjct: 286 SNKIIGKESNSKEEEEKQSSKESISPSASTTTISSLEEK 324

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 38.5 bits (88), Expect = 0.053
 Identities = 41/182 (22%), Positives = 80/182 (43%), Gaps = 3/182 (1%)
 Frame = +1

Query: 55  DEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNF-EAIEVPQSPTKNRVKVGSH 231
           +E   + I  ++   +R +    + L+ K+++ K     + E  E  Q   +   ++ S 
Sbjct: 192 EEIRNKMITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWREVTEKNQESIRKTKELKSE 251

Query: 232 NATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNA 411
             T    + +  N    RL +L+ + K    T     E+    +KN D +  K + ++  
Sbjct: 252 IETVLTPRIDTQN---KRLEELKSEIKKLDDTLQNKNEQVGEIRKNIDLEREKKDKLLAE 308

Query: 412 RVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH-EIKILRLG-KLFAKIR 585
           +    +  EK        E+E      +KK  + E+ L+RALH E++ LR   +++ +IR
Sbjct: 309 KEEILAYIEKS-----KKEVEE-----IKKILVKEESLRRALHNELQELRGNIRVYCRIR 358

Query: 586 PP 591
           PP
Sbjct: 359 PP 360

>Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AFR025C
          Length = 487

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +1

Query: 55  DEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRV-KVGSH 231
           DEE+E+   +  EF+ER R A  +  KRK+E+ K  + + +  E   S   + V ++   
Sbjct: 310 DEEEEERERKRKEFLERNRLAASKFRKRKKEYIKKIETDLQFYETEYSDLTSFVDRLSGL 369

Query: 232 NATQQGTKFEGSNINEVRL 288
           N   + T  + S+++ ++L
Sbjct: 370 NGNSKSTDLQNSDLSLLKL 388

>KAFR0B06030 Chr2 (1247049..1247765) [717 bp, 238 aa] {ON} Anc_8.372
           YDR174W
          Length = 238

 Score = 35.8 bits (81), Expect = 0.22
 Identities = 32/144 (22%), Positives = 60/144 (41%), Gaps = 3/144 (2%)
 Frame = +1

Query: 28  VDPYNNITSDEEDE-QAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPT 204
           VD YNNI  DEE++ +A     E ++    A  +      +   P D   E I   ++P 
Sbjct: 28  VDFYNNIGEDEEEKIEAFTTLTESLQTLTSATNQFHSISSDLLNPVDDEKEIIAPSKTPL 87

Query: 205 KNRVKVGSHNATQQGTKF--EGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDK 378
           K +V+   +   +  T F    + + +      Q+   PP S+T    E  +  K+  D 
Sbjct: 88  KRKVERDPNAPKKPLTVFFAYSAYVRQELRDARQKAGLPPLSSTEITQEISKKWKELSDN 147

Query: 379 QIAKFESMMNARVHTFSTDEKKYV 450
           +  K++   N  +  +   ++ Y+
Sbjct: 148 EKEKWKQAYNVELTHYQKAKQDYL 171

>SAKL0H14234g Chr8 complement(1216484..1217191,1217259..1217300)
           [750 bp, 249 aa] {ON} similar to uniprot|Q03973
           Saccharomyces cerevisiae YDR174W HMO1 Chromatin
           associated high mobility group (HMG) family member
           involved in genome maintenance rDNA- binding component
           of the Pol I transcription system associates with a
           5'-3' DNA helicase and Fpr1p a prolyl isomerase
          Length = 249

 Score = 35.8 bits (81), Expect = 0.22
 Identities = 34/147 (23%), Positives = 62/147 (42%), Gaps = 6/147 (4%)
 Frame = +1

Query: 28  VDPYNNITSDEEDE-QAIARELEFMERKRQALVERLKRKQEFKKPQDPNFE-AIEVPQSP 201
           VD YN+I  DEE++ +A     E +++   A  +      E   P D   E A   P  P
Sbjct: 34  VDFYNSIGEDEEEKIEAFTTLTEALQKLTSATNQLHGISAELNNPMDDEKEPAAAAPAKP 93

Query: 202 T--KNRVKVGSHNATQQGTKF--EGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKN 369
              + R +   +   +  T F    + + +      Q+   PP S+T    E  +  K+ 
Sbjct: 94  AAPRKRPERDPNAPKKPLTVFFAYSAYVRQALREDRQKAGLPPLSSTEITQEISKKWKEL 153

Query: 370 EDKQIAKFESMMNARVHTFSTDEKKYV 450
            D +  K++   NA +  +  +++KY+
Sbjct: 154 SDSEKDKWKQAYNAELENYQREKQKYL 180

>ZYRO0B01320g Chr2 (111463..112269) [807 bp, 268 aa] {ON} highly
           similar to gnl|GLV|CAGL0K02783g Candida glabrata
           CAGL0K02783g and similar to YKL007W uniprot|P28495
           Saccharomyces cerevisiae YKL007W CAP1 Alpha subunit of
           the capping protein (CP) heterodimer (Cap1p and Cap2p)
           which binds to the barbed ends of actin filaments
           preventing further polymerization localized
           predominantly to cortical actin patches
          Length = 268

 Score = 35.4 bits (80), Expect = 0.32
 Identities = 38/162 (23%), Positives = 61/162 (37%), Gaps = 3/162 (1%)
 Frame = +1

Query: 256 FEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTD 435
           F+GS +NE +   L++  K        ++EK              F   ++  V+    +
Sbjct: 98  FQGSKLNETQQEYLKELNK--------YVEK-------------DFTGQVSVAVYPVPQE 136

Query: 436 EKKYVPIITNELESFSNLWV---KKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEP 606
           E K   II +   +  N W    K  Y+ +  LK+    I +                + 
Sbjct: 137 ESKTAIIIVSTKYNPGNFWNGAWKSEYVYDSHLKQLKGFIDV----------------QV 180

Query: 607 EYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDV 732
            Y     VG  S K D++ T SE P+K      T F++ LDV
Sbjct: 181 HYYEDGNVGFKS-KKDVEITDSESPIKSIQQVETSFENDLDV 221

>KAFR0H02180 Chr8 (414111..416207) [2097 bp, 698 aa] {ON} Anc_8.346
           YLR139C
          Length = 698

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 45/203 (22%), Positives = 83/203 (40%), Gaps = 20/203 (9%)
 Frame = +1

Query: 154 KPQDPNFEAIEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTT 333
           +P+ PN   ++  Q    ++     HN  QQ +  EG +     +S+     K  +   +
Sbjct: 45  RPEKPNIVILDPKQIGHSSKHPHPHHNRGQQNSILEGFDFEFNSISEPLLFSKKASKNVS 104

Query: 334 YFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPI--------------ITNEL 471
           +  E  Q+  + E +++  FE+ +N   H F    + + P+                N+L
Sbjct: 105 HPQEDHQDLIQRETEKLLNFETKLNE--HQFLESIESFKPVSKVNDATHLLIDTNTYNDL 162

Query: 472 ES-FSNLWVKKR---YIP-EDDLKRAL-HEIKILRLGKLFAKIRPPKFQEPEYANWATVG 633
           +S  S+ +  K+   YI  + +LK  L H +KI  + K+F +I   K  E       T  
Sbjct: 163 KSNLSDSFTWKQLYSYIKFKSNLKSKLQHMVKIDLINKIFFEIWNCKISESSDNQSVTSP 222

Query: 634 LISHKSDIKFTSSEKPVKFFMFT 702
             S    ++   SE+  K  + T
Sbjct: 223 TSSDLVTLRIKLSERGAKLLILT 245

>KLTH0E08118g Chr5 (745621..747495) [1875 bp, 624 aa] {ON} similar
           to uniprot|P22336 Saccharomyces cerevisiae YAR007C RFA1
           Subunit of heterotrimeric Replication Factor A (RF-A)
           which is a highly conserved single-stranded DNA binding
           protein involved in DNA replication repair and
           recombination
          Length = 624

 Score = 35.4 bits (80), Expect = 0.47
 Identities = 37/155 (23%), Positives = 65/155 (41%), Gaps = 1/155 (0%)
 Frame = +1

Query: 67  EQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSHNATQQ 246
           E AI +E    ++K   L++ L+  Q   + Q+PN E I+       + V     +A  Q
Sbjct: 87  EPAIVKE----KKKYVLLIDDLEIIQSRAEIQNPNCELIDNYLIAHPDEVFSSEESAPAQ 142

Query: 247 GTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTF 426
           G+ F G           QQQP+ P +      + FQ  ++   +    + +  N     F
Sbjct: 143 GSSFTGR----------QQQPQQPQA------QNFQKPQQYAPQAQQNYNNSNN-----F 181

Query: 427 STDEKKYVPIITNELESFSNLW-VKKRYIPEDDLK 528
           S+ +K        +L  + N+W +K R   + D+K
Sbjct: 182 SSSQKSRPIFAIEQLSPYQNMWTIKARVSFKGDIK 216

>YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON}
           SKO1Basic leucine zipper transcription factor of the
           ATF/CREB family; forms a complex with Tup1p and Cyc8p to
           both activate and repress transcription; cytosolic and
           nuclear protein involved in osmotic and oxidative stress
           responses
          Length = 647

 Score = 35.4 bits (80), Expect = 0.47
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +1

Query: 40  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE 186
           NN+T DE +EQ   R+ EF+ER R A  +  KRK+E+ K  + + +  E
Sbjct: 418 NNVTLDENEEQERKRK-EFLERNRVAASKFRKRKKEYIKKIENDLQFYE 465

>TBLA0E03080 Chr5 (774631..776700) [2070 bp, 689 aa] {ON} Anc_6.42
            YMR008C
          Length = 689

 Score = 35.4 bits (80), Expect = 0.48
 Identities = 20/73 (27%), Positives = 35/73 (47%)
 Frame = +1

Query: 1483 VLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS 1662
            VL S+     P N       +  +D+   ++    ++P++++W +KR+   EV  K F  
Sbjct: 12   VLTSTAEAWSPSNGYAPANVSCPDDINLVRRADGKISPNESDWLQKRNANTEVSLKEFLE 71

Query: 1663 KETKETSDGSASD 1701
            + TK  SD S  D
Sbjct: 72   RATKNFSDTSFMD 84

>NCAS0G02000 Chr7 complement(360567..362222) [1656 bp, 551 aa] {ON}
           Anc_2.86 YNL167C
          Length = 551

 Score = 35.0 bits (79), Expect = 0.59
 Identities = 43/171 (25%), Positives = 70/171 (40%), Gaps = 18/171 (10%)
 Frame = +1

Query: 28  VDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEF--KKPQDPNFEAIEVPQSP 201
           ++  +N   D EDEQ   R+ EF+ER R A  +  KRK+E+  K   D NF  +E     
Sbjct: 355 INDNDNTNYDNEDEQDRKRK-EFLERNRVAASKFRKRKKEYIKKIENDLNFYEVEYADYT 413

Query: 202 TKNRVKVG------SHNATQQ-------GTKFEGSNINEVRLSQ-LQQQPKPPASTTTYF 339
              +  VG      ++NA+         G   +  + N+V+ S  L  Q K   + T ++
Sbjct: 414 KMMQRFVGVIPSQDNNNASTYMDPNSLIGALEKSVSTNDVQSSMALIAQMKRMLTQTKFY 473

Query: 340 MEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKK--YVPIITNELESFSN 486
             K  N K +    I          + +     ++   +P  TN   + SN
Sbjct: 474 QRKGTNPKAHNGDGIDNANGTSKNSISSLDEQSRRTSLIPNYTNPNSNSSN 524

>CAGL0K05555g Chr11 (543605..544297) [693 bp, 230 aa] {ON} similar
           to uniprot|Q08492 Saccharomyces cerevisiae YOR078w
          Length = 230

 Score = 34.3 bits (77), Expect = 0.65
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 20/169 (11%)
 Frame = +1

Query: 58  EEDEQAIARELEFMERKRQALVERLKRKQ---------------EFKKPQDPNFEA--IE 186
           ++ EQA   E + +  KR+   ERLK +Q               E +K Q    E+   E
Sbjct: 69  KKQEQAAILEKQRIREKRKKENERLKEQQLEKKMRTEEMQKQIAELEKLQSQTVESDEEE 128

Query: 187 VPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKK 366
           + + P     K+ + + T   T  +  N N++       + K          E+ +  KK
Sbjct: 129 LQELPEDLLAKINNVDPTAGQTIPKHINFNDIDTQDFVPEVK----------EQIKKRKK 178

Query: 367 NEDKQIAKFESMMN---ARVHTFSTDEKKYVPIITNELESFSNLWVKKR 504
           N  KQ+ K  + MN    +V   S++  K  P     + +  N W+K+R
Sbjct: 179 NALKQLCK--TTMNKGVVKVSVLSSNLSKSAPKKEGNVTNLRNKWLKRR 225

>TBLA0H00300 Chr8 complement(51145..54972) [3828 bp, 1275 aa] {ON}
            Anc_2.409 YMR128W
          Length = 1275

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 6/113 (5%)
 Frame = +1

Query: 1357 SSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGK 1536
            +S L   S  E  +     E AL+   +Q L F P   KIS++ K  +           +
Sbjct: 48   TSNLPKDSNAELLEPVTAEEKALKKRKLQEL-FTPKESKISRLKKKRLDKFIEHQLKREE 106

Query: 1537 KKTVINDLLHYKKEKVILAPSKNEWFKKRSHREE------VWQKHFGSKETKE 1677
            K T+I  L  YK +  IL  SK     +++ +EE      + Q+  G++ TKE
Sbjct: 107  KTTIIKKLQDYKMDTSILVSSKRLGHGRQTKKEEFAEALSLEQQGRGNEHTKE 159

>Smik_6.29 Chr6 (55868..58012) [2145 bp, 714 aa] {ON} YFL047W (REAL)
          Length = 714

 Score = 33.9 bits (76), Expect = 1.4
 Identities = 24/110 (21%), Positives = 53/110 (48%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1360 SGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHG-KISQVLKSSVSGS------EPK 1518
            +G+++  V +  + +  T S    G++Q +  + TH   I+  ++S V         E +
Sbjct: 57   AGMDNLKVVQEDEHEGVTVSRALRGILQEISQEGTHHLTIASNIESLVLQPFSKWCVEHR 116

Query: 1519 NNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKE 1668
              +   +KT++ ++ +++K K  ++  + E+F K    EE  + HF   E
Sbjct: 117  ERIQYSEKTLLANVNNFRKSKKYVSKLEKEYFNKCRQLEEFKRTHFNEDE 166

>ZYRO0F16368g Chr6 complement(1342457..1343491) [1035 bp, 344 aa]
           {ON} some similarities with uniprot|P38852 Saccharomyces
           cerevisiae YHR156C LIN1 Nuclear protein that physically
           interacts with Irr1p a component of the cohesin complex
           may link together proteins involved in chromosome
           segregation mRNA splicing and DNA replication
          Length = 344

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 55/274 (20%), Positives = 107/274 (39%), Gaps = 16/274 (5%)
 Frame = +1

Query: 43  NITSDEED----EQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKN 210
           + + DEED    EQ  +R+  +  R+R       KRK         +F+     +S    
Sbjct: 16  DFSEDEEDSNPGEQGFSRKDRYASRQR-------KRKLNTSDYDSDSFDDNSDSESEGGK 68

Query: 211 RVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAK 390
           + K  +HN    G     S+ ++    + + + +       Y   KF+  +  +DKQ  +
Sbjct: 69  QEKKENHN-DDDGDDMFASDDDQKPPKKSEPETEAVQDAFDYDDPKFEQREPLQDKQDVQ 127

Query: 391 FESM-----MNARVHTFSTDEKKYVPIITNELESFSNLWVKK----RYIPED---DLKRA 534
            ES            + +TD+K     + NE  +  + W+ +    R + E    D +R 
Sbjct: 128 LESFNMDEDTTQNEPSNNTDDK----YLQNEDYNREDQWIDEVEDVRGVAESQRRDKERR 183

Query: 535 LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 714
           L ++  L+  +    +     +   + N     L +     K  S  +P ++ +  I   
Sbjct: 184 LQKLNELKNRQRHYMVDEALIRLQYFINPGETVLTALGRFNKLRSRNEPSEYVVNAINFV 243

Query: 715 QHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVL 816
              +DV    +KG+E  Y+L+  D+  ++  E L
Sbjct: 244 TDLIDV--IERKGIEDVYSLKRSDLSKLIEEESL 275

>YJL049W Chr10 (345973..347325) [1353 bp, 450 aa] {ON} Putative
           protein of unknown function; YJL049W is a non-essential
           gene
          Length = 450

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 22/90 (24%), Positives = 45/90 (50%)
 Frame = +1

Query: 43  NITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKV 222
           N   DEE E+ I RELE +E   +   +   + Q+  +P++ + E +        N +K+
Sbjct: 368 NKGQDEEAEEEIERELEQLELDEKNNNKEENKNQDLHEPKESSSEDL----LKRLNNLKI 423

Query: 223 GSHNATQQGTKFEGSNINEVRLSQLQQQPK 312
            ++    Q  +   ++ NE+R   +++QP+
Sbjct: 424 NTNEGPVQDNE---NHDNEIRKIMMEEQPR 450

>NCAS0I02930 Chr9 (541697..544243) [2547 bp, 848 aa] {ON} Anc_1.163
            YJL176C
          Length = 848

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 15/228 (6%)
 Frame = +1

Query: 43   NITSDEEDEQAIARELEFMERKRQALVERLKRK--------QEFKKPQDPNFEAIEVPQS 198
            N   D E EQ    E E +E K +A  ++ +          +E K  ++P  +A+    +
Sbjct: 626  NKNQDPEQEQ----EQEQLETKEEAQDQKQEISNLPEPAIAKETKDKEEPIIDAVPDVSA 681

Query: 199  PTKNRVKVGSHNA-TQQGTKFEGSNINE----VRLS-QLQQQPKPPASTTTYFMEKFQNA 360
               + +K GS  A +  G + +    NE    +RLS Q+ Q       T    + K +  
Sbjct: 682  ALGSPLKEGSEIAFSTLGVRSKVFANNEERKLIRLSNQMVQIQLRKVETKMNLINKLEKT 741

Query: 361  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 540
             + E K + + +  +  +  TF+ + KK +    + LESF N  + ++ I  +++K  L 
Sbjct: 742  MELEKKVLERQQEDLLIQRLTFNKNSKKLLEKFQSSLESFDNKEILEQNI--NEIKSLLT 799

Query: 541  EIKILRLGKLF-AKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKP 681
                L  GK F + +   + +    AN       + +S+IK  S E P
Sbjct: 800  NPAQLSFGKPFNSSVSISRAEAESNAN-------ASESEIKPISIEAP 840

>TBLA0B07220 Chr2 complement(1707881..1710844) [2964 bp, 987 aa] {ON} 
          Length = 987

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/114 (19%), Positives = 48/114 (42%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1195 HNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTA------LSRELGKIMRRRE 1356
            H  ++S + + +  +K + P ++  +DN   ++I     T       + ++   I     
Sbjct: 226  HIKSHSKAIRRYISKKGKTPKLIKIIDNNNNELIPPPTDTTSTFQVTVQQQFNNINNETN 285

Query: 1357 SSGLE-------DKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSS 1497
            S+ L+       D S+   + +KR +++ L T        DP +G I  +  +S
Sbjct: 286  SNPLQNANDFFKDISIDSLELLKRKSDTKLDTDSTSNTNIDPNNGNIININNNS 339

>NDAI0E01830 Chr5 complement(363691..367503) [3813 bp, 1270 aa] {ON}
            Anc_2.409
          Length = 1270

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 33/137 (24%), Positives = 58/137 (42%), Gaps = 13/137 (9%)
 Frame = +1

Query: 1324 RELGKIMRRRESSGLEDKSVGERQKMKRTT-------------ESALQTGLIQRLGFDPT 1464
            +EL K+  ++    +E++S  E  K    T             E +L+   +Q + F P 
Sbjct: 21   KELKKVRNKQFHREVEEESEEEDAKNTSITDTNAEILEPLTEEEKSLKKRKLQEI-FTPK 79

Query: 1465 HGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVW 1644
              KIS++ K  +           +KKT+I  L  YK +  +L  SK     +++ +EE  
Sbjct: 80   ESKISRLKKKRLDKFIDHQLKREEKKTIIEKLQDYKIDTSLLVSSKKLGEGRQTKKEEFA 139

Query: 1645 QKHFGSKETKETSDGSA 1695
            +     K+ + T D  A
Sbjct: 140  EALSLEKQGRSTDDTRA 156

>KLLA0F06116g Chr6 (592103..595960) [3858 bp, 1285 aa] {ON} conserved
            hypothetical protein
          Length = 1285

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 34/145 (23%), Positives = 64/145 (44%), Gaps = 8/145 (5%)
 Frame = +1

Query: 40   NNITSDEEDEQAIARELEF-MERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSP-TKNR 213
            +NI+SDEE+E A+  ELE   E + +   E   +  +  + Q+     IE  ++P T  +
Sbjct: 860  SNISSDEEEEDAVDAELETGQEDEEEQEQEDSTQHMDSLEVQNVVDNVIETKENPCTDRQ 919

Query: 214  VKVGSHNATQQGTKFEGSNIN----EVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQ 381
              V   N+       +   ++     + ++ ++    P   T T    K  N ++++ ++
Sbjct: 920  FSVSDANSKSDVPALQNEEVSVDTASIAINSVEIPSTPANDTETSLSSKEANIEESKPEK 979

Query: 382  IAK--FESMMNARVHTFSTDEKKYV 450
            I +  FES         S DE+K V
Sbjct: 980  ILEQGFES-----AKPLSQDEQKRV 999

>NCAS0J00650 Chr10 (99780..100766) [987 bp, 328 aa] {ON} Anc_8.85
          Length = 328

 Score = 32.7 bits (73), Expect = 2.6
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 5/99 (5%)
 Frame = +1

Query: 289 SQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK---KYVPII 459
           S+LQQ P PPA+T + F  K   A        A F   ++ ++      EK   + + ++
Sbjct: 16  SELQQPPPPPATTKSKFFGKASLASTFRKSTAANFGPELSRKLSQLVKTEKGVLRALEVV 75

Query: 460 TNELESFSNLWVKKRYIPEDDLKRALHEIKIL--RLGKL 570
            NE  + +       Y  +DD+     ++ +L   LG+L
Sbjct: 76  ANERRAAARQLSLWGYDNDDDVSDVTDKLGVLMYELGEL 114

>Kthe_YGOB_CWC15 Chr7 complement(983375..984070) [696 bp, 231 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 231

 Score = 32.3 bits (72), Expect = 2.7
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 6/79 (7%)
 Frame = +1

Query: 52  SDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVG-- 225
           SDEED++A+ REL  + ++R  +V++LK ++E +   +   EA  V +S     V  G  
Sbjct: 138 SDEEDQEALLRELNKIRQER--MVQKLKEQRERQDSVEEPSEAPTVQRSWRSQTVFGGLR 195

Query: 226 ----SHNATQQGTKFEGSN 270
               S+  T +  K E SN
Sbjct: 196 SNKSSNRNTPKDLKQEYSN 214

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 32.3 bits (72), Expect = 3.0
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 2/121 (1%)
 Frame = +1

Query: 166 PNFEAIE-VPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFM 342
           P FE ++   QSPT+++VK  ++     G    G+ +NE+  S L   PK          
Sbjct: 2   PLFETVKSFVQSPTESKVKQATNEDETMGAT--GTLMNEI--SVLTYSPKTLKEIVQVLK 57

Query: 343 EKFQN-AKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPED 519
           ++    ++K   K        +    +  +    ++V  I N     SNL  +K   P+D
Sbjct: 58  KRLSGYSRKTSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKD 117

Query: 520 D 522
           D
Sbjct: 118 D 118

>Suva_14.171 Chr14 complement(315525..317483) [1959 bp, 652 aa] {ON}
           YNL167C (REAL)
          Length = 652

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +1

Query: 40  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE 186
           NN+  DE +EQ   R+ EF+ER R A  +  KRK+E+ K  + + +  E
Sbjct: 417 NNVIIDETEEQEKKRK-EFLERNRVAASKFRKRKKEYIKKIESDVQFYE 464

>Skud_2.300 Chr2 complement(546556..548811) [2256 bp, 751 aa] {ON}
           YBR172C (REAL)
          Length = 751

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 30/147 (20%), Positives = 56/147 (38%), Gaps = 26/147 (17%)
 Frame = +1

Query: 82  RELEFMERKRQALVERLKRKQEFKKPQD------PNFEAIEVPQSPTKNRVKVGSHNAT- 240
           +E E +E +RQ  VE+  +  + +          P+  A++    P  ++VK+ S   T 
Sbjct: 427 KERETLESERQRQVEKTNKAMQARAEVSKISKDLPSLNALKAKSIPWASKVKIDSPVETI 486

Query: 241 ------------QQGTKFEGSNINEVRLSQLQQ-------QPKPPASTTTYFMEKFQNAK 363
                       ++ T  +  NI E +  Q  +       +  PP   T     +FQ   
Sbjct: 487 VKNGVSSNETKKEESTNLQQRNIKEEKQKQESKFVLNWANKSSPPPDQTIDIKSQFQKNV 546

Query: 364 KNEDKQIAKFESMMNARVHTFSTDEKK 444
           KN +  + +  S+       F  ++KK
Sbjct: 547 KNVNVNVKETPSLKELEDPNFIEEQKK 573

>CAGL0F02255g Chr6 (221723..222163) [441 bp, 146 aa] {ON} similar to
           uniprot|P43587 Saccharomyces cerevisiae YFR003c
          Length = 146

 Score = 31.2 bits (69), Expect = 3.9
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 7   DPREILAVD-PYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAI 183
           DP ++   D  +++ +S     ++   +    E++RQ  +ER +R+Q+  +P  PN   I
Sbjct: 72  DPEQLCPSDHEHSSSSSSSSSSESDDDDKYNSEQRRQRRIERRRRRQKTNRPASPNAYEI 131

Query: 184 EVPQSPTKNRV 216
           +   S  + R+
Sbjct: 132 QPDYSEYRKRM 142

>Skud_14.164 Chr14 complement(310167..312116) [1950 bp, 649 aa] {ON}
           YNL167C (REAL)
          Length = 649

 Score = 32.3 bits (72), Expect = 4.2
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +1

Query: 40  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEV 189
           NN   DE +EQ   R+ EF+ER R A  +  KRK+E+ K  + + +  E+
Sbjct: 418 NNTIMDETEEQENKRK-EFLERNRVAASKFRKRKKEYIKKIESDLQFYEL 466

>ABL180W Chr2 (66980..69025) [2046 bp, 681 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL216W (RAP1)
          Length = 681

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 28/146 (19%), Positives = 63/146 (43%), Gaps = 1/146 (0%)
 Frame = +1

Query: 4   NDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAI 183
           N+ +++  + P +         Q    + + ++ +  + +  LKR  +  + +    +A 
Sbjct: 455 NNAKKVKFMSPTSQQAHSASTNQYTIPQDDLLDEETLSFITGLKR--DLSRMESHQNQAP 512

Query: 184 EVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPP-ASTTTYFMEKFQNA 360
           ++P   T+   +   +N T + T+F+  N +E+        P PP  +TT  FM +F + 
Sbjct: 513 DIPFEYTQELAESIRNNFTMEETQFDNINPDEI--------PFPPQIATTDLFMPEFFHF 564

Query: 361 KKNEDKQIAKFESMMNARVHTFSTDE 438
               D  + K   ++N   HT   ++
Sbjct: 565 ATTRD-FLNKVHEIVNRTYHTSQAEK 589

>YFL047W Chr6 (40421..42565) [2145 bp, 714 aa] {ON}
            RGD2GTPase-activating protein (RhoGAP) for Cdc42p and
            Rho5p
          Length = 714

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 23/110 (20%), Positives = 51/110 (46%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1360 SGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHG-KISQVLKSSVSGS------EPK 1518
            +G+++    +  + +  T S    G++Q +  + TH   I+  ++S V         E +
Sbjct: 57   AGMDNLKAVQEDEDEGVTVSRALRGILQEMSQEGTHHLTIASNIESLVLQPFSKWCIEHR 116

Query: 1519 NNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKE 1668
              +   +KT++ ++ +++K K  +   + E+F K    EE  + HF   E
Sbjct: 117  ERIQYSEKTLLTNVNNFRKSKKYVGKLEKEYFNKCRQLEEFKRTHFNEDE 166

>KNAG0D02550 Chr4 complement(446875..450576) [3702 bp, 1233 aa] {ON}
            Anc_8.78 YPL012W
          Length = 1233

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 33/133 (24%), Positives = 58/133 (43%), Gaps = 16/133 (12%)
 Frame = +1

Query: 1228 FFDEKFQNPDM--LANLDNKRRKIIETKKSTALSREL--------GKIMRRRE------S 1359
            F  E F   DM  LAN+   R +   +K+ T    E+         K M   +      +
Sbjct: 995  FIAEHFPESDMKLLANIRKIRNR---SKRETGADSEILLPDVAKGPKFMSAFDEAIYDSA 1051

Query: 1360 SGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKK 1539
            S  ED+   E++   +    A Q  ++++ G +P     S+ L + +S + PK    GKK
Sbjct: 1052 SDTEDRGDAEQETAGKGKRQASQKYIVEKSGDNPLDLLDSETL-AHISTTRPKKFQKGKK 1110

Query: 1540 KTVINDLLHYKKE 1578
             T+ +D+ ++  E
Sbjct: 1111 GTISDDMFNFDAE 1123

>NCAS0A04110 Chr1 complement(829352..833095) [3744 bp, 1247 aa] {ON}
            Anc_2.409
          Length = 1247

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 25/91 (27%), Positives = 42/91 (46%)
 Frame = +1

Query: 1414 ESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILA 1593
            E AL+   +Q L F P   K+S++ K  +           +KKT+I  L  YK +  +L 
Sbjct: 64   EKALKKRKLQEL-FTPKESKVSRLKKKRLDKFIEHQLKREEKKTIIEKLQGYKIDTSLLT 122

Query: 1594 PSKNEWFKKRSHREEVWQKHFGSKETKETSD 1686
             SK     +++ REE  +     K+ + T +
Sbjct: 123  SSKRLGEGRQTKREEFAEALSLEKQGRSTEE 153

>KNAG0A06020 Chr1 complement(905792..909550) [3759 bp, 1252 aa] {ON}
            Anc_2.409 YMR128W
          Length = 1252

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 6/81 (7%)
 Frame = +1

Query: 1453 FDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHR 1632
            F P   K+S++ K  +           ++KT+I+ +  YK +  +L  SKN    KR+ +
Sbjct: 76   FVPKESKVSRLKKKRLDKFIEHQLKREERKTIIDKMQDYKMDTSVLTSSKNLGHGKRTKK 135

Query: 1633 E------EVWQKHFGSKETKE 1677
            E      ++ ++  G++ETK+
Sbjct: 136  EIFAEALDLEKQGRGNEETKQ 156

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 30.0 bits (66), Expect(2) = 4.7
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +1

Query: 40  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPN 171
           NN++  E  +Q IAR  +  + ++Q L ++L++ Q+ K+ Q  N
Sbjct: 148 NNVSISEIQQQTIARLQQQQQMQQQQLQQQLEQLQQLKQLQQQN 191

 Score = 20.4 bits (41), Expect(2) = 4.7
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +1

Query: 283 RLSQLQQQPKPPASTTTYF 339
           +L QLQQQ    ++TTT F
Sbjct: 183 QLKQLQQQNVMNSTTTTPF 201

>TBLA0D05330 Chr4 complement(1306412..1310893) [4482 bp, 1493 aa]
           {ON} Anc_1.294 YJL076W
          Length = 1493

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 26/109 (23%), Positives = 48/109 (44%)
 Frame = +1

Query: 163 DPNFEAIEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFM 342
           D NF   E+P+S   N     ++N     +K    +I+    + L   P P    +    
Sbjct: 547 DSNFHLAELPKSNNNNN---NNNNNNNNISKDSQGSISNNTSNILPNSPAPQRKIS--IE 601

Query: 343 EKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNL 489
           +K QN   NE+ Q     ++++ R+  FS DE   +P+ +     F+++
Sbjct: 602 KKIQNKSYNENIQGL---NLVSIRIEKFSDDEDDDIPLGSENKIEFNDI 647

>Ecym_2096 Chr2 complement(172230..173636) [1407 bp, 468 aa] {ON}
           similar to Ashbya gossypii AAR060C
          Length = 468

 Score = 32.0 bits (71), Expect = 5.1
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +1

Query: 358 AKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRAL 537
           + +N+DK + K +SMM+  +   + + KKY+ ++  EL    N  +K   IP   L   +
Sbjct: 270 SNQNDDKMVVKVDSMMSKLLPMTTGEPKKYLKLM--ELPQLLNNHIKP--IPPIKLDYTI 325

Query: 538 HEIKILRLGKLFAKIRPPK 594
              K    G+L   I  PK
Sbjct: 326 QVDKTSTYGELVFDIEVPK 344

>Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {ON}
            YNL225C (REAL)
          Length = 581

 Score = 32.0 bits (71), Expect = 5.4
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 2/76 (2%)
 Frame = +1

Query: 1198 NFTNSNSAKAFFDEKFQNPD--MLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLE 1371
            N+ N N         F NPD  +  N  N R    E K  +       +    +ES GL+
Sbjct: 34   NWLNENHVGKSILPLFVNPDDVIKRNFSNVRDSSEENKPPSTDRMNYARTTNLQESPGLQ 93

Query: 1372 DKSVGERQKMKRTTES 1419
            ++S  ER +  + TES
Sbjct: 94   ERSHNERPQSPKVTES 109

>Kwal_56.22646 s56 complement(218373..220415) [2043 bp, 680 aa] {ON}
           YDR485C (VPS72) -  [contig 184] FULL
          Length = 680

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 58  EEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQ 195
           +EDE+   RELE  ERK++ L +  KRK    K + P  E    PQ
Sbjct: 82  DEDEEEGERELEQQERKKRKLAQ--KRKIPLVKQRPPKVEEATKPQ 125

>SAKL0C09746g Chr3 (880534..882699) [2166 bp, 721 aa] {ON} weakly
           similar to uniprot|Q03388 Saccharomyces cerevisiae
           YDR485C VPS72 Protein of unknown function component of
           the Swr1p complex that incorporates Htz1p into chromatin
           required for vacuolar protein sorting
          Length = 721

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 6/48 (12%)
 Frame = +1

Query: 52  SDEEDEQAIARELEFMERKRQALVERLK------RKQEFKKPQDPNFE 177
           +DE+DE+    ELE  ERKR+ L  R K      R ++ +KP+ P +E
Sbjct: 88  ADEDDEE---HELERQERKRRKLASRKKIPVIRRRAEKEEKPKKPQYE 132

>TBLA0E03580 Chr5 (897438..901094) [3657 bp, 1218 aa] {ON} Anc_2.202
            YNL087W
          Length = 1218

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 8/117 (6%)
 Frame = +1

Query: 1360 SGLEDKSVGERQ-KMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGS-------EP 1515
            SG ED+SVG    ++    + +     I+ +  +P  G++  V K  + GS        P
Sbjct: 760  SGSEDRSVGSFDVRLPNLFQKSADDRYIECVDDEPKTGRL--VSKKGIRGSITYYASFYP 817

Query: 1516 KNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSD 1686
               +L  ++  +NDL +  K++ +L    + + KK+  +EE+ +     +E KE S+
Sbjct: 818  TVPVLTLEE--VNDLTNITKKQALLKEKADLYDKKKMSKEELAKMEREERELKELSE 872

>CAGL0J01892g Chr10 (187614..191738) [4125 bp, 1374 aa] {ON} similar
           to uniprot|P32521 Saccharomyces cerevisiae YIR006c PAN1
          Length = 1374

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 8/88 (9%)
 Frame = +1

Query: 343 EKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESF--------SNLWVK 498
           E+ + AKK E ++  K +     +  +F+  E ++  +  +E+E            L V+
Sbjct: 720 EREEAAKKKEQERKTKMDIERARKQGSFTNSEPEFTDVSVSEIEDIKRRITEAQQKLAVR 779

Query: 499 KRYIPEDDLKRALHEIKILRLGKLFAKI 582
            + IP +DLK+  +E+ + RL  LF +I
Sbjct: 780 NQSIP-NDLKKRFNEV-VARLPTLFVEI 805

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 35/143 (24%), Positives = 71/143 (49%), Gaps = 20/143 (13%)
 Frame = +1

Query: 1210 SNSAKAFFDEKFQNPDMLANLDN--KRRKIIETKKSTALSRELGKIMRRRESSG----LE 1371
            S+S K   DEK +  + L  +D    +RK I+ + S+  S+E   ++ RRE  G    LE
Sbjct: 415  SSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLE 474

Query: 1372 DKS---VGERQKMKRTTESALQT-----GLIQRLGFDPTHGK-----ISQVLKSSVS-GS 1509
            +++   V + +K ++T +S   +      +++ L    T  +     ++Q+L+   S   
Sbjct: 475  ERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILD 534

Query: 1510 EPKNNLLGKKKTVINDLLHYKKE 1578
            + K +L  K K +  +++ ++KE
Sbjct: 535  DIKLSLKDKTKNISAEIIRHEKE 557

>ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa]
            {ON} some similarities with uniprot|P47035 Saccharomyces
            cerevisiae YJL076W NET1 Core subunit of the RENT complex
            which is a complex involved in nucleolar silencing and
            telophase exit stimulates transcription by RNA polymerase
            I and regulates nucleolar structure
          Length = 1454

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 41/160 (25%), Positives = 64/160 (40%), Gaps = 8/160 (5%)
 Frame = +1

Query: 58   EEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSHNA 237
            +E+E    R+ E +E+KRQ  +E L RK   KK ++   +  E      K R +V     
Sbjct: 1072 QEEELQGKRQQEELEKKRQ--LEELNRK---KKQEELEKKRKEKEDQERKRREEV----E 1122

Query: 238  TQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNE----DKQIAKFESMM 405
             ++    E     EV+  Q   + K  A       E+ Q  K+ E     +Q AK ++  
Sbjct: 1123 KKKQEDLEKKRQAEVKKKQEDLEKKKQAEVKKKQEEELQRKKQAELDKKKQQDAKKKAKS 1182

Query: 406  NARVHTFSTDEKKYVPIITNELESFSNLWVK----KRYIP 513
             A   T S       P +TN  +    L  +    K Y+P
Sbjct: 1183 AAAKSTISKPATAKSPAVTNGSDKLKELKARFTSPKAYVP 1222

>TPHA0F00400 Chr6 (91892..97645) [5754 bp, 1917 aa] {ON} Anc_4.50
           YLR305C
          Length = 1917

 Score = 32.0 bits (71), Expect = 6.3
 Identities = 20/54 (37%), Positives = 24/54 (44%)
 Frame = +1

Query: 232 NATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKF 393
           NAT  G  FE      + ++     P   A TTT   +KF    KN DK I KF
Sbjct: 519 NATFHGNLFENCISASIVITNNYNVPSITALTTTILTQKFGVISKNLDKIIIKF 572

>TBLA0B04870 Chr2 (1146824..1148233) [1410 bp, 469 aa] {ON} Anc_8.85
           YPL004C
          Length = 469

 Score = 31.6 bits (70), Expect = 6.8
 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 5/99 (5%)
 Frame = +1

Query: 289 SQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKY---VPII 459
           +QLQ  P PPA+T + F  K   A       +      ++ ++      EK Y   + I+
Sbjct: 16  AQLQSPPPPPATTRSKFFGKRSIASSFRRNAVGNLGPELSRKLSQLIKTEKNYLQSLEIV 75

Query: 460 TNELESFSNLWVKKRYIPEDDLKRALHEIKIL--RLGKL 570
            NE    +    +  Y  +DD+     ++ +L   LG+L
Sbjct: 76  ANERRIAARCLSQWGYDNDDDVSDVTDKLGVLLYELGEL 114

>SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON}
           some similarities with uniprot|P53741 YNR051C
           Saccharomyces cerevisiae BRE5 Ubiquitin protease
           cofactor
          Length = 490

 Score = 31.6 bits (70), Expect = 6.9
 Identities = 38/174 (21%), Positives = 72/174 (41%), Gaps = 17/174 (9%)
 Frame = +1

Query: 7   DPREILAVDPYNNITS-DEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAI 183
           +P+ ++     N +T  ++ED++   +E +  E+K +   E+ + K+E KK +    +  
Sbjct: 173 EPKTMVENGGENQVTKINDEDKKDDVKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKE 232

Query: 184 EVPQSPTKNRVK-------VGSHNATQQGTKFEGSNINEVRLSQLQQQP---KPPASTTT 333
           E  +   + R K              +Q  K E     +   S+ Q++    K       
Sbjct: 233 EKKEEKNEERKKEEELKKQAKKEELKKQEKKEESKKEEKKEESKKQEKKEEIKKDDRKEE 292

Query: 334 YFMEKFQNAKKNEDKQIAKFES------MMNARVHTFSTDEKKYVPIITNELES 477
              EKFQ AKK++ K+    +S       +N      STD K+   + TN + +
Sbjct: 293 QVDEKFQGAKKDDAKKDDTRKSELQQPKKLNWASKIASTDSKEVPNVSTNYIRA 346

>Kwal_27.11814 s27 complement(955243..956016) [774 bp, 257 aa] {OFF}
           [contig 27] FULL
          Length = 257

 Score = 31.2 bits (69), Expect = 6.9
 Identities = 24/80 (30%), Positives = 36/80 (45%)
 Frame = -2

Query: 635 RPTVAQLAYSGS*NLGGRILAKSLPNRRILISCKARFKSSSGMYLFLTQRFEKLSNSFVI 456
           RP +  LA   S N  GR+ + S+ +    I   A F            ++EKL  S   
Sbjct: 56  RPEIRGLAKICSFNSEGRVFSNSMNSGSKQIRGSASFHCCDRK-----SKYEKLQTSISS 110

Query: 455 IGTYFFSSVLNVCTLAFIML 396
           +G  F +S+LNV + A + L
Sbjct: 111 LGNNFINSLLNVSSSATLSL 130

>YJR002W Chr10 (438865..440646) [1782 bp, 593 aa] {ON}
           MPP10Component of the SSU processome and 90S
           preribosome, required for pre-18S rRNA processing,
           interacts with and controls the stability of Imp3p and
           Imp4p, essential for viability; similar to human Mpp10p
          Length = 593

 Score = 31.6 bits (70), Expect = 7.2
 Identities = 41/178 (23%), Positives = 76/178 (42%), Gaps = 10/178 (5%)
 Frame = +1

Query: 28  VDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTK 207
           +D + ++ SD+E+E+AI  E +F ++  +   E +K+  + K P++   E  E       
Sbjct: 215 IDYFQDMPSDDEEEEAIYYE-DFFDKPTK---EPVKKHSDVKDPKEDE-ELDEEEHDSAM 269

Query: 208 NRVKVGSHNATQQGTKFEG-SNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQI 384
           ++VK+      +     EG    ++  LS  ++Q           +E+ +N    E K  
Sbjct: 270 DKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQ----IEQLENEAVAEKKWS 325

Query: 385 AKFESMMNARVHTFSTDEK-------KYVPIITNELESFSNLWVKKRYIPE--DDLKR 531
            K E     R       E+       K VP+IT+E+       +++R      DDL+R
Sbjct: 326 LKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQR 383

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 31.6 bits (70), Expect = 7.3
 Identities = 32/147 (21%), Positives = 60/147 (40%), Gaps = 4/147 (2%)
 Frame = +1

Query: 61  EDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE----VPQSPTKNRVKVGS 228
           +++QA    L+  + K+   ++R   K   +K + P F+  +      +  +KN+ K   
Sbjct: 7   KNKQAAPPTLDEFQAKKDRKLKRSNDKDSERKSKKPKFDDKKDVKPKSEKKSKNKKKRSV 66

Query: 229 HNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMN 408
            +  +Q  K E   + EV L +L Q  K          E  Q     E+ ++ K E  + 
Sbjct: 67  EDEEEQQQKEEMEKLPEVDLEELSQAKKSLFDDA----EDVQEQLSGEEDEL-KDEFDLE 121

Query: 409 ARVHTFSTDEKKYVPIITNELESFSNL 489
                 S +E +  P+ ++E E    L
Sbjct: 122 QEYEDDSDEEARAHPMFSDEEEDMEEL 148

>SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} similar
            to uniprot|Q07457 Saccharomyces cerevisiae YDL074C BRE1
            E3 ubiquitin ligase for Rad6p required for the
            ubiquitination of histone H2B recruitment of Rad6p to
            promoter chromatin and subsequent methylation of histone
            H3 (on L4 and L79) contains RING finger domain
          Length = 647

 Score = 31.6 bits (70), Expect = 7.3
 Identities = 42/218 (19%), Positives = 93/218 (42%), Gaps = 9/218 (4%)
 Frame = +1

Query: 22   LAVDPYNNITS--DEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAI--EV 189
            L  +  N ++S  D  D+ A+ +EL+ +E+  + L     +K      +  N E+I  ++
Sbjct: 373  LQTEQINKLSSRCDSNDQNALMKELQDLEKAFKELSSLSHKKYS----EYMNHESIISKL 428

Query: 190  PQSPTKNRVKVGSHNATQQGTKFEGSNI--NEVRLSQLQQQPKPPASTTTYF---MEKFQ 354
                TK   K  +   ++     E  N+  N  + ++L  Q K    T       +EK  
Sbjct: 429  TVEKTKADQKYFAAMRSKDSILIENKNLSKNLSKSNELILQLKDLEKTLQLKIENLEKQM 488

Query: 355  NAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRA 534
               +N +K++ +     + ++   ++   K   ++ N LES +     ++   E  L  +
Sbjct: 489  QLSQNNEKRLIESNKSTSLKIMELTSQVNKSKKLL-NSLESNNKKLTTEKTELESKLNDS 547

Query: 535  LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHK 648
              E+K +++  + A+ +  K  +   +N    G+I+ +
Sbjct: 548  SIELKTMKVRVVHAETKAKKLHKSLISNGGDAGVIAEE 585

>Kpol_1025.48 s1025 complement(124224..126356) [2133 bp, 710 aa]
           {ON} complement(124224..126356) [2133 nt, 711 aa]
          Length = 710

 Score = 31.6 bits (70), Expect = 7.4
 Identities = 29/130 (22%), Positives = 60/130 (46%)
 Frame = +1

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 180
           MN     L +D   +I  DE DE+A  R+   ++R+R  L ++ ++ Q+ K     +   
Sbjct: 572 MNTLGAELFMDIDTHIYEDEIDEEAEDRKTAELKRRRM-LRKKKEKLQKMKLENISSENT 630

Query: 181 IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 360
            EV Q+   + + + + + +     F  + ++  R S         +S++ + +E F++ 
Sbjct: 631 SEVEQTQESDAISLMNSDNSLSNIPFFSTGVD--RPSSSASSVMAESSSSDFEVENFESK 688

Query: 361 KKNEDKQIAK 390
             N   +IAK
Sbjct: 689 GNNISDKIAK 698

>TBLA0D03220 Chr4 complement(785837..789256) [3420 bp, 1139 aa] {ON}
           Anc_8.834 YML111W
          Length = 1139

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 2/133 (1%)
 Frame = +1

Query: 403 MNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALHEIKI-LRLGKLFAK 579
           +++ + TF+T +  +     ++L    N+++ K Y     L R    I+I +RL K   K
Sbjct: 286 ISSNLSTFNTHQVPF----EDDLNDSDNIFIDKLYT----LPRLSTPIEIDIRLTKYATK 337

Query: 580 IRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDV-YIFGKKGV 756
               K Q+       T G + H   +    S+KP+KF MF +T   +T  +    GK+ +
Sbjct: 338 PHE-KPQDESLLKEYTSGDLIHGYCVIQNKSKKPIKFEMFYVTLEAYTSIIDRSIGKRTI 396

Query: 757 ERYYNLRLGDVIA 795
           +R+  LR+ D+ A
Sbjct: 397 KRF--LRMVDLSA 407

>NDAI0F01500 Chr6 complement(369071..372622) [3552 bp, 1183 aa] {ON}
           Anc_6.234 YPL217C
          Length = 1183

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/74 (27%), Positives = 36/74 (48%)
 Frame = +1

Query: 223 GSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESM 402
           G+  +T  GTK   + + +  +SQ+++ P P    T YF +K  + ++ + KQ    E  
Sbjct: 277 GTPLSTISGTKVHIAGVGDFPISQIEKLPDP--CPTPYFQQKIDDYEREKLKQ----ELA 330

Query: 403 MNARVHTFSTDEKK 444
            N    T ST  ++
Sbjct: 331 ANGEASTASTTRRR 344

>Smik_13.326 Chr13 (506186..509977) [3792 bp, 1263 aa] {ON} YMR128W
            (REAL)
          Length = 1263

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 36/156 (23%), Positives = 71/156 (45%), Gaps = 7/156 (4%)
 Frame = +1

Query: 1231 FDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVG-ERQKMKR 1407
            F+EK ++  M    + KR +  +  +    + E+ K       S + D +V  +  K   
Sbjct: 8    FNEKARSGHMAKLKELKRIRNKQFTRQDENNEEMKKSDSDTCESVIADSNVNADVLKPLT 67

Query: 1408 TTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVI 1587
              E  ++   +Q L F P   K+S++ K  +           ++KT+I+ L +YK +  +
Sbjct: 68   EEEKMMKKRKLQEL-FTPKESKVSRLKKKRLDKFIEHQLKREERKTIIDKLQNYKIDTSL 126

Query: 1588 LAPSKNEWFKKRSHREE------VWQKHFGSKETKE 1677
            L  SK     +++ +EE      + ++  GS++TKE
Sbjct: 127  LTSSKKLGEGRQTKKEEFKEALSLERQGRGSEKTKE 162

>Skud_13.288 Chr13 (497303..501121) [3819 bp, 1272 aa] {ON} YMR128W
            (REAL)
          Length = 1272

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 36/156 (23%), Positives = 68/156 (43%), Gaps = 7/156 (4%)
 Frame = +1

Query: 1231 FDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVG-ERQKMKR 1407
            F+EK ++  M    + KR +  +  +      E+ K       S   D +V  +  K   
Sbjct: 8    FNEKARSGHMAKLKELKRVRNKQFTRQDENDEEMKKPDSDSSESNTVDSNVNADILKPLT 67

Query: 1408 TTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVI 1587
              E  ++   +Q L F P   K+S++ K  +           ++KT+I+ L  YK +  +
Sbjct: 68   DEEKKIKKRKLQEL-FTPKESKVSRLKKKRLDKFIEHQLKREERKTIIDKLQDYKIDTSL 126

Query: 1588 LAPSKNEWFKKRSHREE------VWQKHFGSKETKE 1677
            L  SK     +++ REE      + ++  G+++TKE
Sbjct: 127  LTSSKKLGEGRQTKREEFKEALSLERQGRGNEQTKE 162

>TDEL0H03770 Chr8 (632675..636613) [3939 bp, 1312 aa] {ON} Anc_7.74
            YAL024C
          Length = 1312

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 1450 GFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVIL 1590
            G  P  G+IS + K S     P+N LL K +  I DL   +KE  +L
Sbjct: 697  GVRPASGRISLMRKQSPVPLSPQNALLSKAEAAIKDLDFQEKEAELL 743

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 30.8 bits (68), Expect = 8.0
 Identities = 32/166 (19%), Positives = 70/166 (42%), Gaps = 15/166 (9%)
 Frame = +1

Query: 58  EEDEQAIARE-LEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSHN 234
           EE+ +A+ R  L+ +   R+   + +K K +  KP+  + +A+E   +   +   +G  +
Sbjct: 10  EENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFS 69

Query: 235 ATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNAR 414
             ++  KF+  N       +  +Q K          +  + A    +K+++K    +N++
Sbjct: 70  NEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSK----LNSK 125

Query: 415 VHTFSTDEKKYVPIIT--------------NELESFSNLWVKKRYI 510
           +   S ++K  + + T              N L +  N   KKRY+
Sbjct: 126 LENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYM 171

>CAGL0L04708g Chr12 (541185..542444) [1260 bp, 419 aa] {ON} similar
           to uniprot|P53265 Saccharomyces cerevisiae YGR111w
          Length = 419

 Score = 28.1 bits (61), Expect(2) = 8.1
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 11/73 (15%)
 Frame = +1

Query: 370 EDKQIAKFESMMNARVHTFSTDEKKYVPIITN-ELESFSNLW----------VKKRYIPE 516
           ED+ I  F  ++  +   F+ D+ +Y   IT+ E +    +W          + K YIPE
Sbjct: 270 EDRDIFIFSKLLEKKKSPFTVDDLRYGYAITDGEYKDAHIIWHHSWNGNELIITKIYIPE 329

Query: 517 DDLKRALHEIKIL 555
           D  + A    KIL
Sbjct: 330 DRQQNADDIAKIL 342

 Score = 21.6 bits (44), Expect(2) = 8.1
 Identities = 9/28 (32%), Positives = 11/28 (39%)
 Frame = +1

Query: 538 HEIKILRLGKLFAKIRPPKFQEPEYANW 621
           HE K        + +RPP    PE   W
Sbjct: 383 HESKTFLSNGSLSAVRPPHGIHPELVRW 410

>Suva_10.546 Chr10 (948276..954947) [6672 bp, 2223 aa] {ON} YLR430W
            (REAL)
          Length = 2223

 Score = 31.6 bits (70), Expect = 8.3
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 6/157 (3%)
 Frame = +1

Query: 1255 DMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTG 1434
            D+ +N D K+RKI+E    T    +  K  + ++    + K+  +++K K    S+  +G
Sbjct: 1889 DVESNKDAKKRKIVEESDETKKISKKKKKDKEKKKDKKKLKTDEKKKKEKEGESSSTSSG 1948

Query: 1435 LIQRLG-FDPTHGKISQVLKSS--VSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKN 1605
              ++   F  T      V KSS  V+GS+     + KKK   N  + +  +  I+  S+ 
Sbjct: 1949 TKKKSSIFGGTSVANIVVSKSSLDVNGSKKTTADVDKKKK--NRHVCFSDDVSIIPRSEE 2006

Query: 1606 EWFK-KRSHREEVWQKHFGSKETKETSDG--SASDLE 1707
               K  RS    + +K    KETK +S    SASD E
Sbjct: 2007 PEVKVTRSLSSVLKEKKSSLKETKPSSPPPISASDGE 2043

>Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {ON}
            YOR198C (REAL)
          Length = 470

 Score = 31.2 bits (69), Expect = 8.9
 Identities = 37/155 (23%), Positives = 72/155 (46%), Gaps = 10/155 (6%)
 Frame = +1

Query: 1201 FTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKS 1380
            ++     +A FD +F++    A LD +R K  E +K + L               LE K 
Sbjct: 225  YSQIRQIRADFDNEFKS--FRAKLDKERLKREEEQKLSKL---------------LEQKD 267

Query: 1381 VGERQKMKRTTESAL-----QTGLIQR--LGFDPTHGKISQVLKSSVSGSEPKNNLLGKK 1539
            V   +  ++ T + +     + G I+   L  DPT+ K  + + + +S +  +      +
Sbjct: 268  VDMGKLQEKLTHAKIPAFTYEIGAIENSLLVLDPTYVKPKKNILADLSDNVMETK--PAR 325

Query: 1540 KTVINDLLHYKKEK---VILAPSKNEWFKKRSHRE 1635
            K V +DL+    +K   V +APSK++ +KK++ ++
Sbjct: 326  KVVADDLVLVTPKKDDFVNVAPSKSKKYKKKNQQK 360

>Skud_14.208 Chr14 (383074..384528) [1455 bp, 484 aa] {ON} YNL124W
           (REAL)
          Length = 484

 Score = 31.2 bits (69), Expect = 9.0
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 31/129 (24%)
 Frame = +1

Query: 52  SDEEDEQAIARELEFMERKRQALVERLKRKQEF---------KKPQDPNFEAIEVPQSPT 204
           S+  DE+    E EF + +++AL +++K++Q+          K+P D +    + P+ P 
Sbjct: 228 SNGYDEELPEEEQEFSDDEKEALFKKMKKQQQQQQRKKRDNRKQPNDSDNVKSKKPRQPK 287

Query: 205 KNRV-----KVG-SHNATQQ----------------GTKFEGSNINEVRLSQLQQQPKPP 318
              +      VG S NA+ Q                GT F+ +   ++ + Q QQQP+ P
Sbjct: 288 PANLPKLVPPVGMSSNASLQRGYKSRNARENTKRETGTVFDQNRSLQIPMGQ-QQQPQFP 346

Query: 319 ASTTTYFME 345
           A+   Y ++
Sbjct: 347 ANNYPYQLQ 355

>TPHA0C03220 Chr3 complement(707955..708705,708802..708818) [768 bp,
           255 aa] {ON} Anc_2.261 YNL050C
          Length = 255

 Score = 30.8 bits (68), Expect = 9.2
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 13/124 (10%)
 Frame = +1

Query: 262 GSNINEVRLSQLQQQPKPPASTTT------YFMEKFQNAKKNEDKQIAKFESMMNARVHT 423
           G   +EV+L ++  +   P  T T      YF    ++ K+N +K   +F+++   +   
Sbjct: 101 GRGGSEVKLMKISLREPSPEITNTERPDSYYFATYTEDDKRNFEKSAIEFDAIFEDKAIN 160

Query: 424 FSTDEKKYVPII-------TNELESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKI 582
            +   KK+  I+        NEL   +N+  K+R   +  + + L + KI    +L   +
Sbjct: 161 INRPGKKHKIIVLEDYNKKINELNERANILRKRRPGKKQRVAKKLAKEKIKEREQLLKTL 220

Query: 583 RPPK 594
           +  K
Sbjct: 221 KKEK 224

>Smik_14.160 Chr14 complement(298499..300451) [1953 bp, 650 aa] {ON}
           YNL167C (REAL)
          Length = 650

 Score = 31.2 bits (69), Expect = 9.6
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +1

Query: 40  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE 186
           +N+  DE +EQ   R+ EF+ER R A  +  KRK+E+ K  + + +  E
Sbjct: 418 SNVIIDETEEQERKRK-EFLERNRVAASKFRKRKKEYIKKIESDLQFYE 465

>Kpol_1056.49 s1056 complement(123255..124097) [843 bp, 280 aa] {ON}
           complement(123255..124097) [843 nt, 281 aa]
          Length = 280

 Score = 30.8 bits (68), Expect = 9.7
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +1

Query: 379 QIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALHEIKILR 558
           +I  F S M  +       EKK +  + N  ES ++LW    +   +D K A +E  +  
Sbjct: 37  KINSFLSTMRIQFEFHDIPEKKRIHFVANHFESLASLWF---HSWREDNKDASYETFVKA 93

Query: 559 LGKLFAKIRPPK 594
             K F +I  P+
Sbjct: 94  FKKRFERIPDPE 105

>TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON}
           Anc_8.604 YOR195W
          Length = 804

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 9/114 (7%)
 Frame = +1

Query: 85  ELEFMERKRQALVERLKRKQEFKKPQDPN---FEAIEVPQSPTKNRVKVGSHNATQQGTK 255
           +L+  ++  + ++E++K++   K  +D N   ++ IE  +   + + K+ + N      K
Sbjct: 498 QLDQQDKDTKEIIEQIKKELN-KMEEDKNSKEYQIIEFEKKIDELQGKINNQNDELLKLK 556

Query: 256 FEGSNINE------VRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFES 399
                IN+        + QL ++ K   S      EK  N +KN +   AK+ES
Sbjct: 557 ESYDKINDNFEIKNAEVIQLNEEIKELRSNEINLKEKISNDEKNSNDWKAKYES 610

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 160,980,336
Number of extensions: 3705700
Number of successful extensions: 12697
Number of sequences better than 10.0: 83
Number of HSP's gapped: 12568
Number of HSP's successfully gapped: 86
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)