Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL150C (MCM10)5.703ON57157130520.0
Smik_9.195.703ON57257226960.0
Suva_9.385.703ON56957126140.0
Skud_9.185.703ON57157125530.0
NCAS0G002205.703ON59257115990.0
KAFR0D022105.703ON58458715170.0
TDEL0B021705.703ON56757614860.0
KNAG0L021505.703ON61661314400.0
NDAI0F002805.703ON61061214120.0
ZYRO0G06578g5.703ON56957914040.0
Kpol_1043.715.703ON58558513960.0
CAGL0H06589g5.703ON58359613930.0
TPHA0E002105.703ON54455413331e-179
TBLA0G010205.703ON59460013121e-175
SAKL0E14938g5.703ON57459011771e-155
KLTH0E01034g5.703ON58356411551e-151
Kwal_55.196915.703ON46647410551e-138
AFR287W5.703ON6116199921e-127
KLLA0A00572g5.703ON5775909361e-119
TBLA0E030806.42ON68973761.4
YNL167C (SKO1)2.86ON64739742.0
KLLA0F24024g2.153ON12261674.1
KAFR0A074102.91ON353128705.1
TBLA0D032208.834ON1139134707.3
CAGL0K11990g3.273ON991144707.7
Suva_14.1712.86ON65239699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL150C
         (571 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...  1180   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...  1043   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...  1011   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   988   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   620   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   588   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   577   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   559   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   548   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   545   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   542   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   541   0.0  
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   518   e-179
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   509   e-175
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   457   e-155
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   449   e-151
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   410   e-138
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   386   e-127
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   365   e-119
TBLA0E03080 Chr5 (774631..776700) [2070 bp, 689 aa] {ON} Anc_6.4...    34   1.4  
YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON} ...    33   2.0  
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...    30   4.1  
KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2...    32   5.1  
TBLA0D03220 Chr4 complement(785837..789256) [3420 bp, 1139 aa] {...    32   7.3  
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    32   7.7  
Suva_14.171 Chr14 complement(315525..317483) [1959 bp, 652 aa] {...    31   9.2  

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/571 (100%), Positives = 571/571 (100%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120
           IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180
           KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH
Sbjct: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480
           LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI
Sbjct: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 541 RSHREEVWQKHFGSKETKETSDGSASDLEII 571
           RSHREEVWQKHFGSKETKETSDGSASDLEII
Sbjct: 541 RSHREEVWQKHFGSKETKETSDGSASDLEII 571

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/572 (87%), Positives = 534/572 (93%), Gaps = 1/572 (0%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           M+DPREILAVDPYN++TSDEEDEQAIA+ELEFMERKRQAL+ERLKRKQ FKKP DPNFEA
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120
           IEVPQSPTK+RVK GS NA +Q T+ E SN NE  LSQ+Q+QP+ P +TTTYFM+KFQNA
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180
           KK+ED+QIAKFESMM+ARVHTF TD KKY PII NELE FSNLWVKKRYIPEDDLKR+LH
Sbjct: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRLGKLFAK+RPPKFQ PEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN KTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KV+SQPSLYKAKGEN FNII+  RK LSEEEER+KKSSHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480
           LANLDNKRRKI +TKKS AL+REL KIMRR+ESSGLEDKS GE+QKMK+TTE+ALQTGLI
Sbjct: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHG+IS+VLKSSV G E KNNLL  KKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 541 RSHREEVWQKHFGSK-ETKETSDGSASDLEII 571
           R+HREEVWQ+HFG K E +E SD SASDLEII
Sbjct: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/571 (84%), Positives = 525/571 (91%), Gaps = 2/571 (0%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           M+DPREILAVDPYNN+TSDEEDEQAIA+ELEFMERK+QAL+ERLKRKQ+FKKP+DPNFEA
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120
           +EVPQSP K  +   S +A +Q  +   SNINE  LSQ  Q+   P++TTTYFM+KFQ+A
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES--PSNTTTYFMQKFQDA 118

Query: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180
           K+NEDKQIAK+E MMNARVHTF TD K+Y PIITNELESFSNLWVKKRYIPE+DLKRALH
Sbjct: 119 KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178

Query: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRL KLFAKIRPPKFQEP+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 179 EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238

Query: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           +LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 239 SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298

Query: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVNKKTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 299 GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358

Query: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KVDSQPSLY+AKGEN FNI++ TRK LSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 359 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418

Query: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480
           LANLD+KRRKII+TKKSTALSRELGKIMRR++SSGLEDKS GE+QKMK+TTESALQTGLI
Sbjct: 419 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478

Query: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGKIS+VLKSSV G E   N +  KKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 479 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538

Query: 541 RSHREEVWQKHFGSKETKETSDGSASDLEII 571
           RSHREEVWQ+HFGSKET+  SD S SDLEI+
Sbjct: 539 RSHREEVWQRHFGSKETEVASDASGSDLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/571 (81%), Positives = 522/571 (91%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           M+DPRE L  DPYNN+TSDE+DEQ IA+ELEFMERK+QALVERLKRKQEFK+ +DPNFEA
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120
           IEVPQSP KNR  + S N  ++  +   SNIN+++LSQLQQ+ + P++TT YFM+KFQNA
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180
           K+NE+KQ AK+E+MMNARVHTF TD+K+Y   I NELE FSN+WVKKRYIPEDDLKRALH
Sbjct: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRLGKLFAKIRPPKFQEP+YANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKK VERYYNLRLGDVIAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN+K ++ CGSPINI+LHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KVD+QP+LY+AKGEN FN+++  RK LSEEEER+KK+SHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480
           LANLD+KRRKII++KKSTALSRELGKIMRR+ SSGLEDK   E+QK+K+TTESALQTGL+
Sbjct: 421 LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGKIS+VLKSSV G EP+N ++G KKTVI+DLL+YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 541 RSHREEVWQKHFGSKETKETSDGSASDLEII 571
           RSHREEVWQKHFGSK+T E SD S SDLEI+
Sbjct: 541 RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/571 (55%), Positives = 423/571 (74%), Gaps = 23/571 (4%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           MNDPRE+L  DPY+N++SDE+DE+AI R+LE +ERKRQ L+ R+K KQE KK  DPNF+ 
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  IEVPQSP---TKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKF 117
           ++VP SP   T+  V V    +T +  +    N NE+R+ +   Q   P++TTTYFMEKF
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNE-MEIPHENPNELRIREKSGQL--PSNTTTYFMEKF 117

Query: 118 QNAKKNEDKQIAKFESMMNARVHTFSTD--EKKYVPIITNELESFSNLWVKKRYIPEDDL 175
           Q +KK E+ +I K E+MMNARVHTF     ++++ PI  NE+E +SN+W+KKRYIP+ +L
Sbjct: 118 QKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSEL 177

Query: 176 KRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 235
           ++ LH IKILRL KLFAK+RPPKF EP+Y+NWA +G+IS K D KFT+++KP K+  FT+
Sbjct: 178 RKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTM 237

Query: 236 TDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFK 295
           TDFQH LDVYIFGK GVERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDFK
Sbjct: 238 TDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFK 297

Query: 296 CILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYA 355
           CILEIGSS+DLG+C + + +    C +PIN+S    CDYH+E++FR  ++KRIELNG +A
Sbjct: 298 CILEIGSSKDLGFCKVTS-RNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFA 356

Query: 356 LGAPTKVDSQPSLYKAK-GENGFNIIKGTRKRLSEE-------EERLKKSSHNFTNSNSA 407
           LGAPTKV++ P+LY+ K GE   +  +  R+  S         +++    + +F+N+NSA
Sbjct: 357 LGAPTKVENNPTLYRKKNGETRHS--RKNRQNFSVSASFGSINKDQFDLRNRHFSNNNSA 414

Query: 408 KAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKM 467
           KAFFDEKFQNPDML NL++KRRKI + KK T + +EL K +  R S  L ++S  E ++M
Sbjct: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474

Query: 468 KRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNL---LGKKKTVINDLLHYK 524
           KR TE+ LQ+G+IQRLGFDPTHGKI+ VL+++ S  E K+ L   +  KK  +NDLLH++
Sbjct: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEE-KDTLSEQMSGKKDKVNDLLHFR 533

Query: 525 KEKVILAPSKNEWFKKRSHREEVWQKHFGSK 555
           K  VILAP++NE  ++R  RE +WQ++FG K
Sbjct: 534 KSHVILAPTRNELIERRDRRERIWQENFGQK 564

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/587 (50%), Positives = 409/587 (69%), Gaps = 19/587 (3%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           M+DPREI   D Y NIT D+ED + I  ELE +E  ++ L+ERL RK+   + +DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  IEVPQSPTKN---RVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPA------STTT 111
           ++VP SP K    ++        +   +FE SN N   L   Q+  K  A      ++T 
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 112 YFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKK--YVPIITNELESFSNLWVKKRY 169
           YFMEKF++AK+ E   I K ESMM +RVHTF+  E K  Y  +I +ELE +SNLW+ KRY
Sbjct: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 170 IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVK 229
            P  +LK  LHE+KILRL KLFAK+RPPKF+EP+Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 230 FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLR 289
           +  FT+TDF+H +D YIFGK+GVERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 290 ISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIE 349
           ISH +KCILEIG SRDL  CPIV + T K+CG PIN  + +CC+YHRE++ R   +KR++
Sbjct: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 350 LNGGYALGAPTKVDSQPSLYKAKGE-----NGFNIIKGTRKRLSEEEERLKKSSHNFTNS 404
           L+G YALGAPTK++SQP+LY+           F +     +      ++  + S  F+N 
Sbjct: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 405 NSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGER 464
           N+AKAFFD++FQNPDM++NLDNKRRKI+E +KS  L+REL +++R+     LE K+  E 
Sbjct: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478

Query: 465 QKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYK 524
           +KMK+TT+  LQ+GL Q++GFDPT GKIS++LK+     + +   L +K   ++DL+ +K
Sbjct: 479 EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538

Query: 525 KEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 571
           KE +ILAPSK +   K++ RE+VWQ++FG  ++ + S+ S SDLEI+
Sbjct: 539 KEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSE-SDSDLEIV 584

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/576 (50%), Positives = 405/576 (70%), Gaps = 14/576 (2%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           MNDPRE++  DP+  +TSDEED++ +  ++  +ER+++ LVERLK K++ K  +DPNF+A
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120
           I+V  SP K   +      ++     +  N+NE    +++ + + PA+TT+YF++ F+N+
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLDIENLNE---KKVESRSQIPANTTSYFIDNFRNS 116

Query: 121 KKNEDKQIAKFESMMNARVHTFS--TDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRA 178
           KK E K   + + +++ RVHTF       K+  +   E+E +S+LWVK+RYI +DDL++ 
Sbjct: 117 KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 179 LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238
           LHE+KILRL KLFAKI+PPKF EP+Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 239 QHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298
           Q+ LDVY+FGKKGVERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 299 EIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358
           EIG SRD+ WC   NK  +K CG+PIN +  KCCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 359 PTKVDSQPSLYKAKGENG---FNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKF 415
           PTKVDS P+LY+ K       F ++    ++   +   L+    +F+N N+AKAFF+++F
Sbjct: 357 PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLR--GIHFSNGNAAKAFFNDEF 414

Query: 416 QNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESAL 475
           QNPD+L NLD+KRRK  + KKS  L ++L +I  R  +  +E K   + +++  TTE+ L
Sbjct: 415 QNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEATL 473

Query: 476 QTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKN 535
           Q+GLIQ LGFDPTHG+I  VLK + +  +  N  L KK+  ++ LL +KKE V L P+K 
Sbjct: 474 QSGLIQNLGFDPTHGEIGNVLKQA-AKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532

Query: 536 EWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 571
              +++  RE  WQ++FG K    +SD S SD+EI+
Sbjct: 533 VLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/613 (46%), Positives = 409/613 (66%), Gaps = 44/613 (7%)

Query: 3   DPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA-I 61
           DPR+++  DPY+NITSDE++E  I RELE MER+++ L +RLK K+   KP D N +  +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  EVPQSPTKNRVK--------------VGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPA 107
           +VP SP K  V               +   N +      +  N+NE R +QL       +
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 108 --STTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWV 165
             +TT+YF+EKFQ +KK E  +I   E+M++ARVHTF   +K++     NELE FS+LW+
Sbjct: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183

Query: 166 KKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSE 225
            KRYIP+  L+ +L ++K+LRL KLFAK+RPPKFQEP+Y+NWA + +IS KS++KFT+S+
Sbjct: 184 SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243

Query: 226 KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG---RGNF 282
            P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GD++A+LNPE+LPWRPSG   +   
Sbjct: 244 NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303

Query: 283 IKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRG 342
           IKSFNL+I+H FKCILEIG SRDLG+CP+  K +++KCGS IN++  + C+YHRE+Q R 
Sbjct: 304 IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363

Query: 343 TSAKRIELNGGYALGAPTKVDSQPSLYK-AKG---ENGFNIIKGTRKRLSEE-------- 390
            S+KR++LNGG+ALGAPTKV +QP L++ A G   ++  ++ +   KR   E        
Sbjct: 364 NSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSRHG 423

Query: 391 -----EERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELG 445
                EE        FT+SN+AKAFFD++FQNPDML NLD KRRK+ ++KKS  L R+L 
Sbjct: 424 QGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRKLK 483

Query: 446 KIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLK--SSVSGS 503
           +++ + E     DK+  E   +KRTTE+AL TGLIQRLGFDPTHG+ + V+K   S  GS
Sbjct: 484 RLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSERGS 543

Query: 504 EPKNNL-LGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK----ETK 558
               ++ L +K+ ++N+LL +K++K  L PS+ +   ++ HR EVW++ FG K    +++
Sbjct: 544 GANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPVDSQ 603

Query: 559 ETSDGSASDLEII 571
              +  + DLEI+
Sbjct: 604 PVDNDDSDDLEIV 616

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/612 (47%), Positives = 404/612 (66%), Gaps = 43/612 (7%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           MNDPRE    DP+ +++  EE+E A+  ELE ++R++  L+ RLK  +E +K +DPNF+ 
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  IEVPQSPTKNRVKVGSHNAT-----------QQGTKFEGS---NINEVRLSQLQQQ-PKP 105
           +++P +P +    + +   T            +  +F G    N NE+++ + ++   K 
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 106 PASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK-------KYVPIITNELE 158
           P++TT+YFMEKFQ+ KK E+ +  + E M+ ARVH F    K       +Y P   NE+E
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 159 SFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSD 218
            +S L ++KRYIP+ +L      IKILRL KLFAK+RPPKF+EP+Y+NW T+G+I+ K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 219 IKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 278
           IKFTSS+KP K+F FTI+DF++ +D++IF K  VERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 279 --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHK-KCGSPINISLHKCCDYH 335
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI NK      C +PI+IS    C YH
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 336 REVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKG--------ENGFNIIKGTRKRL 387
           +E++FR   +KRIELNG +ALGAP KV +QP LY+            N FN++KG+  R 
Sbjct: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 388 SEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKI 447
           +E +   ++    F+++NSAKAFFDEKFQNPDML NLD KRRKI + K+S  L +EL K 
Sbjct: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 448 MRRRESSGLE-DKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPK 506
           +  + S+ L  +K+  E  KMK  TE+ LQTG+IQRLGFDPTHGKI++VL++       K
Sbjct: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG--K 538

Query: 507 NNLLGKKKTV-INDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS------KETKE 559
           +N+    K   + DLL +KK KV+LAP+K E  K+++ REEVWQKHFGS      +   +
Sbjct: 539 DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLND 598

Query: 560 TSDGSASDLEII 571
             D S SDLEI+
Sbjct: 599 DVDTSESDLEIV 610

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/579 (48%), Positives = 398/579 (68%), Gaps = 19/579 (3%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           M DPRE+L  D Y+ +TS+ E+E  I  ++  +ER+++ L++RL  K+   KP DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFE--GSNINEVRLSQLQQQPKPPASTTTYFMEKFQ 118
           I+V  SP K    V      QQ  + E    N+NE++    Q Q + PA+TT++F+EK+ 
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKA---QSQEQIPANTTSFFIEKYS 117

Query: 119 NAKKNEDKQIAKFESMMNARVHTF--STDEKKYVPIITNELESFSNLWVKKRYIPEDDLK 176
            +K+ +D ++   E +++ RVHTF  +  + +Y PI TNELE FSNLW+ KRYIP+++ +
Sbjct: 118 TSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQR 177

Query: 177 RALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTIT 236
                IKILRL KLFAK++PPKF EP Y+NWA +GLIS+K ++KFTS+  P K+F FT+T
Sbjct: 178 SIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLT 237

Query: 237 DFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKC 296
           +FQ+++D YIFGK+GVERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+C
Sbjct: 238 NFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFEC 297

Query: 297 ILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYAL 356
           ILEIG+SRDLGWCP+ NK  ++ C +PIN     CC+YHRE++FR T+AKR+EL+G YAL
Sbjct: 298 ILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYAL 357

Query: 357 GAPTKVDSQPSLYKAKGEN---GFNII-KGTRKRLSEEEERLKKSSHNFTNSNSAKAFFD 412
           GAPT++D+QP+LY+         +NII  G     ++E   L  ++ +F+N N+AKAFFD
Sbjct: 358 GAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFD 417

Query: 413 EKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTE 472
           E+FQNP+ L NL+NKRRK+ + +KS  L+REL    ++     ++ KS  E  ++KRTTE
Sbjct: 418 ERFQNPETLRNLENKRRKLRDNRKSNILNREL----KKNSELDIKHKSAEEIDEIKRTTE 473

Query: 473 SALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAP 532
           S + +G+++ LGFDPT GKI+ V K   S S+ K   L +K + +  LL +KK+ V L P
Sbjct: 474 STMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKK--PLTEKDSSVASLLSFKKDNVKLKP 531

Query: 533 SKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 571
           SK    K++  RE VW++HFGS    +  D S SDLEI+
Sbjct: 532 SKEILIKQKRRRERVWKEHFGS--GGDEKDDSDSDLEIV 568

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/585 (48%), Positives = 400/585 (68%), Gaps = 26/585 (4%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           MNDPRE    D Y+N++SDE ++  I+ +L+ +ER++Q L+ERLK+K+E K   DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120
           ++VP SP K+RV V     ++     E           L  +      TT+YFMEKF N+
Sbjct: 59  VQVPSSPKKSRV-VELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNS 117

Query: 121 KKNEDKQIAKFESMMNARVHTFST--DEKKYVPIITNELESFSNLWVKKRYIPEDDLKRA 178
           KK+ ++++  + SMM++RVHTFS    +K++ P   +EL+ +SNLW++ RYIP D+L   
Sbjct: 118 KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177

Query: 179 LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238
           L +IKILRL KLFAK+RPPKF EP+Y+NW   G+I+ K DIK+TSS KP K+F FTI+DF
Sbjct: 178 LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237

Query: 239 QHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS----GRGNFIKSFNLRISHDF 294
           QH LDV+IFG KGVE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSFNLRISH F
Sbjct: 238 QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297

Query: 295 KCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 354
            CILEIG+SRDLGWCPI N   +  C +PIN S    C YHRE+QFR T++ R+EL+G Y
Sbjct: 298 DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357

Query: 355 ALGAPTKVDSQPSLYKAKG-------ENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSA 407
           ALGAPTKVD++P+LY+ +G       +  +N++  +  +  ++  +L+   H+F+  NSA
Sbjct: 358 ALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSA 417

Query: 408 KAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKM 467
           KAFFDE FQNPD+L NLD+KRRKI ++K    + R L K ++        DK     + +
Sbjct: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKNFKNL 468

Query: 468 KRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEK 527
           K  T++ LQTG++QRLGFDPT GK+S V+++S S +E  N    +KK  ++DL+ ++K+ 
Sbjct: 469 KNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDT 528

Query: 528 VILAPSKNEWFKKRSHREEVWQKHFGSKETK-ETSDGSASDLEII 571
           V L PSK++  K+R  R+  W+K FG +++  + +D S SDL+I+
Sbjct: 529 VNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/596 (47%), Positives = 399/596 (66%), Gaps = 45/596 (7%)

Query: 2   NDPREILAVDPYNNITSDE-EDEQAIARELEFMERKRQALVERLK--RKQEFKKPQDPNF 58
           NDPRE+  +DPY +++ D+ E E  I RELE +ERK+Q L+ RLK  +++   K  DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  EAI------EVPQSPTKNRVKVG---SHNATQ----QGTKFEGSNINEVRLSQLQQQPKP 105
           + I      EVP+SP +  +       HN  Q    Q    + +N NE     + ++   
Sbjct: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNE---EDIVRKELD 123

Query: 106 PASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTF--STDEKKYVPIITNELESFSNL 163
             +TT+YF  KF+N+K +E++ +  ++ MM+AR HTF  ST       I  +ELE +SN 
Sbjct: 124 VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183

Query: 164 WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 223
            +KKRYIP+D++ + LH IKILRL KLFAK+RPP F EP+Y+NW  +G IS K D+K T+
Sbjct: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243

Query: 224 SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 283
           + KPVK+F FT+TDF+H LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N I
Sbjct: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303

Query: 284 KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGT 343
           KSFNLRI HDF CILEIG+SRDLGWC +VN    K C SPIN    +CC++HRE+Q R T
Sbjct: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363

Query: 344 SAKRIELNGGYALGAPTKVDSQPSLYKAK--------GENGFNIIKGTRKRLSEEEERLK 395
           ++KRIEL+G YALGAPTKV +QPS+YK           ++    I G   +  +E+E+ +
Sbjct: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKHE 423

Query: 396 KSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSG 455
             +H+F+N  +AKAFFD+ FQ+P +LANL++KRRKI    K++ + R L K +   ++S 
Sbjct: 424 IEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDASQ 479

Query: 456 LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 515
            ++K     Q++K  TE  LQTG+IQRLGFDP+ G+I++VL  S  G++  +  + KK  
Sbjct: 480 SKNK-----QQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKS-RGTKTDDPTISKKMG 533

Query: 516 VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 571
           +INDL+H+KK+K+ L PS+    +KR  RE +W+KHF     ++T+D S SDLEI+
Sbjct: 534 LINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF-----QDTND-SDSDLEIV 583

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  518 bits (1333), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 272/554 (49%), Positives = 360/554 (64%), Gaps = 33/554 (5%)

Query: 41  VERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSH-NATQQGTKFEGSNINEVRLSQL 99
           ++RLK K+E +K  DPNF  I++ +SP K +    +  N        E  N NE ++   
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVS- 59

Query: 100 QQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTD--EKKYVPIITNEL 157
                 PA+TT+YFM+ F  AKK E KQ+ +++  M++RVH+F+     KKY  II  EL
Sbjct: 60  --NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117

Query: 158 ESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKS 217
           E +S   + KRY+P++++ + LH IKILRL KLFAKIRPPKF EP+YANWA  G+I  K 
Sbjct: 118 EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177

Query: 218 DIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 277
           DIK TSS+ PVKFF FTIT+FQHTLD++IFG  GVE+YYNLR+GD+I ILNPEVLPWRP 
Sbjct: 178 DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237

Query: 278 GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHRE 337
            +GN IKSFNLRISH F CILEI  S+D+ WC  +N+KT  KC +PIN S    CDYH+E
Sbjct: 238 FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297

Query: 338 VQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGE------NGFNIIKGTRKRLSEEE 391
           +QFR  +AKR+EL+G YALGAPT++DS+P+LY++K        N FNI+   R    +E 
Sbjct: 298 MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357

Query: 392 ERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRR 451
           + +    H+F++SNSAKAFFDE FQNPDML NL+NKRRKI + K+   L R L      R
Sbjct: 358 DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRAL------R 411

Query: 452 ESSG-----LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPK 506
           ES G     L+DKS  E Q M+ TT++ LQ G IQ+LGFDPT G+I  VL+ S   S  +
Sbjct: 412 ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKST-Q 470

Query: 507 NNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS---------KET 557
           + L  +K   + +L+ +KK  V L PS+    +K  HRE+ + ++  S         K  
Sbjct: 471 SKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSA 530

Query: 558 KETSDGSASDLEII 571
              +D  + DLEII
Sbjct: 531 STKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  509 bits (1312), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 264/600 (44%), Positives = 392/600 (65%), Gaps = 35/600 (5%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           MNDPRE+   D ++NI+ DE++E  + +++E +ER+++ L ERL+ K++  +  DPNF +
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 61  ------------IEVPQSPTKNRVKVGSHNATQQGTKFEG--SNINEVRLSQLQQQPKPP 106
                       I+VP SP K + K     AT    K  G   N NE++L    +    P
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 107 ASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFS--TDEKKYVPII-TNELESFSNL 163
           A +T YFM  F ++KK E ++I  +E++M+ARVH+F   T+ +K   II   E E +S L
Sbjct: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 164 WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 223
           W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P+Y+NW  VG+I+ KS  K TS
Sbjct: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 224 SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 283
           S  P K+F FTI DFQ  + +++F ++ + +YYNLR+GD+I ILNP + PWRPS    +I
Sbjct: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 284 KSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKKCGSPINISLHKCCDYHREVQFRG 342
           KSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN +  KCC++HRE +FR 
Sbjct: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 343 TSAKRIELNGGYALGAPTKVDSQPSLYKAK-----GENGFNIIKGTRKRLSEEEERLKKS 397
            +AKRIELNG +ALGAPTK D+ PSLYK K      +N FN++   R+R + +E   K  
Sbjct: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVV---RRRNARKEGDSKLH 417

Query: 398 SHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRE--SSG 455
           + NF ++N AKAFF+++FQNPD+++NLD+KRRK+ + K+ + L +EL K + + +  S  
Sbjct: 418 NSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 477

Query: 456 LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 515
           LE KS  + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S +G +P  +    +  
Sbjct: 478 LEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSN 534

Query: 516 VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFG--SKETKET--SDGSASDLEII 571
            +NDLLH+KK+KV L P K++   K+  R+E+W ++FG  SK  ++   S G  SDLEI+
Sbjct: 535 AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  457 bits (1177), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 246/590 (41%), Positives = 379/590 (64%), Gaps = 35/590 (5%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           M DPRE   +D ++ ++ DE+D+  + + L+ +ER+++ L +RL+   + KK  DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  IEVPQSPTKNR---VKVGSHNATQQGTKFEG-SNINEVRLSQLQQQPKPPASTTTYFMEK 116
           +EVP+SP+K++   VK  S +   + + F    N+NE+   Q+Q++    + +T YF + 
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNEL---QVQKKASLSSISTPYFAQN 115

Query: 117 FQNAKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNELESFSNLWVKKRYIPEDD 174
           F ++KK ++ +  +   M+N RVHTF   +  ++Y PI  NE E FS  W+ KRYI  + 
Sbjct: 116 FSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQ 175

Query: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 234
            ++ L E K+LRL KLFAK+RPP F EP+Y+NW T+G+IS KS +K T+  KP ++F  T
Sbjct: 176 ARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLT 235

Query: 235 ITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS------GRGNFIKSFNL 288
           +TDF+HT+++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL
Sbjct: 236 LTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNL 295

Query: 289 RISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRI 348
            I H+F  ILEIG+SRD G+C I NK   K CG+PIN S+   C YH+EVQFR  +AKR+
Sbjct: 296 CIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRL 355

Query: 349 ELNGGYALGAPTKVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHN---FTNSN 405
           ELNG  +L +PTK   +  LY       ++++     R + + +   K S N   F+N N
Sbjct: 356 ELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPD---RYAPQTQ--SKDSQNVLYFSNPN 410

Query: 406 SAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQ 465
           +A+AFFD+ +QNPD L NLD+KRRK+   KK   L ++L +++ +  S+  ++++  ++ 
Sbjct: 411 AARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQD 470

Query: 466 KMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKK 525
           +++R T++AL++GLI+++GFDPT G++S VLK++  G + +      K + + ++L  KK
Sbjct: 471 EIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVEEILQIKK 525

Query: 526 EKVILAPSKNEWFKKRSHREEVWQKHFGSKETK----ETSDGSASDLEII 571
           EK+ L PSK    +K   REEVW  HF  +E      E+SDG  S+LEI+
Sbjct: 526 EKIELKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  449 bits (1155), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 235/564 (41%), Positives = 361/564 (64%), Gaps = 22/564 (3%)

Query: 3   DPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE 62
           DPRE+L +D ++ +TSDE+++  I ++L+ +ER+++ L +RL++K   KK Q  + E +E
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 63  VPQSPT---KNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQN 119
           VP SP    K++    S  +++  T    SN + + +         P++TT+YF+E F N
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPW----KNGPSNTTSYFVENFVN 121

Query: 120 AKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNELESFSNLWVKKRYIPEDDLKR 177
           A+K E+++I    S+++ RVHTF   +  K   P+  +E E +S   + +RY+   +L  
Sbjct: 122 ARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDE 181

Query: 178 ALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITD 237
            + EIK+LRL KLF+K+RPPKF EP+YANW  +G+IS KS++K TSS KP K+F  T+TD
Sbjct: 182 IMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTD 241

Query: 238 FQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FIKSFNLRIS 291
           F H LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS   N       +KSFNL I 
Sbjct: 242 FTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIR 301

Query: 292 HDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELN 351
           H+F C+LEIG+S+DLG+C I NK T K CG+PIN +    C+YH++V+FR  +A+R+ELN
Sbjct: 302 HNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELN 361

Query: 352 GGYALGAPTKVDSQPSLYKAKG-ENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAF 410
           G  +L +P K   + +LY   G +    ++    K   + ++   +++  F+N N AKAF
Sbjct: 362 GSTSLRSPVKNGKKQALYGTSGVKRKLQLLPD--KHAPQAQDGESQNTLFFSNPNYAKAF 419

Query: 411 FDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRT 470
           FD+ +QNPDML NL+NKRRK+ +++K   L  +L   + +       +KS  E+++MK  
Sbjct: 420 FDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDA 479

Query: 471 TESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVIL 530
           TE  L +GL++ +GFDP  GK+ +VLK   +     N+ L  K + + +++ +KK  V L
Sbjct: 480 TEQVLNSGLLRDIGFDPFRGKMREVLKFGKNV----NSGLNSKSSQVKEIMSFKKSNVSL 535

Query: 531 APSKNEWFKKRSHREEVWQKHFGS 554
           APSK E  K+   RE+VW++HF +
Sbjct: 536 APSKAEQKKRLLRREQVWREHFDT 559

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  410 bits (1055), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 213/474 (44%), Positives = 305/474 (64%), Gaps = 24/474 (5%)

Query: 114 MEKFQNAKKNEDKQIAKFESMMNARVHTF----STDEKKYVPIITNELESFSNLWVKKRY 169
           ME F N++K E+ +I     M+++RVHTF    +T  +K  PI   E E  S LWV +RY
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRK--PIAVEEKEPASGLWVSRRY 58

Query: 170 IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVK 229
           I  D+L   L +IKILRL KLF+K+RPPKF EP+YANW  VG++ HKS +K TSS KP K
Sbjct: 59  IASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTK 118

Query: 230 FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FI 283
           +F  TITDF H+LDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +
Sbjct: 119 YFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASV 178

Query: 284 KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGT 343
           KSFNL I  ++ C+LEIG+SRDLG+C I NK   K CG+PIN +    CDYH+E++FR  
Sbjct: 179 KSFNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQV 238

Query: 344 SAKRIELNGGYALGAPTKVDSQPSLYKAKG-ENGFNIIKGTRKRLSEEEERLKKSSHNFT 402
           +A+R+ELNG  +L +P K   + +LY + G +   N++    K   ++++R  +++  F+
Sbjct: 239 NAQRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFS 296

Query: 403 NSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVG 462
           N N AKAFFD+ +QNPD+L NLD+KRRK+ +T+    L  +L + + +       +K+  
Sbjct: 297 NPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQ 356

Query: 463 ERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLH 522
           E+++MK+ TE  + +GL++ +GFDPT GK+  VLK    G   KN+    K   + +++ 
Sbjct: 357 EQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLK---VGKNSKNS-TDTKSIQVREIIE 412

Query: 523 YKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKET-----SDGSASDLEII 571
            +K  V LAPSK +  K+   RE+VW++HF +K          SD S SDLEI+
Sbjct: 413 TRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  386 bits (992), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/619 (36%), Positives = 347/619 (56%), Gaps = 62/619 (10%)

Query: 1   MNDPREILAVDPYNNITSDEEDE-----------------------QAIARELEFMERKR 37
           +NDPREI+    Y+ I SDEED                          +   L+ +E +R
Sbjct: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  QALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNR-VKVGSHNATQQGTKFEGSNINEVRL 96
             L+ RL+  +   K +      +EVP+SPTK + V+     +T   T +          
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 97  SQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK--KYVPIIT 154
             L     P   TT+YF EKF  A+ +    + + + ++  RV+TFS  +   +Y     
Sbjct: 125 RYLLSANTP---TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAV 181

Query: 155 NELESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLIS 214
           +E+E++SN+ + KRY+PE+DLKR LH+IK+LRL KLFAK+RPPKF EP+YANW T+G IS
Sbjct: 182 DEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAIS 241

Query: 215 HKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPW 274
           +KSD+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ PW
Sbjct: 242 YKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPW 301

Query: 275 RPSGRG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISL 328
           + S +          +SF L I H+  CILEIG S++LG+CP +NK     CG+PIN   
Sbjct: 302 KESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLK 361

Query: 329 HKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGENGFNI-----IKGT 383
            + C YH+E   R  +AKR+ELNG  +L APT+   Q + Y  +  +G  I     +   
Sbjct: 362 EQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAP 421

Query: 384 RKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRE 443
           R   +E++ R      +F ++N+ +A+FD  + NPD+L NL++KRRKI  +KK   ++++
Sbjct: 422 RAPGAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476

Query: 444 LGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGS 503
           L  ++ +  +   +  S    Q+ ++ T++ ++TG+++ +GFDPT G+++ VL     G 
Sbjct: 477 LSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHG- 535

Query: 504 EPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHF---------GS 554
            P + +   ++  I+++L  KK  + L PSK    K+   R EV+   F         GS
Sbjct: 536 -PADTV---REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGS 591

Query: 555 KETKETSDGSASD--LEII 571
            ET + S   +SD  LEI+
Sbjct: 592 CETAQLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  365 bits (936), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/590 (36%), Positives = 344/590 (58%), Gaps = 36/590 (6%)

Query: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60
           + DPREI A DPY  ++ DE + + + R +  ++ +++ L  RL   ++ +  +DPNF++
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  IEVPQSPTKNR-----VKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFME 115
           I+VP+SP K+      ++   H A     +    N+NE  + +  ++      TT+YF E
Sbjct: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK----LGTTSYFTE 120

Query: 116 KFQNAKKNEDKQIAKFESMMNARVHTFSTDE-KKYVPIITNELESFSNLWVKKRYIPEDD 174
           K ++   NE + I + + ++  RV+TF+ D   +Y PI  +E +  S L + +RY+P   
Sbjct: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 234
           L++    IK+LRL KLF+K+R PKF EP+Y NW  +G+IS K++ + T+S KPVKFF  T
Sbjct: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 235 ITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWR--PSGRGNFIKSFNLRISH 292
           I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 293 DFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 352
           D   ILE+G S++ G C    K   K CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 353 GYALGAPTKVDSQPSLYKAKGENGFNIIKGTR---KRLSEEEERLKKSSHNFTNSNSAKA 409
             A+ AP     Q ++ K++  NG   I+  +   K    E    + +   F+++N++ A
Sbjct: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420

Query: 410 FFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGER----- 464
           FFD+ ++NPD+LANLDNKRRKI E + +  L ++L          GL DK + ++     
Sbjct: 421 FFDDDYENPDILANLDNKRRKIQELRNNRNLEKKL---------KGLSDKLLSKKEDRVN 471

Query: 465 QKMKRT-TESALQTGLIQRLGFDPTHGKIS-QVLKSSVSGSEPKNNLLGKKKTVINDLLH 522
           Q+ K+T T S  Q GL  ++G+DPT GK S ++L+ S     PKN+    K+  I D+ +
Sbjct: 472 QEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND----KQLAITDICN 527

Query: 523 YKKEKVILAPSKNEWFKKRSHREEVWQKHF-GSKETKETSDGSASDLEII 571
            KK+ V L PSK +  +K   R  ++ +   GS+E  +  +GS+ DLEII
Sbjct: 528 IKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>TBLA0E03080 Chr5 (774631..776700) [2070 bp, 689 aa] {ON} Anc_6.42
           YMR008C
          Length = 689

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%)

Query: 495 VLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS 554
           VL S+     P N       +  +D+   ++    ++P++++W +KR+   EV  K F  
Sbjct: 12  VLTSTAEAWSPSNGYAPANVSCPDDINLVRRADGKISPNESDWLQKRNANTEVSLKEFLE 71

Query: 555 KETKETSDGSASD 567
           + TK  SD S  D
Sbjct: 72  RATKNFSDTSFMD 84

>YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON}
           SKO1Basic leucine zipper transcription factor of the
           ATF/CREB family; forms a complex with Tup1p and Cyc8p to
           both activate and repress transcription; cytosolic and
           nuclear protein involved in osmotic and oxidative stress
           responses
          Length = 647

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 14  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKK 52
           NN+T DE +EQ   R+ EF+ER R A  +  KRK+E+ K
Sbjct: 418 NNVTLDENEEQERKRK-EFLERNRVAASKFRKRKKEYIK 455

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 198 KFQEPE-YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYY 256
           K Q+PE  A      L  +K+ + FT  +  V  + F   D + TL+ Y F  KG   YY
Sbjct: 13  KLQQPEKVAENVDPSLELNKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYY 72

Query: 257 N 257
           +
Sbjct: 73  D 73

>KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2.91
           YNL164C
          Length = 353

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 26/128 (20%)

Query: 360 TKVDSQPSLYKAKGENGF------NIIKGTRKRLSEEEERLK--KSSHNFTNSNSAKAFF 411
            K D   S Y   GEN        +++K T        ++     S++   +S SA AFF
Sbjct: 61  VKSDGDSSHYSKSGENASITSTDGDVLKMTNHLALNGAQKTGDLNSANILIDSKSAGAFF 120

Query: 412 DEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTT 471
           DE+F +P++  N                   E  +I+   ES  +ED + G  +K+    
Sbjct: 121 DEEFPDPELHIN------------------GEEAEIIFDYESHDMEDPTEGIGRKISEMI 162

Query: 472 ESALQTGL 479
           ES L  G 
Sbjct: 163 ESVLPGGF 170

>TBLA0D03220 Chr4 complement(785837..789256) [3420 bp, 1139 aa] {ON}
           Anc_8.834 YML111W
          Length = 1139

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 65/134 (48%), Gaps = 15/134 (11%)

Query: 135 MNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALHEIKI-LRLGKLFAK 193
           +++ + TF+T +  +     ++L    N+++ K Y     L R    I+I +RL K   K
Sbjct: 286 ISSNLSTFNTHQVPF----EDDLNDSDNIFIDKLYT----LPRLSTPIEIDIRLTKYATK 337

Query: 194 IRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTIT--DFQHTLDVYIFGKKG 251
               K Q+       T G + H   +    S+KP+KF MF +T   +   +D  I GK+ 
Sbjct: 338 PHE-KPQDESLLKEYTSGDLIHGYCVIQNKSKKPIKFEMFYVTLEAYTSIIDRSI-GKRT 395

Query: 252 VERYYNLRLGDVIA 265
           ++R+  LR+ D+ A
Sbjct: 396 IKRF--LRMVDLSA 407

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 60/144 (41%), Gaps = 20/144 (13%)

Query: 300 IGSSRDLGWCPIVNKKTHKKCGSP----INI--SLHKCCDYHR----EVQFRGTSAKRIE 349
           IG SR +G    V    +     P    +N+   + K  +YH+    E    G + K ++
Sbjct: 595 IGPSRSMGSVSPVQSPVNYNQNHPNFQALNLERGMEKPVNYHKGNPFEQDMPGNNGKFVQ 654

Query: 350 LNGGYALGAPTKVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKA 409
                  G P +++ QP    A  + G N+ K   KR S+ E +     +N ++SN   +
Sbjct: 655 K------GQPIQINQQPLYVGASSQMGQNMNKNQEKRSSDLEGKY----NNTSSSNFDPS 704

Query: 410 FFDEKFQNPDMLANLDNKRRKIIE 433
              E   N   +++L +K    +E
Sbjct: 705 LLRENVPNKSSMSHLLDKNGNQVE 728

>Suva_14.171 Chr14 complement(315525..317483) [1959 bp, 652 aa] {ON}
           YNL167C (REAL)
          Length = 652

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 14  NNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKK 52
           NN+  DE +EQ   R+ EF+ER R A  +  KRK+E+ K
Sbjct: 417 NNVIIDETEEQEKKRK-EFLERNRVAASKFRKRKKEYIK 454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,489,515
Number of extensions: 3113337
Number of successful extensions: 10734
Number of sequences better than 10.0: 159
Number of HSP's gapped: 11230
Number of HSP's successfully gapped: 162
Length of query: 571
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 456
Effective length of database: 40,294,809
Effective search space: 18374432904
Effective search space used: 18374432904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)