Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL149C (MLP2)5.702ON1679167984540.0
Smik_9.205.702ON1682168155530.0
Skud_9.195.702ON1680168053320.0
Suva_9.395.702ON1682168251220.0
TDEL0B021905.702ON1810139212651e-144
ZYRO0G06600g5.702ON1820181211941e-135
SAKL0E14916g5.702ON1779158911761e-133
Smik_11.3585.702ON1878154511581e-130
Skud_11.3345.702ON1885155010911e-121
Suva_11.3315.702ON1898155010701e-118
YKR095W (MLP1)5.702ON1875155010411e-115
Kwal_55.196975.702ON1760134810341e-114
Ecym_40185.702ON1769159110231e-113
KLTH0E01056g5.702ON1771136110231e-113
NCAS0A032005.702ON178818129631e-105
KLLA0A00594g5.702ON174815599421e-103
CAGL0G02497g5.702ON178013449171e-100
AFR286W5.702ON175813649062e-98
NCAS0G002305.702ON173514348322e-89
TBLA0E017305.702ON182013298242e-88
NDAI0E050405.702ON197314406823e-71
KNAG0L021405.702ON160813395696e-58
KAFR0D022205.702ON16744524722e-46
KAFR0H002105.702ON14547424506e-44
KNAG0C065905.702ON165113704363e-42
NDAI0F002905.702ON15544172932e-25
Kpol_1043.705.702ON13215832681e-22
TPHA0D046105.702ON11832672223e-17
TPHA0E002305.702ON12845191794e-12
Kpol_2001.755.702ON10062311096e-04
KNAG0J019108.704ON76397950.023
KNAG0A074003.393ON42199890.10
Kpol_392.88.259ON1427156880.21
KAFR0G032004.238ON186983830.82
TPHA0P004308.85ON319151801.2
KLTH0F16500g5.414ON838108791.8
Smik_12.4704.237ON1114237792.3
AGL305W7.462ON1057115792.4
Kpol_1053.383.107ON95957773.4
Ecym_45043.243ON66344755.0
CAGL0B03641g6.16ON988140765.2
TDEL0F026204.86ON41133755.7
NCAS0E019207.186ON1170228755.7
SAKL0D07920g1.382ON17593717.7
NDAI0B055205.414ON1009230748.4
NDAI0D012302.269ON17655718.5
SAKL0C13750g3.6ON49580738.8
KLLA0C10879g5.296ON755157739.1
Suva_16.906.233ON110496749.1
ZYRO0B05192g3.149ON44046739.1
ZYRO0A11132gsingletonON698377739.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL149C
         (1679 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...  3261   0.0  
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...  2143   0.0  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...  2058   0.0  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...  1977   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   491   e-144
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   464   e-135
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   457   e-133
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   450   e-130
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   424   e-121
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   416   e-118
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   405   e-115
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   402   e-114
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   398   e-113
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   398   e-113
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   375   e-105
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   367   e-103
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   357   e-100
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   353   2e-98
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   325   2e-89
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   322   2e-88
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   267   3e-71
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   223   6e-58
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   186   2e-46
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   177   6e-44
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   172   3e-42
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   117   2e-25
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   107   1e-22
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    90   3e-17
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    74   4e-12
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    47   6e-04
KNAG0J01910 Chr10 complement(346989..349280) [2292 bp, 763 aa] {...    41   0.023
KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] ...    39   0.10 
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    39   0.21 
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    37   0.82 
TPHA0P00430 Chr16 complement(91648..92607) [960 bp, 319 aa] {ON}...    35   1.2  
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    35   1.8  
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    35   2.3  
AGL305W Chr7 (128699..131872) [3174 bp, 1057 aa] {ON} Syntenic h...    35   2.4  
Kpol_1053.38 s1053 (60075..62954) [2880 bp, 959 aa] {ON} (60075....    34   3.4  
Ecym_4504 Chr4 (1009783..1011774) [1992 bp, 663 aa] {ON} similar...    33   5.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...    34   5.2  
TDEL0F02620 Chr6 complement(487111..488346) [1236 bp, 411 aa] {O...    33   5.7  
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    33   5.7  
SAKL0D07920g Chr4 (659019..659546) [528 bp, 175 aa] {ON} similar...    32   7.7  
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    33   8.4  
NDAI0D01230 Chr4 complement(293860..294366,294470..294493) [531 ...    32   8.5  
SAKL0C13750g Chr3 complement(1210007..1211494) [1488 bp, 495 aa]...    33   8.8  
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    33   9.1  
Suva_16.90 Chr16 (153235..156549) [3315 bp, 1104 aa] {ON} YPL216...    33   9.1  
ZYRO0B05192g Chr2 complement(420331..421653) [1323 bp, 440 aa] {...    33   9.1  
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    33   9.7  

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 3261 bits (8454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1644/1679 (97%), Positives = 1644/1679 (97%)

Query: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60
            MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS
Sbjct: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60

Query: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120
            KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR
Sbjct: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120

Query: 121  VKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQLKYDTSVQE 180
            VKEEYDIWQSRDQG                   MEMENILQRCKSNAISLQLKYDTSVQE
Sbjct: 121  VKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQE 180

Query: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240
            KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ
Sbjct: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240

Query: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300
            NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE
Sbjct: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300

Query: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360
            KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV
Sbjct: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360

Query: 361  GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420
            GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST
Sbjct: 361  GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420

Query: 421  ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480
            ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS
Sbjct: 421  ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480

Query: 481  PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540
            PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL
Sbjct: 481  PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540

Query: 541  ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK 600
            ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK
Sbjct: 541  ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK 600

Query: 601  ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE 660
            ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE
Sbjct: 601  ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE 660

Query: 661  NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI 720
            NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI
Sbjct: 661  NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI 720

Query: 721  SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI 780
            SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI
Sbjct: 721  SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI 780

Query: 781  KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI 840
            KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI
Sbjct: 781  KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI 840

Query: 841  EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE 900
            EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE
Sbjct: 841  EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE 900

Query: 901  IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE 960
            IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE
Sbjct: 901  IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE 960

Query: 961  GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR 1020
            GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR
Sbjct: 961  GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR 1020

Query: 1021 LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIN 1140
            LIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIN
Sbjct: 1081 LIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIN 1140

Query: 1141 DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQ 1200
            DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQ
Sbjct: 1141 DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQ 1200

Query: 1201 LNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEK 1260
            LNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEK
Sbjct: 1201 LNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEK 1260

Query: 1261 LTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDK 1320
            LTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDK
Sbjct: 1261 LTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDK 1320

Query: 1321 LEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANS 1380
            LEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANS
Sbjct: 1321 LEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANS 1380

Query: 1381 SSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEY 1440
            SSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEY
Sbjct: 1381 SSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEY 1440

Query: 1441 EDETLRRIKEAEENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGSLTFLDNKG 1500
            EDETLRRIKEAEENLKKRIRLPSEERIQKIIS                NAGSLTFLDNKG
Sbjct: 1441 EDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDNKG 1500

Query: 1501 SGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKEN 1560
            SGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKEN
Sbjct: 1501 SGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKEN 1560

Query: 1561 NIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVA 1620
            NIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVA
Sbjct: 1561 NIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVA 1620

Query: 1621 VKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE 1679
            VKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE
Sbjct: 1621 VKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE 1679

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 2143 bits (5553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1138/1681 (67%), Positives = 1354/1681 (80%), Gaps = 5/1681 (0%)

Query: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60
            MEDKISEFL+VPFESLQG+ Y VLRKL+KKI  FE  EEEVT+LNVLVDEIKSQYYSRIS
Sbjct: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIS 60

Query: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120
            KL +LL+ESSEQKN A +EL+ L+DQL ++R R RR+IDAL KQL  S +A++ +NDEK 
Sbjct: 61   KLSKLLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120

Query: 121  VKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQLKYDTSVQE 180
             KEE  I QS+ Q                    MEMENILQ CKSN++SLQLKYDT VQE
Sbjct: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180

Query: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240
            KELMLQ+KK  EEKLSS++ KTL +E TK+S + NLEEKLYQ Q++ ES  +Y++ LL+Q
Sbjct: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240

Query: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300
            NKQLS SVEEK+LE+KNLKDTA +EK EFSKEMTLQK+MNDLL SQL S E+D S   I 
Sbjct: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300

Query: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360
            K+DDN C++P+H +V DEL++TK++ +KS++ECQRLQNI+ D  +E++AT+ T+  S TV
Sbjct: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV 360

Query: 361  GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420
            GKLFSDIKVL++QLIKER+QKFQLQNQ+EDFILELEHKTPEL+SFKERTKSLEHELKRST
Sbjct: 361  GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST 420

Query: 421  ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480
            ELLET+S+ KRK ERE+TSLRQKIN CEANIH LVKQRLDLARQVK+LLLNTSAIQ+T  
Sbjct: 421  ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL 480

Query: 481  PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540
            PLS+D+LISLRKILES + VNEND+QAII+ERLVEF+N+NELQEKNVELL CIR LADKL
Sbjct: 481  PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540

Query: 541  ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK 600
            E +EGK+D TL +VE QTIKEAKDAIIELEN N KME+RINILLRERDSYKLLAS++EN 
Sbjct: 541  EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600

Query: 601  ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE 660
             N N+    E + EKKI+ELEAELSSTKVE+SA+IQNLRKEL  YKK  C KK   +DFE
Sbjct: 601  VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660

Query: 661  NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI 720
            NFK LAKEKE +LE  +++LK +LEKQK  VPS++   K R STEL QSR K + L +EI
Sbjct: 661  NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI 720

Query: 721  SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI 780
            S LKKETA+ +  KESLTRD E+CCKEK +LQM+LKESEIS NE K++F SK  +Y A+I
Sbjct: 721  SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI 780

Query: 781  KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI 840
            K+LE +LERLR +L+SK QEI+S++S KDSQLKWAQNTIDDTE K+KS+LTELS KE T+
Sbjct: 781  KQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTV 840

Query: 841  EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE 900
              LSS+IENLD ELR+ K +Y+FL+  SDASTL+P LRKELEQ Q++LKDA+SQ++ YEE
Sbjct: 841  VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE 900

Query: 901  IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE 960
            IIS+NE AL EL ++LA  KE+YDA+IELE KEK A EE+LS LR EL EIR+LQPKLKE
Sbjct: 901  IISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEIRSLQPKLKE 960

Query: 961  GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR 1020
            G +  V+QSEKLRN+ E+IQ+M  KI+KM+  VQ+ KK++ SQ+QS MK NK+LSELV R
Sbjct: 961  GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR 1020

Query: 1021 LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEK+A D Q EL K KSSL+  QDLLD HE+KWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKVDD-TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTI 1139
            LIEK+   T  ++G++D+LKLVS FSNLRHERNSLETKLTTCKR+LA VKQKN SLEK I
Sbjct: 1081 LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI 1140

Query: 1140 NDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYK 1199
            NDLQ  Q  S+ E QCSAVIIDEF DITKE+ QVN+LKENNAILQKSLKNVTEKNREIY+
Sbjct: 1141 NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE 1200

Query: 1200 QLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIE 1259
            +L  RQEE+S+L+ DLI+TKEQVS+N+NKIL+YESEM+QCKQRY DLS QQ++ QKK IE
Sbjct: 1201 ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE 1260

Query: 1260 KLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD 1319
            KL +EISD K KL  AEN   +LENKFNRLKKQAHEKLDASKKQQ ALTNEL ELKA++D
Sbjct: 1261 KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD 1320

Query: 1320 KLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTAN 1379
            KLEQDL+ +N K +DLDT+ K H +QS D+ RD EK     L+EEIESLK+ELQ+FK AN
Sbjct: 1321 KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN 1380

Query: 1380 SSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSE--AEYSKDIETLKKEWL 1437
            +SSDAFEKL+ NME+EK++II+ERTKEFEKKL+E ++KS S+   A+ S++IETLKKEWL
Sbjct: 1381 NSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSENIETLKKEWL 1440

Query: 1438 KEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGSLTF-L 1496
            KEYE+ET+RRI+EAEENLKKRIRLPSEERIQKIIS                NA SLTF  
Sbjct: 1441 KEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC 1500

Query: 1497 DNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVT 1556
            D K + +D +E+LWNSPSKGNSERPS +  F+ QKN+K QEQLK  KN V F DS+S   
Sbjct: 1501 DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM 1560

Query: 1557 NKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQ 1616
            NKEN+ +      +KA  TFSFGKP F S T+S QSFQNPFT S  + NT   L T NI+
Sbjct: 1561 NKENSAL-VKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIR 1619

Query: 1617 PEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQA 1676
             ++    A + S    L NNS D  +ITEIGST KRP E   SSDP+TKKVKESP ++ A
Sbjct: 1620 TDLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPA 1679

Query: 1677 S 1677
            S
Sbjct: 1680 S 1680

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 2058 bits (5332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1093/1680 (65%), Positives = 1312/1680 (78%), Gaps = 7/1680 (0%)

Query: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60
            MEDKISEFL+VP ESL+G+ +  L++LYKKI +FERSE+EVTKLNV VDEIKSQYY+RIS
Sbjct: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60

Query: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120
            KL +LL+ESSE+K    + +N L+DQL EERSR+ R+IDAL KQL+ SHE ++++ DE+ 
Sbjct: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120

Query: 121  VKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQLKYDTSVQE 180
             KEE   WQ   +                    +EMENILQ CKSNA+SLQ KYDT+ QE
Sbjct: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180

Query: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240
            KEL LQ+KK  EE+LSS ++K L +EVTK+S+++NLEEKL Q Q+  ESV TYNKFLL+Q
Sbjct: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240

Query: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300
            NK+LS  VEEK+LE+KNLKDTA+ EK+EFSKEMTLQK MNDLLRSQLTS E+  SLR  E
Sbjct: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300

Query: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360
            K DD  C+NPEH DV +ELID KL+LEKSK ECQ L+NIV DC +E   T+ T+  +PTV
Sbjct: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTTVNTNTAAPTV 360

Query: 361  GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420
            GKLFS+IK LKRQL+KER+QKFQ+QNQL+DF+LELEHKTP L+SFKERT+ LEHELK ST
Sbjct: 361  GKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST 420

Query: 421  ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480
            ELLET+SL KRK E+++TSL QKIN  EANIHSLV+QRLDLARQVK+LL N SAIQ T S
Sbjct: 421  ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS 480

Query: 481  PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540
            PLS DEL+SLRK+LES N VNE DSQ IITE+LVEF N++ELQEKN+ELL+CIRILADKL
Sbjct: 481  PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540

Query: 541  ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK 600
            E  EG+ DKT+ K+ENQTIKEAK+AIIE+E+IN+K+  R+NIL RERDSYKLLAS  +NK
Sbjct: 541  ETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNK 600

Query: 601  ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE 660
             + ++    EA  EKKIREL+++LSST+VE+SAIIQNL  +LL YKKSQ   K  L++FE
Sbjct: 601  THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE 660

Query: 661  NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI 720
            NFK L  EKE ML+E I+HLK +LEKQ+      +   K    T+LS S  KI SL+YEI
Sbjct: 661  NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI 720

Query: 721  SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI 780
            S LKKE    I  KESLTRD E+CCKEK +L ++L ESE SHNE  + F SKE QY  +I
Sbjct: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780

Query: 781  KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI 840
            K LE NL+ L   L+SK QEI++++S K+SQLKWAQNTIDDTE  +KS+  ELSNKETTI
Sbjct: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840

Query: 841  EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE 900
             +LS EIENL  ELR TK QYKFL   SD +TLEPTLRKEL+Q Q++LKDA+SQI+AYEE
Sbjct: 841  GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE 900

Query: 901  IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE 960
            IIS+NEN L EL  EL K KE+ + KI+LE KEK A+EE+LS LR EL EIR LQPKL+E
Sbjct: 901  IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE 960

Query: 961  GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR 1020
            GA + V QSEK+ ++ +RIQ+M  KI+KM+ I++  +K+E SQYQS +K NKDLSE V+R
Sbjct: 961  GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020

Query: 1021 LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEK+A D Q EL KTK SLYS Q+LLD+HE+KWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKVDD-TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTI 1139
            LIEK+D  T  +N ++ +L+LVSLFSNLRHER+SLETKLTTCKR+LA ++QKN SLEK+I
Sbjct: 1081 LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140

Query: 1140 NDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYK 1199
             DLQR  T+   + QC AVIIDE++ I KE+ QVNIL+ENNAIL KSLKNVTEKN  IYK
Sbjct: 1141 GDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYK 1200

Query: 1200 QLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIE 1259
            +L + QEEISRLQ  LIQTKEQVSIN+NK+L YESE+EQCKQRYQDLSQQQK   K + E
Sbjct: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260

Query: 1260 KLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD 1319
            KL N I DL+ KL + +NANADLENKFNRLKKQAHEKLDASKKQQ ALTNELNELK  KD
Sbjct: 1261 KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD 1320

Query: 1320 KLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTAN 1379
            KLE++LH E +KV+DL+ KLK H LQ  +VS+DH+   ++  +EEIESLKKELQ+F+ AN
Sbjct: 1321 KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN 1380

Query: 1380 SSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTS--SEAEYSKDIETLKKEWL 1437
             +SDAFEK+K NME+EK++IIDE+TK+FEKKLQ+ +NKS S  SE E S+ IE LKKEWL
Sbjct: 1381 DASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVENSEHIEALKKEWL 1440

Query: 1438 KEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGSLTFLD 1497
            KEYE+ET++RIKEAEENLKKRIRLPSEERIQKIIS                N  SL F  
Sbjct: 1441 KEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVF-- 1498

Query: 1498 NKGSG-EDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVT 1556
              GS  E+AE+ELWNSPSKG+SE+PS V   I QKN+K QEQLKNVKN V+FND +    
Sbjct: 1499 -SGSNEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSE 1557

Query: 1557 NKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQ 1616
            NKENNI DS+AA N+    FSFGKP FSSNTSS QSF NPFT S +N +T+  L T NI+
Sbjct: 1558 NKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIK 1617

Query: 1617 PEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQA 1676
               A   A N    +D  N   + AK+ EIG+TSKRPI+S TSSDPD+KK KESP ND A
Sbjct: 1618 SAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLA 1677

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 1977 bits (5122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1068/1682 (63%), Positives = 1312/1682 (78%), Gaps = 7/1682 (0%)

Query: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60
            MEDKISE+L+VP +SLQGV Y +LR L K+I KFERSEEEVT+LNVL+DEIKSQYY+RIS
Sbjct: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60

Query: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120
            KL +LL ESSE+KN +K+EL+ L + L  ERS+  R+IDAL KQL+ S   + ++NDE+ 
Sbjct: 61   KLNELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120

Query: 121  VKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQLKYDTSVQE 180
            VKEE ++ ++  Q                    +EMENILQ CKSN +SL+LKYDT VQE
Sbjct: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180

Query: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240
            KEL+L++KK +EE+LS   +KTL ++VT++SHV+NLEE+L + Q++YESV T N+FLL Q
Sbjct: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240

Query: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300
            NKQLS S+E+K+LE+KNLKDT ++EKA+FSKEMTLQKNMNDLLRSQLTS EK+ SL A E
Sbjct: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300

Query: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATM-TTSAVSPT 359
            K++D+ C+N +H +V+D+LIDTKL+LEKSK+ECQRLQNIV DC +E+EA    T  V P+
Sbjct: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360

Query: 360  VGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRS 419
            V K+FSDIK LKRQLIKERNQKFQLQNQ+E FI ELE KTPELISFKERT+SLE ELK S
Sbjct: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420

Query: 420  TELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETA 479
            T+LLET+SL KRK E+E+TSLRQKIN CEANIHSLVKQRLDLARQVKLLLLN SA+Q+ A
Sbjct: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480

Query: 480  SPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADK 539
            SPLS DELISL+K+LES ++ NE DSQ IITERLVEF+N NELQEKN+ELLNC+R+LADK
Sbjct: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540

Query: 540  LENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEEN 599
            LEN+EGKQDK+L K+ENQTIKEAKDAIIELE++N+ +E+RI+IL RERDSYKLLAS   N
Sbjct: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600

Query: 600  KANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDF 659
            K   ++    EAA  KKI+ELE+ELS TKVENSA++Q L KELL  KKSQ   +  L++F
Sbjct: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660

Query: 660  ENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYE 719
             NFK LA EKE +L+  ID LK +LEKQ+S  PS IH       TELSQ + K KSL  E
Sbjct: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720

Query: 720  ISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAK 779
            IS L K+       KESLTRD E+CCKEK +LQM+L ESE SHNE K+   SK+ QY  K
Sbjct: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTK 780

Query: 780  IKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETT 839
            IK LE N E L + L SK+QEIE++++ K+SQLKWAQNTIDDTE  MKSL T+LS K+TT
Sbjct: 781  IKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840

Query: 840  IEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYE 899
            I KLS E+++L+ EL+KTK QYK L+ +SDA+TLE  L+KELE+ Q+ LKDA+SQI+AYE
Sbjct: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900

Query: 900  EIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLK 959
            EIIS++EN L EL ++L KTKE    K +   +E  A+EE++S LR EL EIR LQPKLK
Sbjct: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960

Query: 960  EGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVI 1019
            EGAL  VQQSEKL N+ +RIQ M EKI+KM+TIV+L ++ E SQYQ+ +K NKDLS LV+
Sbjct: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020

Query: 1020 RLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENS 1079
            RLE +  D Q EL KTKSSL+S Q+LLDKHERKWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080

Query: 1080 VLIEKVDD-TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKT 1138
             L+EK+DD T  NNGDK++LKLVSLFS+LRHERN+LETKLTTCKR+LA  KQKN +LEK+
Sbjct: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140

Query: 1139 INDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIY 1198
            +ND+Q+T  +S K+ QCS  IIDEF+DI KE+ QVNILKENN ILQKSLK VTEKN  IY
Sbjct: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200

Query: 1199 KQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDI 1258
            K+    Q EIS+LQ DL QTKEQVS+N+NK+LVYESE+EQ KQRY +LSQQQK+  K + 
Sbjct: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260

Query: 1259 EKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIK 1318
            EKL NEISDLK KL +A+NANADL +KFNRLKKQAHEKLDASKKQQ ALTNE++ELK +K
Sbjct: 1261 EKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320

Query: 1319 DKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTA 1378
            ++LE+ LH E +KV++L+ KLK H +Q+E VS+D E+DT + LMEEIE LK+ELQ+FK  
Sbjct: 1321 NELEESLHSEESKVLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380

Query: 1379 NSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLK 1438
            + SSD  EK+K  ME EK++II+E+T EFE+KL+E   K+T +  E  +++E LKK+WLK
Sbjct: 1381 SDSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEATGKNTGATIENGENMEELKKQWLK 1440

Query: 1439 EYEDETLRRIKEAEENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGSLTFLDN 1498
            +YE+ET+RRIKEAEENLKKRIRLPSEERIQKIIS                N+GS T   +
Sbjct: 1441 QYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500

Query: 1499 KGSGE-DAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTN 1557
            K   E +AE++LWNSPSKGNSE+PS V   I QKNL  QEQLKN K  +  NDS+   +N
Sbjct: 1501 KKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSN 1560

Query: 1558 KENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTN-APLRTLNIQ 1616
            KEN+I  S+ A NKA   F+FGKP F SNTSS QSFQNPFT + ++ NT  +P+   NI+
Sbjct: 1561 KENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPV--FNIK 1618

Query: 1617 PEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTS-KRPIESGTSSDPDTKKVKESPANDQ 1675
            P +AV A ++      L +  T+ AKI EIG+ S KRPIE+  S D D+KKVKE+  NDQ
Sbjct: 1619 PALAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDNDQ 1678

Query: 1676 AS 1677
             S
Sbjct: 1679 VS 1680

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  491 bits (1265), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 420/1392 (30%), Positives = 768/1392 (55%), Gaps = 83/1392 (5%)

Query: 154  MEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHV 213
            ME +N +Q  K N +  + + +   Q+  ++ +S + +E++++S +++ +       + +
Sbjct: 175  METQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTEL 234

Query: 214  ENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEM 273
            +   +++ +++++Y+   +  +FLL +N+++SQ ++ K+ E+K L D  + EK EFS+EM
Sbjct: 235  QKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREM 294

Query: 274  TLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTD---VIDELIDTKLRLEKSK 330
            +L++ + DL   QL S +++  L   EK++     N + T     +D+L   + +LE+S 
Sbjct: 295  SLKQKLLDLQDEQLQSFKEELRLTE-EKHNSTEADNLQSTQQARFMDDLAQVRQQLEESN 353

Query: 331  NECQRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLED 390
            +E  RLQ +V +   + E     S  + ++ KL+ DI VLK+QLIKER+QK  LQ Q+E 
Sbjct: 354  HERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIES 413

Query: 391  FILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEAN 450
            F++ELE+K P + S KER+ +LE EL     LLE  S  K ++ RE+ S   KI   E N
Sbjct: 414  FVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEIN 473

Query: 451  IHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIIT 510
             H+L++QR DLARQV+ LL N +   ++  PL+ DE+  ++KI+E+ N  NE+DSQ+IIT
Sbjct: 474  THTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIIT 533

Query: 511  ERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELE 570
            ERLVEF ++  LQE+N ELL   R LAD+LE  E   +  +  +E +TI EAK+AII L+
Sbjct: 534  ERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQ 593

Query: 571  NINAKMETRINILLRERDSYK-LLASTEENKANTNSVTSMEAAREKK--IRELEAELSST 627
              N+++E++++ + +ERD+YK +L+ T ++  N      M+ ++E +  I+ LE +LS+ 
Sbjct: 594  ERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTL 653

Query: 628  KVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK---AEL 684
              E S   + L +E+    +S+ +   + E   + + LA+++ ++L+  ++  K   AEL
Sbjct: 654  TTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAEL 713

Query: 685  EKQKSWVPSYIHVEKERASTELS-----QSRIKIKSLEYEISKLKKETASFIPTKESLTR 739
             ++   + S +  ++ R    ++     QS++ +  LE   + L  E +    + +SL R
Sbjct: 714  IRRSHELQSILSKQEARNGETVNKYISCQSKLSV--LEARAANLDAEKSLLQSSSDSLRR 771

Query: 740  DFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQ 799
            + ++   E+  L + + + +   +E +      +  +KA I +LE     L++++ SK  
Sbjct: 772  EIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDN 831

Query: 800  EIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKF 859
            EI++    K +Q KW Q  ID+       +  EL+ K  T+ +L  E+ +L K++ ++  
Sbjct: 832  EIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDS 891

Query: 860  Q---YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNEL 916
            +   YK L+   +  T +  LRK+LE+  ++LK A SQ + +++I S+ E  L  L NE 
Sbjct: 892  RIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEF 951

Query: 917  AKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIR---ALQPKLKE-------GALHFV 966
             +  E   +  E    EK   E+ +S L+  +  +    ALQ    E         L  +
Sbjct: 952  EERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSL 1011

Query: 967  QQSEKLRNEV-----ERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRL 1021
            + SE    +V     +++ ++ + +E+ +    + +K     Y+  ++++ ++S+++ +L
Sbjct: 1012 ESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKN----YEEELQKHAEVSKIISQL 1067

Query: 1022 EKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVL 1081
              +    ++E+ + K+S   A+++L+  E+ W  +K + +  +     Q +++  +N +L
Sbjct: 1068 RSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLL 1127

Query: 1082 IEKVDDTAANNGDKDHLKLVS---LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKT 1138
              +V+  + +  + ++  L     L  +LR ER+ LETKLT  KRE   + QK  +LE  
Sbjct: 1128 FSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDE 1187

Query: 1139 INDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIY 1198
            + + ++     ++     + I  + +DI +++ Q+N+L+E+N  L+ ++    EKN ++ 
Sbjct: 1188 LAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQ 1247

Query: 1199 KQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDI 1258
             +LN  Q +I  L  +L + ++ +     +I++   E ++ K+R  D+ ++ +    ++ 
Sbjct: 1248 SELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEY 1307

Query: 1259 EKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIK 1318
             KL  EIS+LK +L +    N DL ++F RLKKQAHEKL+ASK  QA L+ E+NEL+  K
Sbjct: 1308 RKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTK 1367

Query: 1319 DKLEQDLHFENAKVIDLDTKLKAHELQS---EDVSRDHEKDTY----------------- 1358
             K+E+ L     KV++L+  L   + +S   ED+   HE D                   
Sbjct: 1368 TKMEEILKETQTKVLNLEKLLTERDSESANNEDLR--HELDDALERCKEIEVKLGETVGS 1425

Query: 1359 -----RTLMEEIESLKKELQIFK---------TANSSSDAFEKLKVNMEKEKDRIIDERT 1404
                   L EEI SLK++++IFK          +   S+  E +K   E+EK + I E+T
Sbjct: 1426 SEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKT 1485

Query: 1405 KEFEKKLQE---TLNKSTSSEAE--YSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRI 1459
            +E+ KK +E    L+    S AE   + D+ +LKK+W +EYE  + +RI+EAEENLKKRI
Sbjct: 1486 EEYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRI 1545

Query: 1460 RLPSEERIQKII 1471
            R+P+EERI+K++
Sbjct: 1546 RMPTEERIKKVL 1557

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  464 bits (1194), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 488/1812 (26%), Positives = 915/1812 (50%), Gaps = 182/1812 (10%)

Query: 4    KISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLK 63
            K+S F  VP + L  +   +L  L  K+  F   + +  +LNV +DEIK+    R   LK
Sbjct: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLK 84

Query: 64   QLLD---------------------ESSEQKNTAKEELNGLKDQL---NEERSRYR---R 96
              ++                     +SS  K   + E+  L+++L   ++ER   +   R
Sbjct: 85   NEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKR 144

Query: 97   EIDA-----LKKQLHVSHEAMREVNDEKRVKEEYDIWQSRDQGXXXXXXXXXXXXXXXXX 151
            E+ A     +K+      E+ + ++D KR++++                           
Sbjct: 145  EVVAVLEEKIKELESFRTESRKSLDDSKRLRQQV-------------------------- 178

Query: 152  XXMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSS 211
              +E+E  +Q  KS  +  Q +  T  Q   ++ ++ + +EE+++S +++ ++       
Sbjct: 179  --LELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDD 236

Query: 212  HVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSK 271
             ++ L  +    ++  +   + N+ +  +N++L++S++EK++EMK+L D+   EK EF+ 
Sbjct: 237  ELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAH 296

Query: 272  EMTLQKNMNDLLRSQLTSLEKDCSLRAIEKND----DNSCRNPEHTDVIDELIDTKLRLE 327
            EM++++ + DLL +Q+ SL+ + +  +++K++     +  RN E+  +I ELI  K   E
Sbjct: 297  EMSMKQKLIDLLENQVKSLQGELNA-SLDKDNVELLASGERNTENEKLIQELITLKENFE 355

Query: 328  KSKNECQRLQNIVMDCTKEEEATMTTSAVSPTVG-----KLFSDIKVLKRQLIKERNQKF 382
            +S+ E  RL+ +V +    +++    +  S  +          D+ +LK++LIKER+QK 
Sbjct: 356  ESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKE 415

Query: 383  QLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQ 442
            +LQ Q+E FI+ELE+K P + SFKERT  LE EL     LL+  S  K K+ERE  +L +
Sbjct: 416  RLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSK 475

Query: 443  KINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNE 502
            K+   E++IH+L +QR DLA QV+ LL+N S   ++   LS +E+  +++I+ + +  +E
Sbjct: 476  KVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSE 535

Query: 503  NDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEA 562
            +DSQ +I+ERLVEF+N+  LQEKN+ELL  +R LA+KLE+ E   +K +Q  EN TIKEA
Sbjct: 536  SDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEA 595

Query: 563  KDAIIELENINAKMETRINILLRERDSYKLLAS---TEENK---ANTNSVTSMEAAREKK 616
            K+AI+ L++ NA +E+++ IL +E D++K + S   +++N    AN        ++ E+K
Sbjct: 596  KEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEK 655

Query: 617  IRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEA 676
            +R LEA L+S  VE+S   + L  E+    +S+ +    LE   + K L +E+ ++++  
Sbjct: 656  LRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHT 715

Query: 677  IDHLKAE---LEKQKSWVPSYIHVEKERAS---TELSQSRIKIKSLEYEISKLKKETASF 730
            ++  + E   L K+   + S    +  R +    EL     K+  LE +++ L+ E    
Sbjct: 716  LELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELL 775

Query: 731  IPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERL 790
              ++ +   ++ +  +E+  L++ + + +   +E +      +  YK  +  LE      
Sbjct: 776  QSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADA 835

Query: 791  RSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENL 850
            R+ L +K +E E + + K +Q++W Q+ +D    + + L  EL  K   +  L SE+  L
Sbjct: 836  RARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKL 895

Query: 851  DKELRKTKFQ---YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNEN 907
            +K++ +++ +   Y+ L  +   ++ E +LRKELE+ ++ L D  ++I  Y+ ++S+ E 
Sbjct: 896  EKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEE 955

Query: 908  ALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEI-RALQP--KLKEGALH 964
            +L +L  + A  K+    ++E  + EK   ++ +++L   + ++  +LQ   K  E   +
Sbjct: 956  SLSQLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKN 1015

Query: 965  FVQQ-----------SEKLRNEVE-RIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENK 1012
             +Q+           S +L+ E + +I K+   +E+ ++     ++     Y+  ++++ 
Sbjct: 1016 TLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRN----YEEELQKDS 1071

Query: 1013 DLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTE 1072
            ++S+ +  L + +   +  +T+ K+S    + +L+++E+ W  +K +YER+L ++ +  E
Sbjct: 1072 NVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLE 1131

Query: 1073 SLRVENSVLIEKV-----DDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAF 1127
             L  +NS+L +++     D++   NG+   ++   + +NLR ER+ L TKLT  +RE   
Sbjct: 1132 DLSTQNSLLYDQIELFSKDNSDGVNGETAEVR--EILTNLRRERDILGTKLTVSQREEQT 1189

Query: 1128 VKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSL 1187
            ++    S+E  ++  +R  +  +KE    + +I + + I +++ Q+N+L+E+N  L+ + 
Sbjct: 1190 LRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAA 1249

Query: 1188 KNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLS 1247
            +   +KNRE+ ++LN  +E I  L+ +L      V     ++ +Y+ E  + K+R Q++ 
Sbjct: 1250 EEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEIL 1309

Query: 1248 QQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAAL 1307
             +      +D ++L  ++S L+ KL      N +L+++FNRLKKQAHEKL++SK  Q  L
Sbjct: 1310 HKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTL 1369

Query: 1308 TNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDV-------------SRDHE 1354
            +N+LNEL+  K +LE     E  KV +L  +L AH   +E V             SR+ E
Sbjct: 1370 SNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELE 1429

Query: 1355 KDTYRTLME----------EIESLKKELQIFKTANSS----------SDAFEKLKVNMEK 1394
            ++   TL +          EI+SLK EL   K  +++          S+  E ++ + E+
Sbjct: 1430 QNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEE 1489

Query: 1395 EKDRI--IDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAE 1452
            EK           +  ++ + TL  + +   +   + E +K++W  E E+  L+RI EAE
Sbjct: 1490 EKINFLKEKTEELKKLEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAE 1549

Query: 1453 ENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGSLTFLDNKGSG---------- 1502
            ENLKKRIRLP+EERI++++                 +  SL   D   S           
Sbjct: 1550 ENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLKKQLEKDLQ 1609

Query: 1503 EDAEEELWNSPSKGNSERPSAVA---GFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKE 1559
            E  E E+     K   E     A     + +K  K + QL    +    + S++    K 
Sbjct: 1610 EKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSVPKP 1669

Query: 1560 N---NIVDSSAAGNKAIPT----------FSFGKPFFSSNTSSLQSFQNPFTASQSNINT 1606
            N    I + S   N+++P               KP F  N SS  S  NPFT+S  N N 
Sbjct: 1670 NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTF--NFSSF-SGGNPFTSSPQN-ND 1725

Query: 1607 NAPLRTLNIQPEVAVKAAINFSNVTDLTNNSTDG------AKITEIGSTSKRPIESGTSS 1660
                     +P   +    N S+ T + ++ST+       +  TE G++S     S T+ 
Sbjct: 1726 TMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAM 1785

Query: 1661 DPDTKKVKESPA 1672
             P   +   +P+
Sbjct: 1786 TPTPGEGASTPS 1797

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  457 bits (1176), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 458/1589 (28%), Positives = 840/1589 (52%), Gaps = 148/1589 (9%)

Query: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64
            IS FL +    +  +   V+R+L  K  +F + + +  K +V +DE+KS    R    K 
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80

Query: 65   LLDESSEQKNTAKEELNGLKDQ---LNEERSRYRREIDALKKQLHVSHEAMREVNDEKRV 121
             L++ +E   + ++E +  +D+   L +E++   +E++ LK QL               +
Sbjct: 81   QLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQL-------------TEL 127

Query: 122  KEEYDIWQSRDQ--------------GXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNA 167
            K++ +I++S  Q                                  +E+EN +Q  KSN 
Sbjct: 128  KQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSND 187

Query: 168  ISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNY 227
            +  + +     QE  L+  + + +E++L+S S++  +     +S ++    +L  ++S  
Sbjct: 188  LRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSEL 247

Query: 228  ESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQL 287
            E   + ++ L ++   LSQ +++K+ E+K+L+D++S+EK EF++EMTL++ + DLL  Q+
Sbjct: 248  EIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQI 307

Query: 288  TSLEKDCSLRAIEKNDDNSCRNPEHTD-----VIDELIDTKLRLEKSKNECQRLQNIV-- 340
             S + +     +E   + S  N +H D     +I+ELI+TK +LE S+++  +L+  V  
Sbjct: 308  ESFKTE-----LESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDE 362

Query: 341  MDCTKEEEATMTTSAVS-----PTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILEL 395
            +  T  E     TS VS       V KL  DI +LK++LI+ER QK QLQ Q+E F+LEL
Sbjct: 363  LLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLEL 422

Query: 396  EHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLV 455
            EHK P L SFKERT+ LE EL     +LE  S  K ++E E+TS++ KI   E  IHSLV
Sbjct: 423  EHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLV 482

Query: 456  KQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVE 515
            +QR DLA QV+ LL+  S   ++  PL+ +E   ++KI+ SS    E D+Q II+ERLV 
Sbjct: 483  RQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVR 542

Query: 516  FSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAK 575
            F ++ ELQEKN+ELLN IR LADKLE  E +     ++VE++T+KEAK+AI+ L+  N  
Sbjct: 543  FESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKS 602

Query: 576  METRINILLRERDSYKLLASTEENKANTNSVTSME----AAREKKIRELEAELSSTKVEN 631
            +E+++ I+ +ERD++K+LAS +      ++V S E       E+KI+ELE  LSS   E+
Sbjct: 603  LESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEES 662

Query: 632  SAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAEL-EKQKSW 690
            +  I+ L +E+    ++Q      LE   + + LA+++ +++   ++  K E  E +K +
Sbjct: 663  AKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRF 722

Query: 691  VPSYIHVEKERASTE-----LSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCC 745
                 ++ K+ + T+     L   + ++ +L+ +++  + E       +E+L ++ E   
Sbjct: 723  HSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLS 782

Query: 746  KEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIR 805
            +E+  +++ + + +    E +      +  ++ K  +LE  L      L +K +EI    
Sbjct: 783  EERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYI 842

Query: 806  SCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YK 862
            S KDSQ KW Q   D    ++ +   +LS+K T I+ L  ++E+L+ +L +++ +   + 
Sbjct: 843  STKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFN 902

Query: 863  FLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKEN 922
             L+ +    +   TLR+ELE+ +++L DA SQ++ Y+ +  S+E +   +K+ L ++K  
Sbjct: 903  ALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAE 962

Query: 923  YDAKIELEKKEK-------WAREEDLSRLRGELGEIRA-LQPKLKEGALHF----VQQSE 970
            Y  KIE   KE+          ++ +S L  EL   ++  + ++ +   +      +QSE
Sbjct: 963  YTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSE 1022

Query: 971  --KLRNEVE-RIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAAD 1027
               ++ E E +I K+ E + + ++     +K     Y+  ++++ D+S+ +  L  +A  
Sbjct: 1023 LDNMKAEYEQKISKIQEDLNQQTSYANTAQKN----YEQELQKHADVSKKISLLRAEAQK 1078

Query: 1028 CQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD- 1086
             ++E    +++  +A+  L++ E  W ++ +DYE EL    ++ E L  ++ +L +++D 
Sbjct: 1079 YKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDF 1138

Query: 1087 -DTAANNGDKDHLKLVS----LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIND 1141
                     +D + + +    L ++LR E++ LETKL    RE   ++QK   +E   +D
Sbjct: 1139 LSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIE---SD 1195

Query: 1142 LQRTQT----LSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREI 1197
            L+ ++     L       SA + D+ ++I  ++ Q+N+L+E+N  L+   +   E++RE+
Sbjct: 1196 LEGSRIELSKLQRAASGNSATLKDQ-EEIMTQLNQLNLLRESNITLRNEAQKNGERSREL 1254

Query: 1198 YKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKD 1257
              +L+    ++  L+  +   +  V     +I +   E E+ KQR QD+  + +    ++
Sbjct: 1255 KAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEE 1314

Query: 1258 IEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAI 1317
             +KL +++S+L+ ++ S  + N +L+ +F RLK+QAHEKL+A+K  Q+ LT++LN+LKA 
Sbjct: 1315 HQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKAT 1374

Query: 1318 KDKLEQDL------------------------------HFENAKVIDLDTKLKAHELQSE 1347
            K+KLE DL                                EN++   L+T+ K  ++ S 
Sbjct: 1375 KEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSS 1434

Query: 1348 DVSRDHE-KDTYRTLMEEIESLKKELQIFKT------------ANSSSDAFEKLKVNMEK 1394
                + E  +   +LM +I+ L+++L+  KT              ++S   E LK+  E+
Sbjct: 1435 SALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEE 1494

Query: 1395 EKDRIIDERTKEF------------EKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYED 1442
            EK ++I ++  E             E K QE   +  + + +   +I+ +KK+W +EYE 
Sbjct: 1495 EKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQ 1554

Query: 1443 ETLRRIKEAEENLKKRIRLPSEERIQKII 1471
            +T +RI+E+ E LKKRIRLP+EE+I KI+
Sbjct: 1555 KTSQRIRESNEQLKKRIRLPTEEKINKIV 1583

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  450 bits (1158), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 452/1545 (29%), Positives = 831/1545 (53%), Gaps = 106/1545 (6%)

Query: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64
            I+ F    FE ++ +   +++ L  K+ +F   + E  ++ V  DE+K+    +I  LK+
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 65   LLDESSEQKNTAKEELNGLKDQL-----------NEERSRYRREIDAL--KKQLHVSHEA 111
             ++   +Q +  ++E +   D+L           NE  S  RR  D +  KK+L  + + 
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 112  MREVNDEKRVKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQ 171
              ++ DE R+KE  +I +S +                     +++E   Q   ++ ++ +
Sbjct: 144  TLKILDE-RLKE-LEIARSDNN-------RSDNECKRLRSTIIDLETKQQDLITSDLNSR 194

Query: 172  LKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVF 231
             + +   QE  ++  +   +E++L S +++ L+        +  +  +L  ++S+++   
Sbjct: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254

Query: 232  TYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLE 291
            T N  L  +N +LS+S++EK+LE+K+L D  S EK EFS E+ L++ + DLL SQL +++
Sbjct: 255  TKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314

Query: 292  KDC-SLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEAT 350
            ++  S R +E ++D+     E  D++ EL  TK  L + K+EC RL +I+ +  +E  ++
Sbjct: 315  EELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEESGSS 374

Query: 351  MTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTK 410
             + S+         SD  +LK+QLIKE+  K  LQNQ+E FILELEHK P + SFKERT 
Sbjct: 375  TSRSS---------SDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTD 425

Query: 411  SLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLL 470
            +LE+EL  +  LLE  S  K  + RE+++  +K+  CE +I +L+KQRLDL RQV+ LL+
Sbjct: 426  TLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLI 485

Query: 471  NTSAIQETASPLSQDELISLRKILES-SNIVNENDSQAIITERLVEFSNVNELQEKNVEL 529
              S  +++  PL ++E++ ++ IL++ S+   E DSQ I+TERLVEF ++ ELQEKN EL
Sbjct: 486  TNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTEL 545

Query: 530  LNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDS 589
            L  +R LAD+LE+ E +  ++LQK+E++TI EAK+AI+ L+    ++E+++  L +E ++
Sbjct: 546  LKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECEN 605

Query: 590  YKLLASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKELLIYK 646
             K L S EE     +++  +   +   E +I++L++ +S    E++  +  L KE+    
Sbjct: 606  SKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLY 665

Query: 647  KSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKERAS 703
             S+      L   ++ + LA+E+ ++L   +D  KAE   L K+   + S I  +  +  
Sbjct: 666  DSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQ 725

Query: 704  TELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEI 760
              L++    + K+   E E+  LK+E    I ++++L ++ ++   EK  L++ + + + 
Sbjct: 726  ETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQT 785

Query: 761  SHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTID 820
               E +         Y+ KI ELE+    L+ +   K Q I+ +    +S ++W QN I+
Sbjct: 786  LQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIE 845

Query: 821  DTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTLEPTL 877
              +   +S++  +++K+  IEKL  ++++L+KE+ + K +   Y  +D     +  + +L
Sbjct: 846  VLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVID----GTINDDSL 901

Query: 878  RKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAR 937
            RKELE+ ++ L DA SQIQ Y+E+  +N  +L ++ ++  ++ +++  +I+    EK + 
Sbjct: 902  RKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSL 961

Query: 938  EEDLSRLRGEL----GEIRALQPKLKEGALHFVQQSEKLRN---EVERIQKMIE----KI 986
            EE +S L+ ++     E+      +KE    F ++   L+N   EVE ++   E    KI
Sbjct: 962  EEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKI 1021

Query: 987  EKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLL 1046
            +K      +      + Y+  ++++ D+S+ +  L +     + ++     S    +  L
Sbjct: 1022 QKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTL 1081

Query: 1047 DKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAANNG---DKDHLKLVS 1102
             ++ER W  ++     +L S+  + E L  +N +L ++++  T A+ G     D   L S
Sbjct: 1082 KENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNS 1141

Query: 1103 LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDE 1162
            +  +LR ER+ L+TK+T  +R+   ++QK   ++  + + +     S  E +    II +
Sbjct: 1142 ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQ 1201

Query: 1163 FKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQV 1222
             +DI +++ Q+N+L+E+N  L+  L+N  E+ R +  +L+  +++I+ ++ +L   K  +
Sbjct: 1202 HEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSM 1261

Query: 1223 SINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADL 1282
                 ++ + + E+ + K+R QD+ ++ +     D EKL +EI  LK KL       A+ 
Sbjct: 1262 QEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEA 1321

Query: 1283 ENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDT----- 1337
            E +FNRL++QA E+L  SK     LT ++N+LK  K KLE+ L   N K+ +L+      
Sbjct: 1322 EERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQ 1381

Query: 1338 ------KLKAHELQSEDVSRD-----HEKDTYR------------TLMEEIESLKKELQI 1374
                   +K  +  +E+ S++      EK T+             TL EEIE  ++  Q 
Sbjct: 1382 DNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQ 1441

Query: 1375 FKT--ANSSSD---AFEKLKVNMEKEKDRIIDERTKEFEKKL---QETLNKSTSSEAEYS 1426
             ++  AN  +D     E +K   E++K   I E+TKE  +K+   QE LN+ ++      
Sbjct: 1442 LQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI----- 1496

Query: 1427 KDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
             +I+ LK +W  E+E+E + RI+EAEE LKKRIRLP+EE+I KII
Sbjct: 1497 -NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKII 1540

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  424 bits (1091), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 456/1550 (29%), Positives = 824/1550 (53%), Gaps = 111/1550 (7%)

Query: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64
            I+ F +   E ++ +   ++ +L +K+ +F   + E  ++ V  DE+K+    +I  LK 
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 65   LLDESSEQKNTAKEELNGLKDQ---LNEERSRYRREIDALKKQLHVSHEAMREV-NDEKR 120
             ++    Q +  ++E N    +   L  E+ +   E++++K++L+   E  +E+ ++++R
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143

Query: 121  VKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQLKYDTSVQE 180
              +  D      +                    +E+E   Q   +N ++ + + +   QE
Sbjct: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQE 203

Query: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240
              L+  +K  +E++LSS S++ L+      + +  +  +L +++++++   T N  L  +
Sbjct: 204  LNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQK 263

Query: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300
            N +LS S++EKVL++KNL D+ + EK EFS E+ L++ + DLL +QL +++++  L++I 
Sbjct: 264  NNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEE--LKSIR 321

Query: 301  KNDDNSCRNPEHTDVIDE-------LIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTT 353
            K+D ++  + +   +I E       L  TK +L + ++EC RL +I  + T EE  T+T+
Sbjct: 322  KSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEE-TGEESGTLTS 380

Query: 354  SAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLE 413
             + +        D  +LK+Q IKE+  K QLQNQ+E FI+ELEHK P + SFKERT  LE
Sbjct: 381  RSST--------DFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLE 432

Query: 414  HELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTS 473
            +EL  S  LLE  S  K  + RE+    +KI  CE +IH L +QRLDL RQV+ LL+  S
Sbjct: 433  NELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNS 492

Query: 474  AIQETASPLSQDELISLRKILESSNI-VNENDSQAIITERLVEFSNVNELQEKNVELLNC 532
               ++  PL ++E+  ++ IL++ N    E+DSQ I+T RLVEF NV ELQEKN ELL  
Sbjct: 493  VSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRI 552

Query: 533  IRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKL 592
             R LADKLE+ E K  + L K+EN+TI EAK+AI+ L++    +E+++  L RER++ K 
Sbjct: 553  TRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELERERETLKS 612

Query: 593  LASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQ 649
              S + +  N + +  +   +   E ++++L+A +S    E++  +  L KE+     S+
Sbjct: 613  SISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSK 672

Query: 650  CKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKERASTEL 706
                  L   ++ + LA+E+ ++L   +D  KAE   L K+   + S I  +  +    L
Sbjct: 673  SDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETL 732

Query: 707  SQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEI--S 761
            ++    + K+   E  +S LK E    I +++SL ++ ++   EK  L++ + + +    
Sbjct: 733  NEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQK 792

Query: 762  HNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDD 821
              E+ +D + K  Q   KI E+E     L+ +   K Q I  +     S+++W QN I+ 
Sbjct: 793  EREDLLDEARKSCQ--NKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIET 850

Query: 822  TEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTLEPTLR 878
             +    S++  ++ K+T IEKL  ++++L+KE+ + K +   Y  +D+  +    + +LR
Sbjct: 851  LKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETIN----DDSLR 906

Query: 879  KELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENY--------DAKIELE 930
            KELE  ++ L +A SQIQ Y+++  S   +L E+ ++L ++ E +        D KI LE
Sbjct: 907  KELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLE 966

Query: 931  KKEKWAREEDLSRLRGELGEIRALQP-KLKEGALHFVQQSEKLRNEVERIQKMIEKIEKM 989
             K    +E+  + L  EL     LQ  ++++  + F +    L+N  + I+ +  + E  
Sbjct: 967  DKVSLLKEQSFN-LNNELD----LQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021

Query: 990  STIVQ-------LCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSA 1042
             + +Q       +      + Y+  ++++ D+S+ +  L +     + ++     S    
Sbjct: 1022 LSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSEL 1081

Query: 1043 QDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAANNGDKDHLKLV 1101
            +++L ++E+ W  +K     +L  +  + E L  +N +L  +++  TAA NG  D     
Sbjct: 1082 ENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGP 1141

Query: 1102 SL----FSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSA 1157
            +L       LR ER+ L+TK+T  +R+   ++QK   ++  + D +     S  E    +
Sbjct: 1142 TLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERS 1201

Query: 1158 VIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQ 1217
             I+ +   I +++ Q+N+L+E+N  L+  L+N ++KN+E+  +L   +E I+ ++ +L  
Sbjct: 1202 SIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSA 1261

Query: 1218 TKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAEN 1277
             K  +     +I + + E+ + K+R QD+ ++ +     D EKL +E+  LK +L     
Sbjct: 1262 LKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQ 1321

Query: 1278 ANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDT 1337
               + E +FNRL++QA EKL  SK  Q  LT +LNELK  K  LE+ L+  N ++ +L+ 
Sbjct: 1322 QGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELEG 1381

Query: 1338 K-----------LKAHELQSEDVSRDHEK----------DTYRTLMEEIESLKKEL---- 1372
            +           +K  +  +E  SR+ E+           T R L EEI +LK+E+    
Sbjct: 1382 EKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQG 1441

Query: 1373 QIFKTANSS--------SDAFEKLKVNMEKEKDRIIDERTKEFEKKLQET---LNKSTSS 1421
            QI K   ++        S+  E +K + E++K + I+E+T+E  KK+QE    LN+ +S 
Sbjct: 1442 QIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSSV 1501

Query: 1422 EAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
                  +I+ +KK+W  E+E+E   R++EAEE LKKRIRLP+EE+I KII
Sbjct: 1502 ------NIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKII 1545

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  416 bits (1070), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 431/1550 (27%), Positives = 807/1550 (52%), Gaps = 105/1550 (6%)

Query: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64
            I+ F +   E ++ +   ++  L  K+ +F   + E  ++ V +DE+K+    +I+ LK 
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83

Query: 65   LLDESSEQKNTAKEELNGLK---DQLNEERSRYRREIDALKKQLHVSHEAMREV-NDEKR 120
             +++   Q +  ++E N      + +  E++    E++++K++L    E  +E+ + ++R
Sbjct: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143

Query: 121  VKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQLKYDTSVQE 180
              +  D      +                    +E+E   Q   SN ++ + + +   QE
Sbjct: 144  TLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQE 203

Query: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240
              L+  +K  +E++LSS +++ L+     ++ +  +   L +++++++   T N  L  +
Sbjct: 204  LNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQK 263

Query: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300
            N +LS+ ++EK+L++K L D+++ EK +FS E+TL++ + DLL SQL +++++ +    E
Sbjct: 264  NNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELN-NTRE 322

Query: 301  KN------DDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTS 354
             N      DD+     E+  ++ +L  TK +L + +NEC RL +I  +  KE+   +T+ 
Sbjct: 323  SNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKED-GILTS- 380

Query: 355  AVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEH 414
                   K   D  +LK+QLIKE+  K  LQNQ+E FI+ELEHK P + SFKERT +LE+
Sbjct: 381  -------KSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTLEN 433

Query: 415  ELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSA 474
            EL  +  LLE  S  K  + +E+    +K+   +  IH L KQRLDL RQ++ LL+  S 
Sbjct: 434  ELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSV 493

Query: 475  IQETASPLSQDELISLRKILESSN-IVNENDSQAIITERLVEFSNVNELQEKNVELLNCI 533
              ++  PL ++E+  ++ IL++ +    E+DSQ I+TERLVEF ++ +LQEKN ELL   
Sbjct: 494  SNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVT 553

Query: 534  RILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLL 593
            R LADKLE+ E K    L+ +EN+TI EAK+AI+ L++   ++E++I+ L +ER+ +K  
Sbjct: 554  RNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNW 613

Query: 594  ASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQC 650
               +E   N + +  +   +   E + ++L+A +S    E++  +  L KEL     S+ 
Sbjct: 614  TMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKS 673

Query: 651  KKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKERASTELS 707
                 L   ++ + LA+E+ ++L   +D  KAE   L K+   + + I  +  +    L+
Sbjct: 674  SLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLN 733

Query: 708  ---QSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEI--SH 762
                 + K+ ++E E+S LK E    I  +++L ++  +   EK  L + + + +     
Sbjct: 734  DYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKE 793

Query: 763  NENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDT 822
             EN +D + K  Q   KI  L+N    L+++   K Q I+ +    DS+++W QN I+  
Sbjct: 794  RENLLDETKKSCQ--NKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETL 851

Query: 823  EMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTLEPTLRK 879
                +S+++ L+ K+  +E+   EI++L+KE+ + K +   Y  LD+    S  + +LR+
Sbjct: 852  RKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDE----SINDDSLRR 907

Query: 880  ELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREE 939
            ELE+ ++ L DA SQIQ Y+++  + + +L E+ ++L ++ + +  +I+    EK + E+
Sbjct: 908  ELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTSLED 967

Query: 940  DLSRLRGELGEIRA---LQPKL-------KEGALHFVQQSEKLRNEVERIQKMIE----K 985
             +S LR ++  +     LQ +         +  +  +Q + K   E+E ++   E    K
Sbjct: 968  KVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNK---EIEAVKTEYESKLSK 1024

Query: 986  IEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDL 1045
            I+K      +      + Y+  ++++ D+S+ +  L +     + ++     +    +  
Sbjct: 1025 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKA 1084

Query: 1046 LDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFS 1105
            L ++E  W  +K     +L  +  + E L  +N +L ++++            K  S+ +
Sbjct: 1085 LKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLN 1144

Query: 1106 N-----LRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVII 1160
            N     LR ER+ L+TK+   +R+   ++QK   ++  + + +     S+ E +  + II
Sbjct: 1145 NDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSFII 1204

Query: 1161 DEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKE 1220
             +  ++ +++ Q+N+L+E+N  L+  L +   KN+E+  +L   +  I+ ++ +L   K 
Sbjct: 1205 QQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKF 1264

Query: 1221 QVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANA 1280
             +     +I + + E+ + K+R QD+ ++ +     D EKL  EI  LK +L       A
Sbjct: 1265 SIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGA 1324

Query: 1281 DLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDL----- 1335
            D E KFNRL++QA EKL ASK  Q +   +LNELK  K  LE+ L+  NA++ +L     
Sbjct: 1325 DSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKV 1384

Query: 1336 ---------------DTKLKAHELQSE----DVSRDHEKDTYRTLMEEIESLKKELQIFK 1376
                           DT+  + EL+++     +S D    T + L EEI  LK+EL+  +
Sbjct: 1385 AENRNQLSMIKKLQEDTEENSKELETKLEENAISYDS---TVKKLNEEIGILKEELEKQR 1441

Query: 1377 TANSS------------SDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAE 1424
                             S   E +K + E++K + I+E+T+E  +K++E      + E  
Sbjct: 1442 QIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETG 1501

Query: 1425 YSK---DIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
                  +I+ +KK+W  E+ +E  ++I+EAEE LKKRIRLP+EE+I KII
Sbjct: 1502 LKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKII 1551

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  405 bits (1041), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 440/1550 (28%), Positives = 824/1550 (53%), Gaps = 112/1550 (7%)

Query: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64
            I+ F     E ++     V++ L  K+ +F   + E  K+ V  DE+K+    +I  LK 
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83

Query: 65   LLDESSEQKNTAKEELNGL----------KDQLNEERSRYRREIDAL---KKQLHVSHEA 111
             ++    + +  ++E N            K +L+ E    +R++D L   KK+   + + 
Sbjct: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143

Query: 112  MREVNDEKRVKEEYDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQ 171
              ++ DE R+KE   I   R +                    M++E   Q   +N ++ +
Sbjct: 144  TLKILDE-RLKE---IELVRVENNRSNSECKKLRSTI-----MDLETKQQGYITNDLNSR 194

Query: 172  LKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVF 231
             + +   QE  L+  +   +E++L S +++ L+        + ++  +L +++++++   
Sbjct: 195  TELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMER 254

Query: 232  TYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLE 291
            T N  L  +N +LS+S++EK+LE+K L D+ + EK EFS EM+L++ + DLL SQL +++
Sbjct: 255  TNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVK 314

Query: 292  KDC-SLRAIEKN----DDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKE 346
            ++  S+R +       DD+  + PE+ D++ EL  TK +L + + EC RL +I  +  ++
Sbjct: 315  EELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEADED 374

Query: 347  EEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFK 406
             E     S+         SD   LK+QLIKER  K  LQNQ+E FI+ELEHK P + SFK
Sbjct: 375  NENLSAKSS---------SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFK 425

Query: 407  ERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVK 466
            ERT  LE+EL  +  LLE  S  K  + +E+ +  QK+  CE ++ +L KQRLDL RQ++
Sbjct: 426  ERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQ 485

Query: 467  LLLLNTSAIQETASPLSQDELISLRKIL-ESSNIVNENDSQAIITERLVEFSNVNELQEK 525
             LL+  S   ++  PL ++E+  ++ I+ E  + + E+DSQ ++TERLVEF N+ +LQEK
Sbjct: 486  YLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEK 545

Query: 526  NVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLR 585
            N ELL  +R LADKLE+ E K  ++LQK+E++T+ EAK+AII L++    +E+RI  L +
Sbjct: 546  NAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQK 605

Query: 586  ERDSYKLLASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKEL 642
            E +  K     E+   +  ++  +   +   E ++++L+  +S    E++  +  L KE+
Sbjct: 606  ELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEI 665

Query: 643  LIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEK 699
                 S+      L   ++ + LA+E+ ++L   +D  KAE   L K+  ++ + I  + 
Sbjct: 666  QDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQD 725

Query: 700  ERASTELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLK 756
             +    L++    + K+  +E E+  LK+E    +  +++L ++  +   EK  L++ + 
Sbjct: 726  SKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVT 785

Query: 757  ESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQ 816
            + +    E +          + KI ELE+ L  L+ +   K   I+ +    +S ++W Q
Sbjct: 786  QLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQ 845

Query: 817  NTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTL 873
            N I+  +   +S++T + +K+T IEKL  ++++L+KE+ + K +   Y  +D+  +    
Sbjct: 846  NKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIN---- 901

Query: 874  EPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKE 933
            + +LRKELE+ ++ L DA SQI+ Y+++  +   +L +  ++L ++ +++  +I+    E
Sbjct: 902  DDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDE 961

Query: 934  KWAREEDLSRLRGEL----GEIRALQPKLKEGALHFVQQSEKLRN---EVERIQKMIE-K 985
            K + E+ +S L+ ++     E+   +  +++    F ++   L+N   EVE ++   E K
Sbjct: 962  KTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESK 1021

Query: 986  IEKMSTIVQ---LCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSA 1042
            + K+   +    +      + Y+  ++++ D+S+ +  L +     + ++     S    
Sbjct: 1022 LSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQL 1081

Query: 1043 QDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAAN---NGDKDHL 1098
            ++ L ++E+ W  +K     +L  +  + E L  +N +L +++   TAA+   N   +  
Sbjct: 1082 ENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGP 1141

Query: 1099 KLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAV 1158
             L ++   LR ER+ L+TK+T  +R+   ++QK   ++  + D +     S  E +  + 
Sbjct: 1142 GLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSS 1201

Query: 1159 IIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQT 1218
            II +  DI +++ Q+N+L+E+N  L+  L+N   K +E+  +L+  ++ ++ ++ +L   
Sbjct: 1202 IIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTAL 1261

Query: 1219 KEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENA 1278
            K  +     ++ + + E+ + K+R QD+ ++ +     D EKL +EI +LK +L + E  
Sbjct: 1262 KYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQ 1321

Query: 1279 NADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDL--------HFENA 1330
             A+ E KFNRL++QA E+L  SK  Q +LT ++N L+  K+ LE  L          +NA
Sbjct: 1322 GAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNA 1381

Query: 1331 KVIDLDTKLKA------------HELQS--EDVSRDHEKDTYRTLMEEIESLKKELQ--- 1373
            KV   + +L+A             ELQ+  E+ +  +E  T   L EEI +LK+E++   
Sbjct: 1382 KVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYE-STINGLNEEITTLKEEIEKQR 1440

Query: 1374 ------IFKTANSSSD---AFEKLKVNMEKEKDRIIDERTKEFEKKL---QETLNKSTSS 1421
                     +AN  +D     E +K + E++K + I E+T+E  +K+   QE LN+ ++ 
Sbjct: 1441 QIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNI 1500

Query: 1422 EAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
                  ++E +KK+W  E+E E  ++I+EAEE LKKRIRLP+EE+I KII
Sbjct: 1501 ------NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKII 1544

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  402 bits (1034), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 382/1348 (28%), Positives = 706/1348 (52%), Gaps = 100/1348 (7%)

Query: 211  SHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFS 270
            S + ++ ++L   + + ++     K L  QN Q    +E +   +K L D  +  K EF+
Sbjct: 231  SELASVSQRLETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFT 290

Query: 271  KEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSK 330
            +EM+L++ + +LL  Q+++L+ +   +   +   ++      + + DEL+    +LE+S+
Sbjct: 291  REMSLKQRLVELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESE 350

Query: 331  NECQRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLED 390
             + Q+L+  V      +E T++ S   P    L++DI +LK+Q+I ER QK  LQNQ+E 
Sbjct: 351  LKIQKLEQTVEQLLSADEKTISGSQSLP---DLYADIGILKKQVIHERRQKEFLQNQVEA 407

Query: 391  FILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEAN 450
            F++ELE+K P L SFK+R   LE EL  +  +L+++S  K +   ++   + +I   E+ 
Sbjct: 408  FVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQ 467

Query: 451  IHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIIT 510
            I +L +QR DLARQV+ LL+  +   ++  PLS +E   ++K++   N   + D+Q II+
Sbjct: 468  ISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIIS 527

Query: 511  ERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELE 570
            ERLVEF N+ ELQ KN +LL+ +R LA++LE  E K     + +EN TI EAK+AI+ L+
Sbjct: 528  ERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQ 587

Query: 571  NINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEA-AREK---KIRELEAELSS 626
            +   ++ETRI+++ RERD+YK + S   ++ +   +  + A A E    KIRELE  LS+
Sbjct: 588  DHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSA 647

Query: 627  TKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKA---E 683
             K E  A ++ L  E     +S+ +    +E  ++ + LA+E+ ++ + ++   K    E
Sbjct: 648  AKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEE 707

Query: 684  LEKQKSWVPSYIHVEKERAS---TELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRD 740
            L K+   + + +  +  R     +EL   + ++ +L  E+     +      + + L   
Sbjct: 708  LNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKET 767

Query: 741  FEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQE 800
             EQ  KE+ EL + + + +    E        +  +K KI  LE  + +LR+ L  K  E
Sbjct: 768  NEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATE 827

Query: 801  IESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELR--KTK 858
            +    S  DS+ +W Q  ID     +KS  ++L++K   I++L S+   L  +LR  +TK
Sbjct: 828  LSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETK 887

Query: 859  FQ-YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELA 917
             Q Y  L+Q  D  T    LR ELE+ ++ LKDA SQ+  Y+ + +S +  L  +   L 
Sbjct: 888  SQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALE 947

Query: 918  KTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRA---LQPKLKEGALHFVQQSEK--- 971
             +K+++  ++E  KKE+ A   D + L+ +L  + +    Q  L E   H   + E+   
Sbjct: 948  HSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVK 1007

Query: 972  --------LRNEVE-RIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLE 1022
                    ++++ +  + K+ E + + +    +   K    Y+  ++ + D+S+ + +L 
Sbjct: 1008 SNKTALASMKDQYQLELSKLTEDLNQQA----MYANKAQENYEQELQRHADVSKTISQLR 1063

Query: 1023 KDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLI 1082
            ++A   + ++   ++S+   +  L+++E  W  +K +YE +   + ++ E L  +N +L 
Sbjct: 1064 EEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLF 1123

Query: 1083 EKV-----DDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEK 1137
            +++     D    N+  K   +   L S L+ E + L+TKL   KR+ + +KQK +  E+
Sbjct: 1124 DQISLKDTDSIPINDELKSEAR--ELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQ 1181

Query: 1138 TI----NDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEK 1193
             +    ++++++Q  S+      +++I+E   I +++ QVN+L+E+N  L+  L+  +++
Sbjct: 1182 ELSVAKSEIRKSQVTSD----TRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQR 1237

Query: 1194 NREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDA 1253
            N+++ + + + QE +  L+ D++  +  V     +I +   E+ + KQR QD+  + +  
Sbjct: 1238 NQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERV 1297

Query: 1254 QKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNE 1313
              ++ +KL  E+S  + + ++     ++LE++F RLKKQA E+LD ++  Q  L  EL E
Sbjct: 1298 DPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTE 1357

Query: 1314 LKAIKDKLEQDLHFENAKVIDLDTKLKA---HELQSEDVSRDHEKDTY------------ 1358
             +  +  LE  L  E  K   L   +KA   +E+++   +RD  +D              
Sbjct: 1358 ARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINE 1417

Query: 1359 ---------RTLMEEIESLKKEL-----QIFKTAN------------SSSDA-FEKLKVN 1391
                     +TL EE+E  ++ +      + KT N            S ++A   ++K  
Sbjct: 1418 MSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTE 1477

Query: 1392 MEKEKDRIIDERTKEFEKKLQET-------LNKS-TSSEAEYSKDIETLKKEWLKEYEDE 1443
            +    ++++ E+  E ++K ++        L KS  SSE+  S DIE LKKEW +EYE  
Sbjct: 1478 LIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEEYEQR 1537

Query: 1444 TLRRIKEAEENLKKRIRLPSEERIQKII 1471
            T++RI+EA E L+KRIRLP+EE+I KII
Sbjct: 1538 TIKRIEEANEILRKRIRLPTEEKINKII 1565

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  398 bits (1023), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 443/1591 (27%), Positives = 801/1591 (50%), Gaps = 152/1591 (9%)

Query: 4    KISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLK 63
            K++ FL V    +Q +   ++   + K  +F + + +  +L++ +D +K  +  +I+  K
Sbjct: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76

Query: 64   Q-----LLDESS---EQKNTAKEELNGL--KDQLNEERSRYRREIDALKKQLHVSHEAMR 113
            +     L D +S   E++ T  E+L  +  K QL+ E  + R +++  K+ + +   A +
Sbjct: 77   EQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQ 136

Query: 114  EVNDEKRVKEEY-DIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQL 172
            +V   K ++E+  D+  S+++                    +++E I+Q  KS  +  + 
Sbjct: 137  DVT--KLLEEKISDLAASKEESDRLLAANKELRKSS-----IDLEFIIQGYKSQELREKS 189

Query: 173  KYDTSVQEKELM----------LQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQ 222
            +     QE  L+          L+SK    E+L+SF +KT       +S ++N  E++  
Sbjct: 190  EIQRLHQELNLVKSNADWLSKELESKN---EQLNSFREKT-------NSELQNGYEQVNS 239

Query: 223  MQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDL 282
            ++S  E     N  L  +  +LS  ++EK++E K L D  + EK EF++EM+L++ + DL
Sbjct: 240  LKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDL 299

Query: 283  LRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQ---NI 339
            L SQ++S++ D    A +  + N    PE   ++DELIDTK  LE ++ E  +L+   N 
Sbjct: 300  LESQVSSMKSDLE-NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNE 358

Query: 340  VMDCTKEEEATMTTSAVS--------PTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDF 391
            ++    +    +  S VS         TV KL  DI +LK+QL++ER QK +LQNQ+E F
Sbjct: 359  LLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESF 418

Query: 392  ILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANI 451
            ++ELEHK P L SFKERT  LE EL   T LLE+ +  + ++  E+   + KIN  E+ +
Sbjct: 419  VVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQV 478

Query: 452  HSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITE 511
             SL+ QR DLA QV+ LL+  S   +   PL++ E+  +++I+ S +   ++D+Q II+E
Sbjct: 479  CSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISE 538

Query: 512  RLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELEN 571
            RLV+F +V ELQ KN ELLN IR LADKLE+ E K    L+ VE QT+KEAK+AI+ L+ 
Sbjct: 539  RLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQE 598

Query: 572  INAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVEN 631
               ++E ++ I+ +ERD++KL  S  +   +  S T      ++ I ELE  L +   ++
Sbjct: 599  HVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQS 658

Query: 632  SAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK---AELEKQK 688
               I+ L  E+    K++ +    LE   + K LA+E+ ++++  +   K    EL K+ 
Sbjct: 659  QDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRS 718

Query: 689  SWVPSYIHVEKERAST---ELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCC 745
              +   +  + E+  +   E+  ++ ++ +L  +++ L  E       +  L  + E   
Sbjct: 719  DDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALT 778

Query: 746  KEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIR 805
            KE    ++ + + +    E  +     +  Y+  I++LE++L   R  L  + +E E  R
Sbjct: 779  KENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQR 838

Query: 806  SCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YK 862
                SQ KW Q  +D    ++ +    L  K  +IE L    ++L  +L + + +   Y 
Sbjct: 839  VSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYS 898

Query: 863  FLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKEN 922
             L    D +    TLRK LE+  + L DA SQI+ Y+ +   +E + +E+   L +++ N
Sbjct: 899  VLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQAN 958

Query: 923  YDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE----------GALHFVQQSEKL 972
            Y   I L ++E+ +  + ++ L  ++ ++ +     K             L  +Q S++ 
Sbjct: 959  YRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRS 1018

Query: 973  RNEV-----ERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAAD 1027
             +E+     E+I K+ E + + ++     +K     Y+  ++++ D+++ +  L +++  
Sbjct: 1019 LDELKSEYEEKISKLQEDLTQQASYANQAQKN----YEQELQKHADVTKTISLLREESQK 1074

Query: 1028 CQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD- 1086
             ++E+   K S   A+  L+++E+ W ++ AD E +L    ++TE L  +N +L ++V+ 
Sbjct: 1075 YKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVEL 1134

Query: 1087 DTAANNGDKDHLKLVS-----LFSNLRHERNSLETKLTTCKRELAFVKQK----NDSLEK 1137
             + A + D +    +S     L   LR ER+ LETKL    RE   ++Q+       LE 
Sbjct: 1135 LSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELEN 1194

Query: 1138 TINDLQRTQTLSEKEYQCSAVIIDEFKD-ITKEVTQVNILKENNAILQKSLKNVTEKNRE 1196
               +  +TQ  +       ++   E ++ I +++ Q+N+L+E+N  L+   K   E+++ 
Sbjct: 1195 VRLEFSKTQATA-----PDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQH 1249

Query: 1197 IYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKK 1256
               ++   QE++  L+  L      +S    +I + + E  + KQR QD+  + +     
Sbjct: 1250 FQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPV 1309

Query: 1257 DIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKA 1316
            + +KL +E+++LK +L      N + + +F +L+KQA+E+LD  K  +A + +E   +  
Sbjct: 1310 EHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSI 1369

Query: 1317 IKDKLEQDL---------------HFENAKVIDLDT------KLKAHELQSEDVSRD--- 1352
             K +LE +L                  N K  + D+      +L+A+ +++ +   D   
Sbjct: 1370 AKAQLEAELAQTLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIKA 1429

Query: 1353 ----HEKD---TYRTLMEEIESLKKELQI----FKTANSSSD---AFEKLKVNMEKEKDR 1398
                 EKD     + L E+I++L+ E++      K +N S D     E +K   E+EK  
Sbjct: 1430 EAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQV 1489

Query: 1399 IIDERTKEFEKKLQE------------------TLNKSTSSEAEYSKDIETLKKEWLKEY 1440
            +I E+ +E   KL+E                  +L +ST +      D ETLK +   EY
Sbjct: 1490 LIQEKDEELRMKLEEIQKQYEEERERELSELKASLVESTPNAPLI--DEETLKSKLEAEY 1547

Query: 1441 EDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
            E +TL RI+EAEE LKKRIRLPSEERI ++I
Sbjct: 1548 EKKTLERIREAEEALKKRIRLPSEERINQVI 1578

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  398 bits (1023), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 396/1361 (29%), Positives = 705/1361 (51%), Gaps = 115/1361 (8%)

Query: 208  TKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKA 267
            T  S +  L +KL  ++   ++    NK L   N +++  +E ++  +K L D  + EK 
Sbjct: 226  TTQSQLAALTQKLETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQ 285

Query: 268  EFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE-KNDDNSCRNPEHTDVIDELIDTKLRL 326
            EF++EM+L++ + DLL  Q+ SL+ D  LR+   + DD S  NP +  + +EL     +L
Sbjct: 286  EFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNA-LSEELAQKTQQL 344

Query: 327  EKSKNECQRLQNIVMD-CTKEEEATMTTSA--VSPTVGKLFSDIKVLKRQLIKERNQKFQ 383
            E+S+ + Q+L+  V D  + ++E+ + +SA     +V  L+ DI +LKRQ+I E+ QK  
Sbjct: 345  EESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEH 404

Query: 384  LQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQK 443
            LQNQ+E F++ELE K P L SFK+R   LE +L  +  +LE++S  K     ++   + +
Sbjct: 405  LQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQ 464

Query: 444  INGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNEN 503
            I+  E  I  L +QR DLARQV+ LL+  S   ++  PL+ +E+  +R+ILE  ++  E 
Sbjct: 465  IHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLER 524

Query: 504  DSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAK 563
            D+Q +I+ERLVEF ++ ELQ KN +LL  IR LADKLE+ E +     + VEN  I+EAK
Sbjct: 525  DTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAK 584

Query: 564  DAIIELENINAKMETRINILLRERDSYKLL--ASTEENKANTNSVTSMEAAREKKIRELE 621
            +AII L+    ++E+RI +L +ERD+YK +  ++   NK   +++ + +     ++ +LE
Sbjct: 585  EAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLE 644

Query: 622  AELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK 681
              L + + E    ++ L  E+    + + K    +E     K LA+E+ ++ + ++   K
Sbjct: 645  RSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTK 704

Query: 682  A---ELEKQKSWVPSYIHVEKERASTELS---QSRIKIKSLEYEISKLKKETASFIPTKE 735
                EL K+   +   +  +  +    LS   + + K+ +LE E+     +  S    ++
Sbjct: 705  QENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQK 764

Query: 736  SLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQ 795
              T   EQ   E+  L + + + +    E     +  E  YK K+  LE    +LR+ L 
Sbjct: 765  KNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLS 824

Query: 796  SKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELR 855
             K +E        DS+ +W Q  ID     +K + ++L ++  T   L S+ + L+  L+
Sbjct: 825  RKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLK 884

Query: 856  --KTKFQ-YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAY-------EEIISSN 905
              +TK Q Y  L+Q  D       LR ELE+ +++L+DA SQI+ +       EE +S+ 
Sbjct: 885  EVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAI 944

Query: 906  ENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKEGALHF 965
             NA    KNE +K   N   K +    +  A +  +S L  ELG  +            F
Sbjct: 945  TNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKK----------QF 994

Query: 966  VQQSEKLRNEVERIQKMIEKIEKMSTIV--QLCK------------KKEMSQYQSTMKEN 1011
              +  +L N++  +Q   E +  M      QL K             K    Y+  ++ +
Sbjct: 995  DSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRH 1054

Query: 1012 KDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQT 1071
             D+S+ + +L +++   + + +  +SS+   +  LD+ + KW+ +K +YE +L S  ++ 
Sbjct: 1055 ADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRI 1114

Query: 1072 ESLRVENSVLIEKVD----DTAANNGDKD-HLKLVSLFSNLRHERNSLETKLTTCKRELA 1126
            E L V+N +L++++D    D  +  G  +   K+  L ++LR ER+ L+TKL   KR   
Sbjct: 1115 EDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSET 1174

Query: 1127 FVKQKNDSLEKTIN----DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAI 1182
               +K +++E+ ++    +L   Q LS +    ++++ DE   + +++ Q+N+L+E+N  
Sbjct: 1175 VSLRKLEAIEQELSFAKEELSSLQALSSQ----NSIMADEHNKLLEQLNQLNLLRESNIT 1230

Query: 1183 LQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQR 1242
            L+  ++  T++ +E+  Q+++ Q+ +  L+ +L   K  V    ++I +   E  + KQR
Sbjct: 1231 LRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISLISEETNRWKQR 1290

Query: 1243 YQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKK 1302
             QD+  + +    ++ +KL  E+S  K +L++  + N++LE++F RLKKQA E+LDA+K 
Sbjct: 1291 SQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKA 1350

Query: 1303 QQAALTNELNELKAIKDKL------EQDLH---------FENAKVIDLDT---------K 1338
             Q  L+ EL + +  +  +      EQD++          E+    D  T         K
Sbjct: 1351 VQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQK 1410

Query: 1339 LKAHELQSEDVSRD-----------------HEKDTYRTLME---EIESLKKELQIFKTA 1378
            L   E +++D+  D                 H ++  R L E   E+ESL+   ++ + A
Sbjct: 1411 LSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEARREVESLE---EVKQGA 1467

Query: 1379 NSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQE-------TLNKSTSSEAEYSK-DIE 1430
             + S   EK+K ++E+  + +I E+  E     +E       T  K      +++  DIE
Sbjct: 1468 FTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIE 1527

Query: 1431 TLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
            TLKK+W ++YE +T++RI+E+ E L+KRIRLP+EE+I KI+
Sbjct: 1528 TLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIV 1568

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  375 bits (963), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 476/1812 (26%), Positives = 897/1812 (49%), Gaps = 207/1812 (11%)

Query: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64
            I  FL+VP E L  +   +L  L  K+ +F   + +  K  V ++E++     RI+ L+ 
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 65   LLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEE 124
             L++  EQ  +A EE   ++ +L++E+            QL  + + +R   + K ++E+
Sbjct: 76   QLEDLIEQNASASEEKKKIEKELSDEKKESF--------QLSSTRDNLRA--ELKEIQEK 125

Query: 125  YDIWQSRDQGXXXXXXXXXXXXXXXXXXXMEMENILQRCKSNAISLQ-----LKYDTSVQ 179
            +D  Q ++Q                    +++ N  +   +    L+     LKY+ S+ 
Sbjct: 126  FDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLT 185

Query: 180  EKELMLQSKKL-----IEEKLSS---FSKKTLTEEVTK-SSHVENLEEKLYQMQSNYESV 230
            E  +   S+ L     I+E+L +      K ++E  +   + ++ L +K+  +++N   +
Sbjct: 186  ETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSII 245

Query: 231  FTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSL 290
             + N  L  +N+ +S ++ EK  +++ L +  + EK E  KE++L++ M D+L++Q+  L
Sbjct: 246  KSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKL 305

Query: 291  EKDCSL-----RAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTK 345
            + D +      + I +ND+   RN E  ++  +LI+T+ +L K   E +  +NI M    
Sbjct: 306  QDDYTRILNTKQPIVQNDEE--RNLEVEELKQKLIETETQLNK---ELEERRNITMQT-- 358

Query: 346  EEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISF 405
             E +T++         +   D+  +K++LI+ER QK +LQNQ+E FI+ELE K P + SF
Sbjct: 359  -ESSTLS--------NQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSF 409

Query: 406  KERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQV 465
            K+RT  LE EL  +T LLE +   K +   E+ +LRQ     +    SL KQR DLA Q+
Sbjct: 410  KQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQL 469

Query: 466  KLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEK 525
            + +L++TS   ++  PLS +E+  ++ IL++ +    +DSQ +I+ERLV F N+ ELQ+K
Sbjct: 470  QYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQK 529

Query: 526  NVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLR 585
            N++LL  +R LA KLE  E  Q  T Q VE Q I EAK+AII L++ N K+E +I  L  
Sbjct: 530  NIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLND 589

Query: 586  ERDSYKLLASTEENKANTNSVTSMEAAREKK---IRELEAELSSTKVENSAIIQNLRKEL 642
            E D YK L      K +T   T      E+    I+ELE  L++++ E++    +L  E+
Sbjct: 590  ELDCYKSLP-----KPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEI 644

Query: 643  LIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEK 699
               +++  +     ++    + LA+++ ++++ ++   K E   L+K+   +      + 
Sbjct: 645  DDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQD 704

Query: 700  ERASTELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLK 756
            +R    L +    ++ + + + E++ ++ +       ++SL  D     KE+ EL+  + 
Sbjct: 705  QRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVS 764

Query: 757  ESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQ 816
            + +    E +  F+S +   + ++  +E  L  +   L++K +EI+ + S + S+++W Q
Sbjct: 765  QLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQ 824

Query: 817  NTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTL 873
            N ID  + K  +   EL  K   I +L+ EI+ L K+L+ ++ +   YK L+ + +  T 
Sbjct: 825  NKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTK 884

Query: 874  EPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKE 933
              TL+ ELE+ ++ L +A +++  Y++  S  E  L   +N + +TK+ +  KIE  +K+
Sbjct: 885  METLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKD 944

Query: 934  KWAREEDLSRLRGELGE-IRALQPKL-KEGALHFVQQSE--KLRNEVERIQKMIEKIE-- 987
            +    ++L   +  L E I  L  +L  +   H  ++SE  K  NE+      IE++   
Sbjct: 945  R----DELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQ 1000

Query: 988  ---KMSTIV----QLCKKKEMSQ--YQSTMKENKDLSELVIRLEKDAADCQAELTKTKSS 1038
               K+ST+     Q      ++Q  Y+  ++++ +L++ + +L +DA   + ++   +++
Sbjct: 1001 YELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQAN 1060

Query: 1039 LYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD------------ 1086
              + ++LL K+E+ W E++  YE ++ +  ++ E L  +N +L ++VD            
Sbjct: 1061 ATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQ 1120

Query: 1087 DTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQ 1146
             +A  N D        L  +LR +R+ L+T+L+  + E   ++ K  S+   + + +   
Sbjct: 1121 SSATPNED--------LVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKL 1172

Query: 1147 TLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQE 1206
            T   ++Y+ + + ++E  +I  ++ Q+N+L+E+N  L+    +  EK +++ + L   +E
Sbjct: 1173 TEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLRE 1232

Query: 1207 EISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEIS 1266
            ++  L+ +  + KE +  N  ++  Y+ E  + KQR QD+  + K     + EKL  EI+
Sbjct: 1233 KVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIA 1292

Query: 1267 DLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLH 1326
             LK  L+  +  N +L ++FNR+KKQAHE+L++SK  Q  L +++ +L+     ++  L 
Sbjct: 1293 TLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLE 1352

Query: 1327 FENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEE---------------------- 1364
             E   + + + K +    QSEDV+        R+ +EE                      
Sbjct: 1353 TERGNIQNTEEKFRQMNKQSEDVT------ALRSQLEEALLSSKEFENKFNASVKSSDEI 1406

Query: 1365 -------IESLKKELQIFKTANSS----------SDAFEKLKVNMEKEKDRIIDERTKEF 1407
                   I+SL  EL   K + ++          S+  E++K + E+EK + + ++T EF
Sbjct: 1407 SSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEF 1466

Query: 1408 EKKLQETLNKSTSSEAEYS-------KDIETLKKEWLKEYEDETLRRIKEAEENLKKRIR 1460
            ++KL E + +  +   +         +DI   +++W KEYE+  L+RI++AEENLK+RIR
Sbjct: 1467 KEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIR 1526

Query: 1461 LPSEERIQKIISXXXXXXXXXXXXXXXXNAGSL-------TFLDN------KGSGEDAEE 1507
            LP+EE+I  +I                  A  L       TF+++      K    + ++
Sbjct: 1527 LPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQ 1586

Query: 1508 ELWNSPSKGNSERPSAV---AGFINQK--NLKPQEQLKNVKNDVSFNDSQSMV-TNKENN 1561
            EL N+ +K   E          F+ +K   L+ Q Q  N  N+ + ND + ++ T  + N
Sbjct: 1587 ELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANE-NKNDVEVLLKTPSDEN 1645

Query: 1562 IVDSSAAGNKAIPTFS---FGKPFFSSNTSSL--------QSFQ------NPFTAS--QS 1602
             V S      + P  S      P  S+  ++L         S Q      NPFT+   Q+
Sbjct: 1646 NVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQT 1705

Query: 1603 NINTNAPLRTLNIQPEVAVK--AAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSS 1660
              + N P  T   QP   ++  +  N S V+ ++  ST     +E  + S+ P+ S   +
Sbjct: 1706 KNDANIPAVT---QPAFLLREPSEPNMS-VSTISRQST-----SETNTESELPVSSEGLA 1756

Query: 1661 DPDTKKVKESPA 1672
             P +K+    PA
Sbjct: 1757 TPSSKR----PA 1764

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  367 bits (942), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 444/1559 (28%), Positives = 758/1559 (48%), Gaps = 213/1559 (13%)

Query: 219  KLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKN 278
            K+  M+S  E   T N+ L      L + +E+K+ E K +KD  +  K E +KEM+L++ 
Sbjct: 228  KVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQR 287

Query: 279  MNDLLRSQLTSLEKDCSLRAIEKNDDNS-CRNPEHTDVIDELIDTKLRLEKSKNECQRLQ 337
            M D L   + SL+K+  + A + N D+S     E  ++I+EL   K RL+ S++ C +L+
Sbjct: 288  MIDALEKHMESLKKE--MDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLK 345

Query: 338  NIVMDCT-----KEEEATMTTSAVSPTVG---KLFSDIKVLKRQLIKERNQKFQLQNQLE 389
              + + T     ++ E   TT++   +V    KL+ D+ +LK+QL+ E+ QK +L+ Q+E
Sbjct: 346  ETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVE 405

Query: 390  DFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEA 449
             F++ELEHK P L SFKER++ LE EL   T LLE+    + ++  ++  L+  +   E 
Sbjct: 406  AFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYET 465

Query: 450  NIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAII 509
             I SL KQR+DLA Q++ LL+N S   E   PLS +EL  ++ +  S  I   +D+Q II
Sbjct: 466  QIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGII 525

Query: 510  TERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIEL 569
            T+RLVEF +V ELQ+KN ELL+ IR LAD+LE  E +    +Q +E++T++EAK+ I+ L
Sbjct: 526  TDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTL 585

Query: 570  ENINAKMETRINILLRERDSYKLLASTEENKANT-NSVTSMEAAREKKIRELEAELSST- 627
             +    +E ++ IL +ERD+YK L+    +  NT  ++T      + K+++LE  L++  
Sbjct: 586  HDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVI 645

Query: 628  -KVENSAI-----IQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK 681
             + EN+A        NLRK+L  Y+ S        E  +  + LA+++  +L+  ++  K
Sbjct: 646  QEAENNAKEWSSENSNLRKKL--YEIS-----LNFESEKTSRTLAEDRLNLLQSTLELSK 698

Query: 682  ---AELEKQKSWVPSYIHVEKERASTELSQSRIKIKS----LEYEISKLKKETASFIPTK 734
                EL+K+ S +   I  ++++ + E   S IK KS    ++ E+S LK E       +
Sbjct: 699  RQCEELQKRSSDLQD-ILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQ 757

Query: 735  ESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELE----NNLERL 790
            + L  + E+  KE  E ++ + + +    E +M     +  YK K+++LE     +LERL
Sbjct: 758  KELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERL 817

Query: 791  RSDLQSKIQEIE----SIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSE 846
                    +EIE     I S K+ Q  W Q  ID    +     T L  KE  ++K+ S 
Sbjct: 818  --------EEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQST 869

Query: 847  IENLDKELRKTKFQ---YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQI-------- 895
            I     +L++ + +   Y  L    DA  L  TLR+ELE++ +QL D+ SQI        
Sbjct: 870  INEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAE 929

Query: 896  ----------QAYEEIISSNENALIELKNE---LAKTKENYDAKIELEKKEKWAREEDLS 942
                      QA+EE    ++  +I L+NE   L  T    + +++    E + ++ +  
Sbjct: 930  QSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQ 989

Query: 943  RLR-GELGEIRALQPKLKEGALHFVQQS-EKLRNEVERIQKMIEKIEKMSTIVQLCKKKE 1000
              R   + EI  LQ          V++S ++ + + E    MI+K  +M T  Q   + +
Sbjct: 990  TERNATMEEISKLQ---------MVKESVDRTKADYEEKIAMIQKDLEMQT--QYANESQ 1038

Query: 1001 MSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADY 1060
             S Y+  ++++ D+S+ +  L  +A   +++L   K+    A + L   E+ W E+K +Y
Sbjct: 1039 RS-YELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEY 1097

Query: 1061 ERELISNIEQTESLRVENSVL---IEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETK 1117
            E +L    ++ + L  +N +L   IE ++ T   +   D      L  +LR ER+ LETK
Sbjct: 1098 EDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDS---SDLLISLRRERDMLETK 1154

Query: 1118 LTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILK 1177
            L     E   +KQ+ D  +  I DL    +  +     SA ++++ ++I KE+ Q+++L+
Sbjct: 1155 LEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLR 1214

Query: 1178 ENNAILQK---SLKNVTEKNREIYKQLNDR----QEEISRLQRDLIQTKEQVSINSNKIL 1230
            E+N  L+    S K   +  +   ++ NDR    Q  IS LQ   I+ KEQ  I S +  
Sbjct: 1215 ESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNG-IKIKEQELIQSKE-- 1271

Query: 1231 VYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENA-------NADLE 1283
                E E+ K R QD+  + +    ++  KL  EI+D+K +L + ++          D E
Sbjct: 1272 ----EAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWE 1327

Query: 1284 NKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLH----------------- 1326
            +KF R++ QA ++L+ASK+++ +L++E+N++   K ++E DL                  
Sbjct: 1328 SKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVT 1387

Query: 1327 ---------FENAKVIDLDTKLKAHELQSEDVSRDHEKDT-----YRTLMEEIESLKKEL 1372
                     F N+++  L   L + ++Q E+ S+  + +       ++L E +E L  ++
Sbjct: 1388 QEAETKEQTF-NSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKI 1446

Query: 1373 QIFKTANSSSDAF-----------------EKLKVNMEKEKDRIIDERTKEFEKKLQ--- 1412
            Q  +   S++                    + LK   E EK+++I ++ KE   K +   
Sbjct: 1447 QELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEK 1506

Query: 1413 --------ETLNKS------------------TSSEAEYSKDIETLKKEWLKEYEDETLR 1446
                    E L K                   + S+     DI+ LK EW KEYE +TL 
Sbjct: 1507 ESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDIDALKNEWEKEYEKQTLE 1566

Query: 1447 RIKEAEENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGSLTF-LDNKGSGEDA 1505
            +IK AEE LKKRIRLP++++I KI+                  A  L   + N     + 
Sbjct: 1567 KIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEK 1626

Query: 1506 EEELWNSPSKGNSERPSAVAGFINQKNLKPQEQ-----LKNVKNDV-SFNDSQSMVTNKE 1559
                 N+      ++  A    I QK+ +  +Q     LK +++ + +    +S +   E
Sbjct: 1627 HRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKPVE 1686

Query: 1560 NNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPE 1618
            N+  + SAA         F  P F S++    +F +PF+ S+ + N      T   QPE
Sbjct: 1687 NDTSNMSAA---------FQAPVFGSHS----TFTSPFSTSEISPNKRPIDDTATEQPE 1732

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  357 bits (917), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 373/1344 (27%), Positives = 697/1344 (51%), Gaps = 155/1344 (11%)

Query: 252  VLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCS--LRAIEKNDDNSCRN 309
            ++E K+LKD  +VEK EF KE++++  +  L  +Q+ SLE       +  E N++NS   
Sbjct: 260  LIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEANEENS--- 316

Query: 310  PEHTDVI----DELIDTKLRLEKSKNECQRLQNIV----------------------MDC 343
               ++V+    +EL   + +L+  + +C RL++I+                         
Sbjct: 317  ---SEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRTYSNDSNSN 373

Query: 344  TKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELI 403
            + +E  +   S++S  + ++  DIK+LKRQL++E+ QK +LQNQ+E F++ELEHK P + 
Sbjct: 374  SSDELGSFDDSSIS--LSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVIN 431

Query: 404  SFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLAR 463
            SF+ERT  LE EL  +  LLE  +     +  E+ SL++KI+   + +  L++QR DLA 
Sbjct: 432  SFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAH 491

Query: 464  QVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQ 523
            Q++ LL+N S I +    L++DE+  ++ ++ + N+ + NDSQ +I+E L++F ++ +LQ
Sbjct: 492  QLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQ 551

Query: 524  EKNVELLNCIRILADKLENYEGKQDKTLQKV---ENQTIKEAKDAIIELENINAKMETRI 580
            EKN+EL+  +R LA +LE  E K+  T       +N+   EAK+AI+ LE +N  +E  +
Sbjct: 552  EKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNL 611

Query: 581  NILLRERDSYKLLAS--TEENKANTNSV---TSMEAAREKKIRELEAELSSTKVENSAII 635
             I+ +ERD++KLL S   E N  ++NSV     +++  E  +++LE  L+    +++A  
Sbjct: 612  QIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHS 671

Query: 636  QNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEK--------- 686
            + L +EL +  K   +    +E + + K LA+E+ ++ + +++ L  E E+         
Sbjct: 672  KALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLE 731

Query: 687  ----------QKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLKKETASFIPTKES 736
                      QK++  SY+    + +S E S     +++LE E++ LK           S
Sbjct: 732  DSLLQQDKETQKTF-SSYVEAISKNSSLETS-----VRNLETEVTLLKDREI-------S 778

Query: 737  LTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQS 796
            L  +     +EK +L++ + + +   +E +      +  +K +I E+    E+L   L  
Sbjct: 779  LKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSE 838

Query: 797  KIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRK 856
            ++ EI+ I   +++Q +W Q  ID+   + + +  +L  K   +E+L  + + L+KEL  
Sbjct: 839  RVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEG 898

Query: 857  TKFQ---YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELK 913
             + +   Y+ ++QN+  +  E  + KELE+ +++L DA SQ++ ++ +  ++E+AL EL 
Sbjct: 899  AQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELN 958

Query: 914  NEL-AKTKENYDA-------KIELEKKEKWAREEDLSRLRGEL--------GEIRALQPK 957
                AK ++  DA       K E+E + +  +++ L  ++ EL         E + L   
Sbjct: 959  ASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQ-LENIKNELTVQSEEAESERKRLTQT 1017

Query: 958  LKE--GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLS 1015
            + E  GA   +++ +K+    E++QK+   +E+ +      +K     Y+  ++ + D+S
Sbjct: 1018 IAELQGAAQPIEEVKKMFE--EKLQKLENDLEEQTVYANNAQK----NYEQELQRHADVS 1071

Query: 1016 ELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYEREL------ISNIE 1069
            + +  L +     + +     + L S QD + ++E+    E+ +Y  ++      I +I 
Sbjct: 1072 KTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDIT 1131

Query: 1070 QTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVK 1129
            +   L      L+ + +    N+ D +     +L  +LR ER+ L+TK+   + E   ++
Sbjct: 1132 KQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQ 1191

Query: 1130 QKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKN 1189
            QK D ++  + + +R+  L E EY   + +I+ ++ I  ++ Q+N+L+E+N  L+  LK 
Sbjct: 1192 QKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQ 1251

Query: 1190 VTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQ 1249
              ++  +I K L   + E+  LQ +L      +     KI     E ++ K R +++ ++
Sbjct: 1252 ALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEK 1311

Query: 1250 QKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTN 1309
             +     D  KL   +++ K  L +      +L ++FNRLKKQAHEKL+ SK+ Q++L  
Sbjct: 1312 HQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQE 1371

Query: 1310 ELNELKAIKDKLEQDLHF---ENAKVI-----------DLDTKLKAHELQSEDVSRDHEK 1355
            +++ L + KD + + L     EN++++           DL+T     E  ++++S+  E 
Sbjct: 1372 QISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLET---LREELNKEISKSEEL 1428

Query: 1356 DT------------YRTLMEEIESLKKELQIFKT--ANSSSDA-------FEKLKVNMEK 1394
            +              R   +EIE L+K +   KT  A +S+DA        E +K   E 
Sbjct: 1429 EVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFEN 1488

Query: 1395 EKDRIIDERTKEFEKKLQETLNK-------STSSEAEYSKDIETLKKEWLKEYEDETLRR 1447
            +K + I E+T+EF K+L E   K       +   + E + D+E L+K+W ++ E+   +R
Sbjct: 1489 QKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKR 1548

Query: 1448 IKEAEENLKKRIRLPSEERIQKII 1471
            I EAE+NLKKRIRLPSEE+I KII
Sbjct: 1549 IAEAEDNLKKRIRLPSEEKINKII 1572

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  353 bits (906), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 377/1364 (27%), Positives = 684/1364 (50%), Gaps = 169/1364 (12%)

Query: 237  LLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSL 296
            L ++N +LS+ +++ + E K L D+   EK EF++EM L++ + +LL  Q+ ++++D   
Sbjct: 251  LRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE- 309

Query: 297  RAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKE---------- 346
            +A +   +    + E   ++++L DTK +LE S+    RL++ + +  +           
Sbjct: 310  KAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNG 369

Query: 347  -EEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISF 405
             E A + + +   T+  ++ D+  L++QL++ER  K +LQ Q+E F++ELEHK P L SF
Sbjct: 370  IEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSF 429

Query: 406  KERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQV 465
            K+R + LE +L   T LLE  +  + ++  +I   + K+   E  +  LV+QR DLARQV
Sbjct: 430  KKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQV 489

Query: 466  KLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEK 525
            + LL++ S   +++ PL+ +E+  ++K+    +    +D+QAII+ RLVEF +V ELQ+K
Sbjct: 490  QCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQK 549

Query: 526  NVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLR 585
            N ELLN IR LA KLE  E K    ++ +E  T+ EAK+AI+ L+     +E ++  +  
Sbjct: 550  NAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTT 609

Query: 586  ERDSYKLLASTEENKANTNSVTSMEAAREKK-----IRELEAELSSTKVENSAIIQNLRK 640
            ERDS+KLL S  +N +  N V +  AA + +     I  LEA L +   E+    + L +
Sbjct: 610  ERDSFKLLVSEGKNNSLPNPVGA--AALQPQEVADGIAHLEARLKAMAEESEQHAKMLNE 667

Query: 641  ELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE----LEKQKSWVPSYIH 696
            E+    KS  +    LE   + + LA EK  +++++++ +K E      +  S     + 
Sbjct: 668  EIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLE 727

Query: 697  VEKERAST--ELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMR 754
             +  R ST  E   ++ ++ S+  +++ L+ E       +  L ++ E   K+  + Q+ 
Sbjct: 728  QDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLL 787

Query: 755  LKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKW 814
            + + + +  E          +Y+ +I+EL+  L   +  L+ K +E + + S   +Q KW
Sbjct: 788  ILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKW 847

Query: 815  AQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRK--TKFQYKFLDQNSDAST 872
             Q+ +D       SL  EL + +  ++  +SE++ L   L    +K +   +D    +  
Sbjct: 848  FQSKLD-------SLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLV 900

Query: 873  LEP-------TLRKELEQIQVQLKDANSQIQAYEEIISSNE-----------------NA 908
            LE        +L K+L++   +L  A S+I+ Y+   ++ E                  A
Sbjct: 901  LESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQA 960

Query: 909  LIELKNELAKTKENYDA-----KIELEKKEKWAREEDLSRLRGELGE-IRAL---QPKLK 959
             I L+ EL  TK N D      +I++ + E   RE   S  R EL E I AL   + +++
Sbjct: 961  AISLEAEL--TKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIE 1018

Query: 960  EGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEM-SQYQSTMKENKDLSELV 1018
            E    + Q+  +L+ ++E+               Q+    E  ++YQ+ +++  ++SE +
Sbjct: 1019 EAKADYQQKITQLQTDLEK---------------QISSTNEAETKYQTALQKQAEISENI 1063

Query: 1019 IRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVEN 1078
              L K +   ++E+ K KS+   A+ +L+++E+ W ++KAD E  L    ++ E L  +N
Sbjct: 1064 ESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQN 1123

Query: 1079 SVLIEKV------------DDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELA 1126
             +L +++             DT  ++  ++      L   LR ER+ LETK+   KRE  
Sbjct: 1124 RLLYDQIELLSRSPSSSLEPDTKISSDARE------LIVTLRRERDILETKIDVSKREEK 1177

Query: 1127 FVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKD-------ITKEVTQVNILKEN 1179
             ++Q+ +  +  +++L R Q LSE     S  ++ E  D       + +++ Q+N+L+E+
Sbjct: 1178 MLRQRLELTKSELDNL-RAQ-LSE-----SKGLVTEGTDSSQNQEELFEKLNQLNLLREH 1230

Query: 1180 NAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQC 1239
            N  L+   + V+E N  +  ++   QE++  ++  +      ++    K+ + + E ++ 
Sbjct: 1231 NMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRW 1290

Query: 1240 KQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDA 1299
            KQR QD+  + +    ++  KL +EI  LK +L      + D + +F +L+KQA+E+LD 
Sbjct: 1291 KQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDE 1350

Query: 1300 SKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYR 1359
             K  +A + +EL    + K +LE  L     K+  L+T+L       +D    HE +  +
Sbjct: 1351 FKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETK 1410

Query: 1360 TLMEEIES----LKKELQI----FK----------------TANSSSDA----------- 1384
            T +++ E+    LK E  I    FK                +A SS  +           
Sbjct: 1411 TKLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQKNSAPSSGHSDPSSYHEQPTA 1470

Query: 1385 -FEKLKVNMEKEKDRIIDERTKEF---------------EKKLQETLNKSTSSEAE-YSK 1427
              E  K  +E+E+  +I+   +E                EK L+E  +  T+   E  S+
Sbjct: 1471 VLEDFKKQVEEERRTLIESHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQ 1530

Query: 1428 DIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
            ++E LKK+W +EYE +TL+RI+EAEE LKKRIRLPSEERI ++I
Sbjct: 1531 NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVI 1574

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  325 bits (832), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 412/1434 (28%), Positives = 721/1434 (50%), Gaps = 206/1434 (14%)

Query: 160  LQRCKSNAISLQLKYDTSVQEKELM---LQSKKLIEE----KLSSFSKKTLTEEVTKSSH 212
            L   KS    L+ KY+  V++ E +     S K  EE    +LS  S K  T + + S+ 
Sbjct: 162  LNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNE 221

Query: 213  VENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKE 272
            + N ++ L+ ++  YE +   NK    +N +L+ +V +++ + K+L++  +  K  F++E
Sbjct: 222  LRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTRE 281

Query: 273  MTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNE 332
            MTL ++ NDLL+  +  L      +   K         E   ++ EL+D K  LEKS+ E
Sbjct: 282  MTLTQHENDLLKEHIEYL------KNTTKETTGGTSTLEKDRLLHELVDIKKSLEKSELE 335

Query: 333  CQRLQNIV-MDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDF 391
               L + +    T+ EE+T     V            +LK QLIKE+ QK  LQ Q+E F
Sbjct: 336  NVHLNDFIEQYLTENEESTSDNELV------------LLKEQLIKEKRQKDYLQEQVELF 383

Query: 392  ILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANI 451
            ++ELE++ P + S K+R ++LE EL + T LLE        + +E+T+  +++     NI
Sbjct: 384  VIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENI 443

Query: 452  HSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITE 511
            + L+ QR+DLA QV+ LLLN    +     L+ DE+  LRKI++S N  N++DSQ II+E
Sbjct: 444  NVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISE 503

Query: 512  RLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIEL-E 570
            RLV+F +++ LQ++N+ELL   R LA++LE+ +    K++QK+   T  E+K+ I +L E
Sbjct: 504  RLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT---KSVQKI---TRNESKEKIAKLQE 557

Query: 571  NINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREK------------KIR 618
            +IN  + +++  L +E+D+YKLL+       NT   T  E  R +            ++ 
Sbjct: 558  SING-LTSKLEKLQKEKDAYKLLSL-----QNTGEQTPTEELRSQLQKKEEQLTKLERMS 611

Query: 619  ELEAELS--STKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEA 676
             L++ L+    KV N +II+ L+KE      +  K+ +        + +A++K +MLE++
Sbjct: 612  SLDSHLAEEKAKVLNQSIIK-LKKEKYDLNNAIIKETSQ-------RAIAEKKSKMLEDS 663

Query: 677  ID--HLKAELEKQKSWVPSYIHVE-----------KERASTELSQSRIKIKSLEYEISKL 723
            ++  H K +L      V  Y H E           K     E +Q++I I  L+ EI   
Sbjct: 664  LELLHKKYDL-----AVKKYEHYETLLNDHNAENIKHSRENETTQAKISI--LQKEIESY 716

Query: 724  KKETASFIPTKESLTRDFEQCCKEKKELQMRLK--ESEISHNENKMDFSSKEGQYKAKIK 781
            K+    +    E+         +EK+ L  RL   ++E+    N M    +E  YK    
Sbjct: 717  KQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLM--QERETYYKEHDS 774

Query: 782  ELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIE 841
              E  L++ +  L+ KI+E++   + K+SQ+ W Q  +D         LT      TT +
Sbjct: 775  ISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDS--------LT------TTND 820

Query: 842  KLSSEIENLDKELRKTKFQY-------KFLDQNSDASTLEPTLRKELEQIQVQLKDANSQ 894
            KL  E   L+KEL K   Q        K L QN++ S+  P + ++ E+++ +LK+   +
Sbjct: 821  KLQVE---LNKELTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQDFEKLKNELKEKQLE 877

Query: 895  IQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRAL 954
            I  Y ++++  E     L+ +L K ++  D    +E KE+   ++ L+ L  E   + +L
Sbjct: 878  INQYRDLLNLAEETKNRLQKDLNKQRQIVDDA--MEGKEQL--DQQLAELTQECSSMNSL 933

Query: 955  QPKLK---EGALHFVQ----QSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQST 1007
              K K   E     +Q    ++E L+N +  ++  I  +E  + +V+  K K   + ++T
Sbjct: 934  LQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLE--NEMVE--KTKSFEEKENT 989

Query: 1008 MKEN-KDLSE---LVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYE-- 1061
             KE    LSE   L+ ++E +    +  L   K+++ + +D +  + +K ++EK ++E  
Sbjct: 990  YKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQ 1049

Query: 1062 ----RELISNIE--------QTESLRVENSVLIEKVDDTAANN-GDKDHLKLVSLFSNLR 1108
                +E I N+         +   +  E S      D+T  N+  DK+ L L      LR
Sbjct: 1050 VDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILA-----LR 1104

Query: 1109 HERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITK 1168
             ER+ L+ KL   +RE+  ++++ ++L+ ++++ +++    E E        ++ K+  K
Sbjct: 1105 RERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVK 1164

Query: 1169 EVTQVNILKENNAILQKSLK------NVTEKNREIYK-QLNDRQEEISRLQRDLIQTKEQ 1221
            ++ ++N LKE N  LQ+ L+      N+     E+ K ++N  ++++ RL+  +++  +Q
Sbjct: 1165 QLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQ 1224

Query: 1222 VSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANAD 1281
            ++     +L  E+E  + + R   + +QQ D ++ +  KL  E+S LK +L +    N D
Sbjct: 1225 LT-----LLSEENERWKLRSREILMKRQQVDLEEHN--KLMEELSTLKTQLDTKTKDNED 1277

Query: 1282 LENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLK- 1340
            L ++FNRLKKQAHEKLDA+K Q A+LT E+ +L   K KLE DL  E  ++ +++++LK 
Sbjct: 1278 LNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQ 1337

Query: 1341 ---------AHELQSEDVSRDHEK-------------DTYRTLMEEIESLKKELQIFKTA 1378
                     A E +  D   + +K             +  + L EE+ SLK +L+  K  
Sbjct: 1338 KPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQ 1397

Query: 1379 NS----------SSDAFEKLKVNMEKEKDRII-----------DERTKEFEKKLQETLNK 1417
            N           +S+    LK + E EK  +I           +E  K+  ++ ++    
Sbjct: 1398 NGVISVADGSAINSETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEEKEKEYYD 1457

Query: 1418 STSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
            S  +      DIE +K EW ++ E+  ++RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1458 SKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  322 bits (824), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 380/1329 (28%), Positives = 695/1329 (52%), Gaps = 123/1329 (9%)

Query: 237  LLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSL 296
            L ++N  L++  E  + E+KNLKD   V K + +KE+ ++  + DLL+ QL+S +++  L
Sbjct: 233  LSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEE--L 290

Query: 297  RAIEKNDDNSCRNPE----HTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMT 352
            R   + +    + P+    +  +  ++ D  L++E+ +NE   L +++   + E+  +  
Sbjct: 291  RQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLNSMINQMSNEQNNSNN 350

Query: 353  TSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSL 412
            +S++   +  L+S I +LK+Q+ +E+ +K  LQ Q+E FI+ELE+K P + SF+E+ ++L
Sbjct: 351  SSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAL 410

Query: 413  EHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNT 472
            E+EL   T LL   S  K   + ++ +   K+   ++NI  L++QRLDLA QVK LLL  
Sbjct: 411  ENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFV 470

Query: 473  SAIQETASPLSQDELISLRKILESSNIVNEND--SQAIITERLVEFSNVNELQEKNVELL 530
            +   ++  PL+++E+  + KI  +S  +N ++  SQ +I+ERLV FSN+ ELQ KN+ELL
Sbjct: 471  AVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELL 530

Query: 531  NCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSY 590
            N IR L++ LEN E       ++ +N+TI +AK+AI+ L+  N  +E+++ +L  ERDS+
Sbjct: 531  NSIRSLSENLENIENANSH--KEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSF 588

Query: 591  KLL----ASTEENKANTN--SVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLI 644
            KLL     S + +  N +  S TS E   EK I +L+  +   K E       L  ++  
Sbjct: 589  KLLLNNNVSIDSSIKNDDLSSSTSPET-NEKSIEKLQTLIEELKAELKKNKDALESQIAS 647

Query: 645  YKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKER 701
            +   +     +LE  ++   L  EK  + E A D LK E   L K+   + + I +++E 
Sbjct: 648  FTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNII-IKQES 706

Query: 702  ASTELSQSRI----KIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKE 757
               ++    I    +I +L+ ++S  K E    + +++SL  +  +  +EK +L++ L +
Sbjct: 707  KLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQ 766

Query: 758  SEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQN 817
             +   NE        + ++ +KI ELENN   L  +L SK+ EI+ +    +SQ  W QN
Sbjct: 767  LQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQN 826

Query: 818  TIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLE--- 874
            TIDD +    ++ TEL++K + I  L+++IE L+        Q   +D N+  S+     
Sbjct: 827  TIDDLKKINSAIKTELTSKNSLISDLNTKIELLES-------QSYTIDTNTRCSSSGNDF 879

Query: 875  PTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEK 934
              + K+L+  ++ L +A +Q++ Y+++ +S E +L  L++     K   D KI     + 
Sbjct: 880  SQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKI----SKL 935

Query: 935  WAREEDLSRLRGELGE-IRALQPKLKEGALHFVQQSEKLRNEVERIQKMI---------- 983
             +  E L    GE  + I  L   LK     + ++  +L  ++ R+ K            
Sbjct: 936  LSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEY 995

Query: 984  -EKIEKMSTIVQLCKK---KEMSQYQSTM-KENKDLSEL------VIRLEKDAADCQAEL 1032
             EKI K+ + ++L  K       +Y+S + K+N +L  +      + +L +     +++L
Sbjct: 996  EEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDL 1055

Query: 1033 TKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD----DT 1088
             K  S       LL ++E  W +++  +  +L  + ++ ++L  +N + +++++    D 
Sbjct: 1056 EKKTS-------LLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDF 1108

Query: 1089 AANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTL 1148
            ++ +  +   +   +F+ LR +R+ LETKL+  +R+      K +SL   + ++Q     
Sbjct: 1109 SSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLIS 1168

Query: 1149 SEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEI 1208
            SE +    + +I+  + I  E+ Q+ + KE+N  L+  +  + EKN+ +  +LN+   ++
Sbjct: 1169 SENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKL 1228

Query: 1209 SRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDL 1268
            S L  +L   KE +      I++ + E  + + R ++LS Q        + KL+ E+  L
Sbjct: 1229 SNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDAL 1288

Query: 1269 KGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFE 1328
            K    +    NA+LE +FN LKKQAHE+L+ASK+ Q++L  ++NELKA    +E  L  E
Sbjct: 1289 KDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSE 1348

Query: 1329 NAKVIDLDTKLKAHE---------LQSEDVSRDHEKDTYRT--------LMEEIESLKKE 1371
              K +DL   L  +E         ++SE  +   E ++++         L +E++SLKK 
Sbjct: 1349 QKKSMDLQNTLSDNEVKYTQKLSNIESELKALKTENNSFKLSSEKEKMELTDEVDSLKKS 1408

Query: 1372 L-----QIFKTANSSSDA------------------------FEKLKVNMEKEKDRIIDE 1402
            L     ++    + S+D+                          +L+   + EKD+++  
Sbjct: 1409 LVEAQSKLSAIGSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLL-- 1466

Query: 1403 RTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLP 1462
              KE+E+K+ E L  + + ++   ++ ++LKKEW +EYE  TL RI+EA+E LKKRIRLP
Sbjct: 1467 --KEYEEKI-EDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLP 1523

Query: 1463 SEERIQKII 1471
            SE +I ++I
Sbjct: 1524 SETKINRVI 1532

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  267 bits (682), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 382/1440 (26%), Positives = 726/1440 (50%), Gaps = 158/1440 (10%)

Query: 154  MEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLS-------SFSKKTLTEE 206
            +++EN  Q  K N +S + + +   QE E + + K  +EE+L        S+ +K++ E 
Sbjct: 177  LQLENENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINEN 236

Query: 207  VTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEK 266
                  +  ++ +L QM+S        N  L  +  +LS  + +    +KN++ + + +K
Sbjct: 237  QDLKLQLNTVKNELDQMKST-------NCVLQERTDELSNKLRDTSTNLKNIQQSRNNDK 289

Query: 267  AEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRL 326
            A   KE+TL++ +  +L+SQL  L+++          D +  + + +D   E+ D K +L
Sbjct: 290  ATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQL 349

Query: 327  EKSKNECQRLQNIVMD--CTKEEEATMTTSAVSP-----TVGKLFSDIKVLKRQLIKERN 379
                N  Q  +N+ ++    K E+ T  +++ S      ++ K + DI VLK++L  E++
Sbjct: 350  ----NHVQE-RNVELEFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQS 404

Query: 380  QKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITS 439
            Q+   +  LE+F+ +LE + P L +++ R  + E ELK +T LLE  +  K     E+  
Sbjct: 405  QRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQ 464

Query: 440  LRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNI 499
             + +I   E  I  + KQR DLA Q++  L++ S   ++A PL+ +E+  +R I++  + 
Sbjct: 465  AQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDE 524

Query: 500  VN--ENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQ 557
            ++  E D+Q +I+ERL +F ++ ELQ+KN+ELL   R LA KLE  +  +     ++E +
Sbjct: 525  MHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEE 584

Query: 558  TIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREKK- 616
            TI EAK+AI+ L+N N+ +  +I  L +E ++YK+L++TE    ++++    +  RE++ 
Sbjct: 585  TIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSNTE----DSSTPADFDKQREQRE 640

Query: 617  ------IRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKE 670
                  ++ELE  ++S   E+      L  ++    +        L   ++ K LA+E+ 
Sbjct: 641  IEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERL 700

Query: 671  RMLEEAIDHLKAELEKQKSWVPSY--IHVEKERASTELSQSRIKIKS----LEYEISKLK 724
            ++L++++D    E E+ +  + S   + VE+++ + E   S IK +S    +E + +  +
Sbjct: 701  KLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQ 760

Query: 725  KETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELE 784
             E      ++E L  +  +  +EK  +++ +   +   +E +   S+ + ++    KEL 
Sbjct: 761  NEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFN---KEL- 816

Query: 785  NNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLS 844
            N+LE   +DL+ K++E E       S ++      DD   K KSL  E+SN    +EK  
Sbjct: 817  NDLEGTCNDLRKKLKEAEE---NYGSLMEETTELKDDFRQKKKSLKEEMSN----VEKRY 869

Query: 845  SEI---------EN--LDKELR-KTKFQYKFLDQNSDASTLE--PTLRKELEQIQVQLKD 890
            SEI         EN  L K+L+ KT+   K+   + D   LE   +L+KEL+ ++ +L +
Sbjct: 870  SEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTE 929

Query: 891  ANSQIQAYEEIISSNENALIELKNELAKTKENYDAKI---ELEKKEKWAREEDLSRLRGE 947
            + SQ ++Y + I     ++ ++  ++   +  +  +I   EL K         L     +
Sbjct: 930  SYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDD 989

Query: 948  LGEIRALQPKLKEG-ALHFVQQSEKLRNEVERIQKMIEKI-----EKMSTIVQLCKK--- 998
            L     +Q KL E   ++F + +    NE+ER+ K +E+      +K+ ++++  ++   
Sbjct: 990  LNNELEVQKKLYEDEKINFTRNA----NELERVTKGLEQSKRDYEDKLKSLMKDLEEQVK 1045

Query: 999  ---KEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWME 1055
               K  + Y+  ++ + ++S+ + +L +     + E+ +   S   A+ LL++++  W +
Sbjct: 1046 YANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQK 1105

Query: 1056 EKADYERELISNIEQTESLRVENSVLIEKVD-DTAANNGDKDHLKLVS-------LFSNL 1107
            ++ +YE+++    ++ E    +N +L E+    T AN+ D      V+       L  +L
Sbjct: 1106 QRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSL 1165

Query: 1108 RHERNSLETKLTTCKRELAFVKQKNDSLEKTI--NDLQRTQTLSEKEYQCSAVIIDEFKD 1165
            R ER+ L+ +L   + E   ++++  S+EK     DL+  Q + E+ +     ++++ K 
Sbjct: 1166 RSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLE-LQKIKEETHNYPD-LLEQHKT 1223

Query: 1166 ITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSIN 1225
            +  ++TQ+++L+E+N  L+     +  KN+ +  ++ +  +++  L+ +L      +   
Sbjct: 1224 VMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEK 1283

Query: 1226 SNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENK 1285
              ++ +   E E+ KQR QD+  + +     + E L  E + L+ +L      N +L N+
Sbjct: 1284 DKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNR 1343

Query: 1286 FNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQ 1345
            F +LKKQAHEKL+ASK  Q +LT ++N+L+A K +L   L  E    + L+ +L+     
Sbjct: 1344 FEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKN 1403

Query: 1346 SEDV-------------SRDHE-----------------KDTYRTLMEEIESLKKELQIF 1375
            S D+             S+D E                     + L EE   L++EL   
Sbjct: 1404 SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIKKLQEESSKLQEELAHE 1463

Query: 1376 KTANS----------------SSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKST 1419
            K   S                S+D  E +K + E+EK + I+E+T EF+KKLQ  +NK  
Sbjct: 1464 KLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIEEQTTEFKKKLQAEINK-- 1521

Query: 1420 SSEAEY-SKDIE-------TLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
              +AEY +K IE        ++K+  +EYE  T +RIKEAEENLK+RIRLP+EE+I K+I
Sbjct: 1522 -LKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVI 1580

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  223 bits (569), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 357/1339 (26%), Positives = 627/1339 (46%), Gaps = 213/1339 (15%)

Query: 219  KLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKN 278
            KL Q  S  +++   N  LL+  +++++ + +K    K L D  S ++ +F +E+  +  
Sbjct: 161  KLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDK 220

Query: 279  MNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQN 338
            +N +L+ Q+ SL  +           N    P H +  D+          +K   Q  + 
Sbjct: 221  LNAVLKKQVNSLHSELG---------NGGETPAHAEPNDQF---------AKQSSQHEEE 262

Query: 339  IVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHK 398
            I     + EE        +P++  L       ++ L+KER +   L+ Q+E F++ELEH+
Sbjct: 263  ISNYKEQVEELLGILGQGAPSIAHL-------RKLLLKERKENVSLKKQMESFVIELEHR 315

Query: 399  TPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQR 458
             P L   +++ K ++ +L  +T  +   S  K + +RE++S RQK++      H L  QR
Sbjct: 316  LPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQR 375

Query: 459  LDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSN 518
             DLA Q++ LL   S+  +T  P S  EL  ++ I+E+ N     DSQ I+++RL+ F N
Sbjct: 376  SDLAHQIQFLLTVNSS--DTVLPPS--ELSFIKTIIENENWDAYKDSQRIVSDRLLRFDN 431

Query: 519  VNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMET 578
            + ELQE+N++L++ +R L DK+E++E   D  L      T++ AK  I +LE  NA++E+
Sbjct: 432  IPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQLES 485

Query: 579  RINILLRERDSYKLLASTEENKANTNS---VTSMEAAREKKIRELEAELSS--------- 626
             +        +++ L  T ++  + +S   VT +E  ++KKI ELE++L+          
Sbjct: 486  EVK-------NWEALMETLKDGDSLDSKINVTMVE--QQKKIEELESKLTDVGESHVQKI 536

Query: 627  -----TKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERM-LEEAIDHL 680
                 T   N + I  L +++    KS    K+ L        +A ++E + L + I   
Sbjct: 537  NVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSEL--------IACKRENLSLTQQISTK 588

Query: 681  KAELEKQKSWVPSYIHVEKERAS----TELSQSRIKIKSLEYEISKLKKETASFIPTKES 736
            + EL++  S        +KER       ELS +  K KS E     L +E       + S
Sbjct: 589  QNELDELNSK-----SAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRS 643

Query: 737  LTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQS 796
            L    +Q  K+  +L+ R KE E+  +  ++     E    +KI  L    + L +DL  
Sbjct: 644  LFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAF 703

Query: 797  KIQEIESIRSCKDSQLKWAQNTIDDTEMKMKS-------------LLTE--LSNKETTIE 841
            K +E++      + Q+KW Q  ID+   + K+             LL+E  LSNK   + 
Sbjct: 704  KEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPV- 762

Query: 842  KLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKE---LEQIQVQLKDANSQIQAY 898
               +E++ L  EL   K   +  +  S A+  + TL +         +  ++  S++Q+ 
Sbjct: 763  --GTELKELQNELNGMKAALEVSE--SQATLYKDTLERNQNFYNNSTLSFQNTISELQSK 818

Query: 899  EEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKL 958
             E +S        L+N++ +T EN    I+LE       +  + RL     E  AL+ KL
Sbjct: 819  NEALSKQHET---LQNQITET-ENQSKGIQLE------HQTIIDRL---TSEKTALEEKL 865

Query: 959  KEGALHFVQQSEKLRNEVE-RIQKMIEKIEKMSTIVQL-------CKKKEMSQYQSTMKE 1010
               + H  ++  +++ E + +IQK IE   K+ +  +L        K+KE++ Y   +++
Sbjct: 866  NSLS-HSEEKIAEMKGEYDAQIQK-IESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQ 923

Query: 1011 NKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQ 1070
               L+  + +L  D A    E  + + +L   +D L +              EL    ++
Sbjct: 924  ---LNTEIAKLNSDIA-ALTEPAEARKTLIKERDSLGQ--------------ELKLANQR 965

Query: 1071 TESLRVENSVL------IEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRE 1124
             ESL  +NS+L      +  VD  A  N D     L +L  NLR ER+  +++ TT +R+
Sbjct: 966  IESLAAQNSILYDTFSGMRHVDADAEPNED-----LRNLVINLRIERDMHQSQETTAQRD 1020

Query: 1125 LAFVKQK----NDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENN 1180
            +  +K+      + L  T  ++       + ++  +       + I +E+  +   KE N
Sbjct: 1021 VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVT----HEKIMRELEGLTNTKEEN 1076

Query: 1181 AILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCK 1240
              L +S+K++ E  R +       QEE+SRL+    +++E    NS+ I   E E +Q  
Sbjct: 1077 LYLDESIKSLNEDKRTL-------QEEVSRLR----ESEELAKKNSSAI--SEQEWQQKI 1123

Query: 1241 QRYQD-------LSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQA 1293
            + YQ        + QQ  +    +I+ L  ++   K  +      N DL ++F RLKKQA
Sbjct: 1124 ETYQQESEKWKLMCQQMSENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQA 1183

Query: 1294 HEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVID--------LDTKLKAHELQ 1345
            HEKL+ASK    +L  EL+ELK + D L++ L+ +    +D        L  K +  + +
Sbjct: 1184 HEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAK 1243

Query: 1346 SEDVSRDHEKDTYRTLMEEIESLKKELQIFK--------TANSSSDAFEKLKVNMEKEKD 1397
            S ++   H  D+   L   I  + KEL   K             +   E+LK   E EK 
Sbjct: 1244 SLELELRHSVDSSEKL---IADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKR 1300

Query: 1398 RIIDERTKE----FEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEE 1453
             +I++ T E    FE++ +E +N +         ++E L+K   +E+E +TL+RI+EA+E
Sbjct: 1301 VLIEKTTSELTERFEREKKELMNNNA--------NLEELRKPLEEEWERKTLQRIEEAKE 1352

Query: 1454 NLKKRIRLPSEERIQKIIS 1472
            NLKK IRLP+EE+I+++I+
Sbjct: 1353 NLKKHIRLPTEEKIERVIA 1371

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  186 bits (472), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 142/452 (31%), Positives = 263/452 (58%), Gaps = 30/452 (6%)

Query: 160 LQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVT------KSSHV 213
           L+R KS  +  Q + + S+++ EL+ +  + +EE L   +++ +T++ +      K   +
Sbjct: 110 LERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILKMEEKDQEI 169

Query: 214 ENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEM 273
           +NL  ++  ++ N       N  LL +N++LS++V+EK++E+K   D  S ++ EF  E+
Sbjct: 170 DNLRHEVSILKKN-------NDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEI 222

Query: 274 TLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNEC 333
            L+  +N  L +QL  ++++ S++    N+DN+ R  E   ++++LIDT+ +L+ S+NEC
Sbjct: 223 GLKDRINSSLETQLKEIQQEKSIQ----NEDNTSR-AESQKIMEQLIDTRKQLKDSRNEC 277

Query: 334 QRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFIL 393
            RL++ V +             ++   G+  S   +LK++L+K + QK  L+ Q+E+FI 
Sbjct: 278 TRLKSYVNEF------------INDVNGEYSSSSSLLKKELLKVKEQKDYLETQVENFIT 325

Query: 394 ELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHS 453
           ELE K P + S +++ K LE EL   T L++ +S+ +   E+E  S ++K    +  I +
Sbjct: 326 ELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQT 385

Query: 454 LVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERL 513
           L  QR DLA Q++ LLL       T + LS+DE   +R++ E+      NDSQ+II+ERL
Sbjct: 386 LTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISERL 445

Query: 514 VEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENIN 573
           ++F+++ ELQ++N+++L  +R LA +LE  E  +      +E +T++EAK A+++L+   
Sbjct: 446 LKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYT 505

Query: 574 AKMETRINILLRERDSYKLLASTEENKANTNS 605
             +E ++    +ERD YKLL+  +   +N  S
Sbjct: 506 NSLERKLETFRKERDVYKLLSKGKSPSSNKPS 537

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  177 bits (450), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 209/742 (28%), Positives = 366/742 (49%), Gaps = 54/742 (7%)

Query: 234 NKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKD 293
           N  L  +N++LS+ +  K+ E+K+L+++      +F  E  LQ  + + L++Q+ +L++ 
Sbjct: 190 NAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQ 249

Query: 294 CSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNE-------CQRLQNIVMDCTKE 346
               + EK DD   +  +  +++ ++ +   +LE S+ E        +  QNI     + 
Sbjct: 250 LESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNI--PEEES 307

Query: 347 EEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFK 406
              +   S  + +   L  D+ +L++  +KER QK QL+ Q+   + ELE   P L S+K
Sbjct: 308 SSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYK 367

Query: 407 ERTKSLEHELKRSTELLETV-------SLTKRKQEREITSLRQKINGCEANIHSLVKQRL 459
           ER+  LE EL  S  LLE +       S    K+E E ++LR  IN       SL  QR 
Sbjct: 368 ERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSIN-------SLAFQRT 420

Query: 460 DLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNV 519
            LARQVK LLL     +   S L + +L  L + L ++     +DS+ I+ ERL +F NV
Sbjct: 421 VLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNV 480

Query: 520 NELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETR 579
            ELQ +N++LL   R LA K E  E    K +   E++TI +AK+AI+ L+  + K+E++
Sbjct: 481 KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540

Query: 580 INILLRERDSYKLLASTEENKANTNSVTSM---EAAREKKIRELEAELSSTKVENSAIIQ 636
           I  L  E      LA  ++ K    S+++M   E        +L  +LS+    +  II 
Sbjct: 541 IKELSDE------LAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIID 594

Query: 637 NLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIH 696
            L  E+    ++      +L+  ++ + LA+++  +LE  +  LK+E E+ +  V     
Sbjct: 595 ALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQ 654

Query: 697 --VEKERASTELSQSRI----KIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKE 750
             ++KE+  +  S+  I    K+ + E EI+ L+ E    I T+ +L    E    E+  
Sbjct: 655 NILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNN 714

Query: 751 LQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDS 810
           L+M + +    +NE +      +  Y  K+K       +  + LQ   Q +  ++S  DS
Sbjct: 715 LRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDS 774

Query: 811 QLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDA 870
           ++KW + TIDD +  +  L  EL  KE  IE+ S  +EN+  EL         L  + D 
Sbjct: 775 EIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNELT--------LANSKDV 826

Query: 871 STLEPTLRKELEQIQVQLKDANSQIQAYEEIISSN----ENALIELKNELAKTKENYDAK 926
           S  +  L KEL +++ QL+ +N +++ YE +IS++    EN  I+ ++ +       D++
Sbjct: 827 SEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSE 886

Query: 927 IELEKKEKWAREEDLSRLRGEL 948
           +    +E+   +E+LS L+  +
Sbjct: 887 L----RERTTLQENLSTLQARM 904

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 1395 EKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEEN 1454
            E D ++ E    FEK+ + +L      E E   D E   +E+   YE+E  +++ +AEEN
Sbjct: 1183 EHDSLVQEMKDNFEKE-KSSLLSQQEQEIEKLTDNERKLREF---YEEEIQKKVSQAEEN 1238

Query: 1455 LKKRIRLPSEERIQKII 1471
            LKKRIRLP+EE+I  II
Sbjct: 1239 LKKRIRLPTEEKINGII 1255

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  172 bits (436), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 337/1370 (24%), Positives = 626/1370 (45%), Gaps = 255/1370 (18%)

Query: 237  LLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSL 296
            L++Q ++LSQ + ++  +++ L D   + + E++ E+ LQK+   LL+ Q+ SLEK+  L
Sbjct: 183  LISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEAKL 242

Query: 297  RAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDC--TKEEEATMTTS 354
               E   +     P     +                 QR  +I MD   T  +E      
Sbjct: 243  VGHETEPEYEIPPPGEEVALQ----------------QRSHSISMDSLLTGNDE------ 280

Query: 355  AVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEH 414
              S ++ +L ++I +L  +L +E   K +L+ Q+  F+ ELE   P + SFK++++  + 
Sbjct: 281  -TSHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDA 339

Query: 415  ELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSA 474
            ++ +    LE V+  K    +E+   ++++         L ++R DLARQ++ LLLN   
Sbjct: 340  QIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLN-GF 398

Query: 475  IQETASPLSQDELISLRKIL----ESSNIVNENDSQAIITERLVEFSNVNELQEKNVELL 530
            ++++  PL+  E   +++IL    E  N  +  DSQ II++R+++F ++ ELQ++N+ LL
Sbjct: 399  VKDSDDPLTSSEFSYIKEILNTDPEEGN-TSSTDSQLIISKRMLKFKSIVELQQQNINLL 457

Query: 531  NCIRILADKLENYEGKQDKTLQKVEN-QTIKEAKDAIIELENINAKMETRINIL---LRE 586
            + +R L+D+ E  E K    L+  ++ + I EAK  +++L+  N+ +E ++  L   L+ 
Sbjct: 458  SAVRTLSDRAETLERK----LESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKA 513

Query: 587  RDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYK 646
             + +  +   E   ++ +   +++A + K          S   E+S  I +L  ++   +
Sbjct: 514  NEHFTSIGDGEFGNSDLSDGNNIQALKNK--------YDSLMAESSETIGHLYSQINNLQ 565

Query: 647  KSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTEL 706
            +S+       E   N K L +++ ++ ++ +D  K E    ++ + +     KER     
Sbjct: 566  QSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKER----- 620

Query: 707  SQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENK 766
                      E E S+  K+    +   + + R  E    EK  LQ     +  S  ENK
Sbjct: 621  ----------EVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQ-----NAQSSIENK 665

Query: 767  MDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLK----WAQNTIDDT 822
            ++ + KE                 R++ Q  I ++ +++  +D QLK      QN IDD 
Sbjct: 666  LNQALKE-----------------RNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDL 708

Query: 823  EMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSD---------ASTL 873
            E++   L  ++  KET+    SS + N   EL   + ++  L  ++D         AST+
Sbjct: 709  ELENTELRNKIDTKETSP---SSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTI 765

Query: 874  EPTLRKELEQIQVQLKDANSQ---IQAYEEI-------------ISSNENALIELKNEL- 916
            E TL  + + + + L++ANS+   ++A E +             ++++   L +   EL 
Sbjct: 766  E-TLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELE 824

Query: 917  --AKTKENYDAKI--------ELEKKEKWAREEDLSRLRGEL----GEI----RALQPKL 958
              + T   Y ++I        ELE + K  R+E ++ LR EL    GE      AL  KL
Sbjct: 825  ISSNTIRQYQSEIKVLNERQSELENENKHLRDE-IAILRDELTHNGGEFEREKEALMKKL 883

Query: 959  KEGALH---FVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKEN-KDL 1014
                +      +  E    E+E+++  ++K   +   ++L   +E+ + Q+   E  ++ 
Sbjct: 884  SNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNE 943

Query: 1015 SELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESL 1074
             ELV            E+ +TK  +   ++L  +   K + E+ + ++E +      ESL
Sbjct: 944  LELV------------EIRQTKVFVEKEKEL--ESRIKILNEQIELDKERMKQFSDEESL 989

Query: 1075 RVENSVLI--EKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKN 1132
              E   L+  EK  D        ++  LV   S+   E+ +LE+KL   + E   ++++ 
Sbjct: 990  LREQVKLLADEKASDLVDAGVSPEYTDLVRKLSD---EKKNLESKLFASQSEKNRLREQL 1046

Query: 1133 DSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTE 1192
               E  I  L      ++KE   +A + +E     + + Q+  LKE+N  L   +K    
Sbjct: 1047 TKTESEIAVLNMNYEQAKKE--VAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQM 1104

Query: 1193 KNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQ-QK 1251
            +N EI  +LN+ + +   ++  L + +  +S    K++  ++E  + K    D+ Q   K
Sbjct: 1105 RNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNK 1164

Query: 1252 DAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASK---------- 1301
            D+  + +  L + ++ L  ++ + ++AN +LE++F RLK+QA E+LDASK          
Sbjct: 1165 DSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNV 1224

Query: 1302 ----KQQAALT-------NELNELKAIKDKLEQDLHFENAKVI-DLDTKLKAHELQSEDV 1349
                K + AL        +ELNEL+A   K+++  H E + V+ +L T+L A   +++D+
Sbjct: 1225 ETLTKDKTALQDVIERSKDELNELRA---KIQE--HIETSAVMKELKTELAAVMSKNKDI 1279

Query: 1350 SRDHEKDTYRT------LMEEIESLKKELQIFKTANSSSD---------------AFE-- 1386
              +  + +  +      L EEIESLK E+Q  K A+S+                 AFE  
Sbjct: 1280 EAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDE 1339

Query: 1387 ---------------------KLKVNM---EKEKDRIIDERTKEFEKKLQETLNKSTSSE 1422
                                 KLK  M   EKEKD ++ E+T+  E+     L K+ S  
Sbjct: 1340 KIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENT--ALMKARSD- 1396

Query: 1423 AEYSKDIETLKKEW-----------LKEYEDETLR-RIKEAEENLKKRIR 1460
                 DIETL+K+W            KE  D+ +R ++ E EE  + R+R
Sbjct: 1397 ---VPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVR 1443

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  117 bits (293), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 136/417 (32%), Positives = 218/417 (52%), Gaps = 43/417 (10%)

Query: 1081 LIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIN 1140
            ++E  D    N     HL       +L HE+  L   L +    L   + +N +  +   
Sbjct: 990  ILESYDGKILNTAAIGHL-----VRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFP 1044

Query: 1141 DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQ 1200
               +    S+KE        ++ +++ +  T++  L+E+NA L K ++N T+ N  +  Q
Sbjct: 1045 SFVKIDQQSKKE--------EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQ 1096

Query: 1201 LNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQK----DAQKK 1256
            L D Q ++  L++++ + K +V+     + + + E+E+ K R Q + QQ K    +A  K
Sbjct: 1097 LADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMK 1156

Query: 1257 DIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKA 1316
             +EK    I  L+ +L +    NA L ++F+RLKKQAHEKLDA+K  Q  LT ++NEL  
Sbjct: 1157 SLEK----IKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNE 1212

Query: 1317 IKDKLEQDLHFE--------NAKVIDLD--TKLKAHELQSEDVSRDHEK--DTYRTLMEE 1364
             K  LE+ L  E        N    + +   +L+A   +S + S + EK  +  +    E
Sbjct: 1213 TKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNE 1272

Query: 1365 IESLKKELQIFKTANSS---SDAFEKLKVNMEKEKDRIIDERTKEFEKKLQ---ETL--- 1415
            IESLK ELQ  K   +S   S   + LK + ++EKD +I++  KEF+ KL+   ET+   
Sbjct: 1273 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332

Query: 1416 -NKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471
               +  +  + S +IE LKK+W +E E   L+RI EAEENLKKR+RLPSEE+I  +I
Sbjct: 1333 RKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVI 1389

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  107 bits (268), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 158/583 (27%), Positives = 280/583 (48%), Gaps = 77/583 (13%)

Query: 1070 QTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVK 1129
            + ++L  +N +L+EK++ +A       +L++  +F +LR+ER++L  ++   ++++  + 
Sbjct: 734  RVQNLATQNRLLLEKLERSA-------NLEVDDIFVSLRYERDTLSDQVVNYEKDMQVIL 786

Query: 1130 QKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFK-------DITKEVTQVNILKENNAI 1182
               +S++  +N    +Q L+   ++    ++ + K        + +++T+++ LKE N  
Sbjct: 787  ADLESVQSELN-AANSQILN---FENQRAMVQDHKKGNVNEETLIEKLTELDELKERNME 842

Query: 1183 LQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQR 1242
            L + +  + E N  +  QL +  E +  L+  + +    +    N I V   + E  K R
Sbjct: 843  LTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTR 902

Query: 1243 YQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKK 1302
            + +L+     A+  D E L N    L+ ++      N +L ++FNRLKKQA+E+L ASK 
Sbjct: 903  FNELTLS---AKNNDNEDLIN----LQKQVEEKSKENEELSDRFNRLKKQANERLHASKV 955

Query: 1303 QQAALTNELNELKAIKDKLEQDL--HFENAKVIDLDTKLKAHELQS-----------EDV 1349
             Q  LT + NELKA    LE++L    E  K ++    LK  EL S            D 
Sbjct: 956  AQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDK 1015

Query: 1350 SRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEK 1409
            S+  E++  +T+ E  ESL  +L+     N      EKLK    KE    + E   E  K
Sbjct: 1016 SKKFEEELIKTVSES-ESLVSDLK-----NEIESLNEKLK---SKESSVGLQESEIENAK 1066

Query: 1410 K-----LQETLNKSTSS-EAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPS 1463
            K     L+E LNK+ S  + ++ ++++ LK E    YE +  +R+ EAEE LK++IRLPS
Sbjct: 1067 KILIAELEEKLNKTKSELDLKHKEELKVLKTE----YEGDIQKRVAEAEEALKRKIRLPS 1122

Query: 1464 EERIQKIISXXXXXXXXXXXXXXXXNAGSLTFLDNKGSGEDAEEELWNSPSKG---NSER 1520
            EE+I  II                  +   T  D +   ++ E+ L N+  K      ++
Sbjct: 1123 EEKINTIIESKVADLEEDYKKKLETVSAEST--DIEKIKQEFEDNLVNAKKKAFEEGKQQ 1180

Query: 1521 PSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKENNIVDSSAAGNKAIPTFSFGK 1580
             S    F+  K  K + QL+N ++DV+  D ++ V   +N   +      +A P+F+F  
Sbjct: 1181 ASMKTKFLENKIAKLESQLQNNESDVT--DKEAEVKTTDNEKSNPELDKQEAKPSFTFSP 1238

Query: 1581 PFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVAVKA 1623
            P  S          NPFT +Q   +T++P+    I+P  ++ A
Sbjct: 1239 PPNS----------NPFTTTQ---DTDSPVSVFGIKPTFSLGA 1268

 Score =  105 bits (263), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 158/644 (24%), Positives = 314/644 (48%), Gaps = 87/644 (13%)

Query: 207 VTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEK 266
           + ++  +ENL+ KL+++++  +++ + N  L ++N  L+ ++  K++E+KNL D  +   
Sbjct: 83  IDQNKTIENLKLKLFKLENENKTLNSTNLNLTDKNDTLNNNLNLKLIELKNLNDNIT--- 139

Query: 267 AEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRL 326
                E+ L++N +  L+ +L                            ++  I+  L+L
Sbjct: 140 -----ELELKRNNDIQLKDKLIQ-------------------------QLNSKIENLLKL 169

Query: 327 EKS---KNECQRLQNIVMDC-TKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKF 382
            KS   KNE +    I+ D  T  ++   + + + P+  K  S              Q  
Sbjct: 170 GKSPKFKNEVE----IINDSKTINDDIENSKATIPPSPAKALSK-------------QNN 212

Query: 383 QLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQ 442
            L++ +++++ ELE + P + +FK   ++L+  L +   ++E++   K++  + + S+++
Sbjct: 213 GLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKK 272

Query: 443 KINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNE 502
            IN   ++I +L  QR DLA Q++ LL+++S   +   PLS+ E++ ++ ++        
Sbjct: 273 TINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS 332

Query: 503 NDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEA 562
           +D Q++I++RL++F ++  LQEKN+EL   IR LA  LE+ E +   + +  +N TI EA
Sbjct: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392

Query: 563 KDAIIELENINAKMETRINIL---LRERDSYKLLASTEENKANTNSVTSMEAAREKKIRE 619
           K+ I+ L+  N  ++  I  L   + E  S  +  S E  K + N  +++       +++
Sbjct: 393 KETILSLQEYNNVLKLEIGTLQSKISELQS-SIPNSKESEKQHFNYHSNL-------VKD 444

Query: 620 LEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDH 679
           LE++LS     + + I+NL K++      +      LE  ++   LA EK  +L+ + D 
Sbjct: 445 LESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDL 504

Query: 680 L---KAELEKQKSWVPSYIHVEKERASTELSQSRIKIKS--LEY--EISKLKKETASFIP 732
           L     EL  + S +   ++ E+E+    +    IK K+  L++   ++ L         
Sbjct: 505 LTLENEELSSKNSMLEQQLN-EEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLEE 563

Query: 733 TKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRS 792
              SL ++ +   ++ K+L  + K  E S  EN++       +Y  K+KELE N+ +L  
Sbjct: 564 ENNSLKQEIKSNYEQIKDLDSKSKHLEQSL-ENEI------SKYTDKVKELELNISKLNE 616

Query: 793 D-------LQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSL 829
                   LQ+K  EI+ + S    Q+ W Q  +D  E  +K+L
Sbjct: 617 QKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTL 660

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 147/267 (55%), Gaps = 20/267 (7%)

Query: 364 FSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELL 423
            ++I  +K +LIKE+ +K  L+ +  DF+ ++E K P L     +  S+E+E     ++ 
Sbjct: 280 INNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKIE 334

Query: 424 ETVSLTKRKQER-EITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASP- 481
           E   + +    + E  SL+ K+N  E+ + +L++QR DL  Q+  LL+  S + E  +  
Sbjct: 335 EQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 482 LSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLE 541
           L+++EL  +R ++         ++Q II+ERL++FSNV++L  KN++L++ +R L +K+E
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454

Query: 542 NYEGKQDKTLQKVEN--QTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEEN 599
           + E +  +    +E   ++I EAK  +I L+  N K +  IN ++ E+   KLL   E+ 
Sbjct: 455 SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEK---KLL---EDK 508

Query: 600 KANTNSVT-----SMEAAREKKIRELE 621
               NS       SME  RE  ++ LE
Sbjct: 509 IHGLNSTVTELNKSMEIKREPTLKNLE 535

 Score = 40.8 bits (94), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 102/418 (24%), Positives = 177/418 (42%), Gaps = 54/418 (12%)

Query: 1263 NEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKL- 1321
            NEI +LK ++ +      +  ++F RLKKQA +KL+  K  +  L  +  +L+  K++L 
Sbjct: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELE 810

Query: 1322 ---------EQDLHFENAKVID----LDTKLKAHELQSEDVSRDHEKDT--YRTLMEEIE 1366
                     E+ L  E  K+ D     + +L  ++   E++  ++EK    Y+   EE+E
Sbjct: 811  QRLLLLESSEKSLQEEIVKMKDELMTSNNELDNNQRSQEELRNEYEKQNKLYKIKEEELE 870

Query: 1367 SLKKELQIFKTANSSSD-----------AFEKLKVNMEKEKDRIIDERTKEFEKKLQETL 1415
            S   +L + +  NS+ D             E +K ++E E D I+  + KE EK   + +
Sbjct: 871  SALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDIILKAKLKEIEKNSAKDV 930

Query: 1416 NKSTSSEAEYSKD-IETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISXX 1474
            N   +   E S D I T+K+ W KEY+     RI++AE     R R   E+  ++ +S  
Sbjct: 931  N---TDSIELSDDNISTMKEAWEKEYQHILKIRIEDAENQAMARTRKELEKEYEERLSKE 987

Query: 1475 XXXXXXXXXXXXXXNAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAG------FI 1528
                          +        +K    + E +L N   +   E   A+         +
Sbjct: 988  SEKLSDQYNNKLKDDLSEELLKIDKKYAMELETKLKNETDESKKEFQDALGTEQTKNKIL 1047

Query: 1529 NQKNLKPQEQLKNVKNDVSFNDSQSMVTNKENNIVDSSAAGNKAIPT-FSFGKPFFSSNT 1587
            ++K    + Q+K +K++ + + S  M +       D        + T F+FG+  F SN 
Sbjct: 1048 SKKIEFLETQIKELKDEQTKHHSNPMKS-------DEKIPSTTNLSTNFAFGQNPFVSNA 1100

Query: 1588 SSLQSFQNPFTASQSNINTNAPLRTL------NIQPEVAVKAAINFSNVTDLTNNSTD 1639
            S      N F  S S  + NAP +        N    + V+  + F+  TD +N S D
Sbjct: 1101 SQNAYMSNVF-LSGSPFSRNAPEKAFKHSTPDNTNSSITVQPTLTFN--TDFSNESKD 1155

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 73.6 bits (179), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 117/519 (22%), Positives = 250/519 (48%), Gaps = 32/519 (6%)

Query: 330 KNECQRLQN-IVMDCTKEEEATMTTSAVSPTVGKL-------------FSDIKVLKRQLI 375
           K E QRL N  +++  K +E  +  + ++ TV +              F D  +LK+++ 
Sbjct: 247 KQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFIILKKEIQ 306

Query: 376 KERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQER 435
           K   Q+  LQ +LE  I ELE+  PEL +  ++   LE  L +     E    T ++ E 
Sbjct: 307 KLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTSEHFKTTIKEIEN 366

Query: 436 EITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILE 495
           E  ++  ++   +  I +L ++  DL  Q++ +L++ S   +    L+++E+  ++ + E
Sbjct: 367 EKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALRE 426

Query: 496 SSNIVNEN---DSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQ 552
                + N   +SQ II++RL+ F +V  LQ+KN+EL+  +R++  KL+N E +     +
Sbjct: 427 KGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWE 486

Query: 553 KVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAA 612
              +  + EAK+ I+++ + + K++ +I+ L ++ ++ + ++     K    SV +    
Sbjct: 487 AENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVS---HEKNGHESVLAENKL 543

Query: 613 REKKIRELEAELSS-----TKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAK 667
             +  R +  EL +     TK  ++ I  N  +   +Y K+       L+ +++ + + +
Sbjct: 544 YTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQS-RDITQ 602

Query: 668 EKERMLEEAIDHLKAELEKQKSW---VPSYIHVEKERASTELSQ---SRIKIKSLEYEIS 721
           +K  +L++  D+L    EK K     +   I  + E  ++ ++     +  + S+  +++
Sbjct: 603 KKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMN 662

Query: 722 KLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIK 781
            L  +       K+  +R   +   E+++L+M L   +    ++ ++ +  +    +KI 
Sbjct: 663 SLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKIN 722

Query: 782 ELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTID 820
           +LE     L  DL++K QE++   S K+ +L W Q   D
Sbjct: 723 DLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 96/403 (23%), Positives = 172/403 (42%), Gaps = 85/403 (21%)

Query: 1194 NREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDA 1253
            NR++ ++LND ++ I ++  ++ +  + +       L   SE+   + R ++L  + K+A
Sbjct: 908  NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967

Query: 1254 QKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNE 1313
              +         SD K K       N +  ++FNRLKKQA+ +L +SK++Q AL  +++ 
Sbjct: 968  SLQ---------SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISS 1018

Query: 1314 LKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQ 1373
            LK    +++  L  ++  V +L+T++K+                      E +S  +   
Sbjct: 1019 LKKDLAEVQSKLEVQSKTVQELETQIKS---------------------TEADSRSRSTS 1057

Query: 1374 IFKTANSSSDAFE-KLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETL 1432
            I K+ N S D  + KL   +  E   +I + T+E + K+               KD++TL
Sbjct: 1058 IPKSQNQSLDKQDTKL---ITDEDSNVIPQSTQEEDIKI---------------KDVKTL 1099

Query: 1433 KKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISXXXXXXXXXXXXXXXXNAGS 1492
              E            +  +  NLK       EE+I  +IS                   S
Sbjct: 1100 DSE------------VSGSGVNLKNN---APEEKIIPVISNEHICTMESHTINNNPVKES 1144

Query: 1493 LTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNL-KPQEQLKNVKNDVSFND- 1550
            +  L N+ S           PSK  S+  +    F+  +NL +P     +V +  +F+  
Sbjct: 1145 VDMLSNEES-----------PSKMESDTTTTKPSFLPNQNLTQP-----SVTSSFTFSPL 1188

Query: 1551 -SQSMVTNKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQS 1592
              ++  T+  N    +S+ G K  P FSFG   F+SNT+SL +
Sbjct: 1189 AMENPFTSPNNAKTPTSSFGMK--PAFSFGSNPFTSNTNSLGT 1229

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 110/231 (47%), Gaps = 15/231 (6%)

Query: 236 FLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCS 295
           FL++ N++LS  + E  +E  +  ++  ++     K + L +   +LL  + + + KD  
Sbjct: 83  FLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLNERYSIIIKDQ- 141

Query: 296 LRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTK-EEEATMTTS 354
            + +  ND N+ +  E   + +++I     ++  +++ ++L  I+ +     E     T+
Sbjct: 142 -KDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEKLNAIIHNFIDINEFDNENTN 200

Query: 355 AVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSL-- 412
             S  +     D KVLK+ L+ E+N   +LQ +L   +LEL  K P L S KE+   L  
Sbjct: 201 KYSLDLN----DNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQS 256

Query: 413 --EHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDL 461
             E+ +  + ELL+       K    I S+  KI   E ++  L+ QR +L
Sbjct: 257 VFENIISSNEELLQQFHSNTDK----IASMNNKIVDYEQSLKQLLSQRTNL 303

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 101/205 (49%), Gaps = 48/205 (23%)

Query: 1285 KFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD----------KLEQDLHFENAKVID 1334
            KF+RLK+QA+E+L+ASK  Q  L+   + +K+++D          KLE D++  N  +++
Sbjct: 670  KFSRLKRQANERLNASKTTQKELS---DNVKSLEDERTNFKEHISKLEVDINNLNNALVE 726

Query: 1335 LDTKLKAHELQSE----------------DVSRDHEKDTYRTLMEEIESLKKELQIFKTA 1378
             + KL    L+ E                 ++ D+ K+  + L E   +LK ++++ +  
Sbjct: 727  AEKKLSEENLKYETERQTGSTLRLKIDDLQLNEDNLKEKVKNLEENESTLKDKIKMIEG- 785

Query: 1379 NSSSDAFEKLKVNMEKE---KDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKE 1435
             +  D   K+ V    E   KD++ D             LN  +S+ +E   D+E LKK+
Sbjct: 786  -NEDDLMGKISVLQSNEILLKDKLND-------------LNSKSSNNSELV-DVEGLKKD 830

Query: 1436 WLKEYEDETLRRIKEAEENLKKRIR 1460
            W KEY     +RI+ AE  L+KR++
Sbjct: 831  WEKEYSHIIEKRIEYAEMQLEKRLK 855

>KNAG0J01910 Chr10 complement(346989..349280) [2292 bp, 763 aa] {ON}
           Anc_8.704 YPL174C
          Length = 763

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%), Gaps = 12/97 (12%)

Query: 771 SKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLL 830
           S E +YK++I +LE+ L+RL+++L           + K SQ + AQ   D    ++ SL+
Sbjct: 247 SMESKYKSRIADLEDQLDRLQTELS----------TFKMSQQR-AQAEADTLSSQLDSLI 295

Query: 831 T-ELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQ 866
           T EL ++E  IE L+S++  L +++ KT   + F  Q
Sbjct: 296 TRELPDREQQIEVLNSQVALLQEQVSKTAIYHDFFHQ 332

>KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] {ON}
            Anc_3.393 YBR130C
          Length = 421

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 58/99 (58%), Gaps = 5/99 (5%)

Query: 1074 LRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKND 1133
            L +++  L+EK+D     +  K  +KL    S+  HER++L + L   KR++  ++ + D
Sbjct: 77   LTLQSHTLLEKLD-----HAQKREIKLNENISHYNHERDNLNSMLQRKKRKINELQGEID 131

Query: 1134 SLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQ 1172
             L +T + LQ + +  EKE + ++ ++D++K+ T  +T+
Sbjct: 132  ELVQTFDSLQTSNSTLEKEIEENSALVDDYKEKTASLTR 170

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
           complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 38.5 bits (88), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 82/156 (52%), Gaps = 9/156 (5%)

Query: 818 TIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTL 877
           TI +T++K++ L    S  E+ +++L+++++     L + K   K  D+  + S      
Sbjct: 497 TISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLK--DKTIEFSDEISQH 554

Query: 878 RKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAR 937
            KELE   +QL+   SQIQ  E  IS  +   ++L+N++    EN ++ I ++ +EK +R
Sbjct: 555 EKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDI----ENLNSLISVKIEEKISR 610

Query: 938 EEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLR 973
           E+++  LR EL  I     ++  G   +    EKLR
Sbjct: 611 EKEIGSLRNELNRITK---EVSIGDTEYTNAKEKLR 643

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 36.6 bits (83), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 770  SSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSL 829
            SS   +Y  K+  LE  L   ++D + K++E+ES ++  DS     + T++    ++K L
Sbjct: 1433 SSITKEYSEKVTALEEKLTSSKNDFEEKVRELESKQTEMDSLKLDLEATLEQKNTEIKKL 1492

Query: 830  LTELSNKETTIEKLSSEIENLDK 852
             +ELS KE  +EK SSEI  + K
Sbjct: 1493 SSELSEKEIQLEKGSSEISEISK 1515

>TPHA0P00430 Chr16 complement(91648..92607) [960 bp, 319 aa] {ON}
           Anc_8.85 YPL004C
          Length = 319

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 71/151 (47%), Gaps = 11/151 (7%)

Query: 723 LKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKE 782
           L ++ +  I T+++L R  E    E+K    +L E    ++E+  D + K G    ++ E
Sbjct: 54  LSRKLSQLIKTEKNLMRSMELVVSERKHAATQLSEWGYGNDEDVSDVTDKLGVLLFELGE 113

Query: 783 LENNL----ERLRSDLQSKIQEIE-SIRSCKDSQLKWAQNTI-----DDTEMKMKSLLTE 832
           L++      ++ R  ++S I++IE S++  +D + K A         D T  K+  L  E
Sbjct: 114 LQDQFIDKYDQYRITIKS-IRDIESSVQPSRDRKEKLAGQIAALKYKDPTSAKLPVLEQE 172

Query: 833 LSNKETTIEKLSSEIENLDKELRKTKFQYKF 863
           L   E       +++ N+ +E  K  F Y+F
Sbjct: 173 LVRAEAESLVAEAQLSNITREKLKASFNYQF 203

>KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]
           {ON} weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component ortholog of human kendrin involved in
           connecting nuclear microtubules to SPB interacts with
           Tub4p-complex and calmodulin phosphorylated by Mps1p in
           cell cycle-dependent manner
          Length = 838

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 13/108 (12%)

Query: 825 KMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEP----TLRKE 880
           ++  L +EL+ K+  +E   +EI+NL  +L+K          N D+S+L      T  KE
Sbjct: 258 RIDKLESELAAKDKELEINRNEIKNLQNDLQKA---------NHDSSSLADQKLQTRSKE 308

Query: 881 LEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIE 928
           +E +  +LK A  + +A E ++  ++NAL  L+ EL+  ++  D K++
Sbjct: 309 IENLNNRLKSAVREREAAEHLLKESQNALRSLRAELSTLRQESDRKLD 356

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 35.0 bits (79), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 116/237 (48%), Gaps = 44/237 (18%)

Query: 1183 LQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQR 1242
            L+  +  + +K  EI +++ +RQE+I R   D    + Q+       ++Y +E       
Sbjct: 326  LENEISGIQQKVDEISEKIRNRQEKIERYTSDDGTIEAQIDAK----VIYVNE------- 374

Query: 1243 YQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKK 1302
                    KD+Q ++  +L   + D+KG+    ++  A+ ++  ++ KK    K++A  K
Sbjct: 375  --------KDSQHQNARQL---LRDVKGRFEKEKSNQAEAQSNIDQGKK----KVNALNK 419

Query: 1303 QQAALTNELN-ELKAIKDKLEQDL-HFE--NAKVIDLDTKLKA--HELQSEDVSRDHEKD 1356
              A L  EL  E+   KD++ Q+L H E  N ++ D++  L     +L++E+    HE++
Sbjct: 420  TIAHLEEELTKEMGGDKDQMRQELEHLEKTNERLRDVNNSLVVDLQDLKNEEREIQHERE 479

Query: 1357 T-YRTLMEEIESLKKELQ-IFKTANSSSDAFEKLKVNMEKEKDRI---IDERTKEFE 1408
            +  R     I+  K ELQ IF+     +D F    +N ++  DR+   +++R  EF+
Sbjct: 480  SELRITSRSIQDKKVELQNIFR----GNDTF---LMNFDRNMDRLLRTVEQRKSEFQ 529

>AGL305W Chr7 (128699..131872) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR091C (JSN1) and
           YPR042C (PUF2)
          Length = 1057

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 49/115 (42%), Gaps = 7/115 (6%)

Query: 469 LLNTSAIQE--TASPLSQDEL--ISLRKILESSNIVNENDSQAIITERLVEFSNVNELQE 524
           +LNT  +    +A P+ QDE+   SL  +     +   N    ++    +  SN+  LQ+
Sbjct: 312 MLNTPVMSAPLSAGPIVQDEVDPRSLNWVSTDPTVPPINQISHLLPSNTISISNIFPLQQ 371

Query: 525 KNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETR 579
           +     N + + +  L        K L     +T+K    AI+E E ++A M  +
Sbjct: 372 QQPHFSNAVNLTSTSLATLCLNFGKVLSA---RTLKTVNMAIVEFETVDAAMRAK 423

>Kpol_1053.38 s1053 (60075..62954) [2880 bp, 959 aa] {ON}
           (60075..62954) [2880 nt, 960 aa]
          Length = 959

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 37/57 (64%), Gaps = 4/57 (7%)

Query: 55  YYSRISKLKQLLDESSEQKNTAKEELN--GLKDQLNEERSRYRREIDALKKQLHVSH 109
           Y S +SKL+++++ + +    A EE N   +K + NEE ++ R+E+D ++ Q+H +H
Sbjct: 457 YTSPLSKLQEMVETTVDLD--AYEEHNEFMIKVEFNEELAKIRQELDMMRDQIHTAH 511

>Ecym_4504 Chr4 (1009783..1011774) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ACL174W
          Length = 663

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 520 NELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAK 563
           N++   N E+  C+ IL  K+ N+EGK    + +++N+ + E K
Sbjct: 535 NQMMRYNKEIFECVVILGIKIPNHEGKAGFAVVQLKNEYLMEDK 578

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score = 33.9 bits (76), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 67/140 (47%), Gaps = 25/140 (17%)

Query: 771 SKEGQYKAK--IKELENNLERLRSDLQSKIQEIESIR-----------SCKDSQLKWAQN 817
           SKEG Y +    K+L  ++E  +++L+   + IES+            S KD    +  N
Sbjct: 505 SKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKAN 564

Query: 818 --TIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQ--------- 866
             ++ D  + ++S L E   KET I  L  +++  ++E++KT   ++F  Q         
Sbjct: 565 IASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTF 624

Query: 867 -NSDASTLEPTLRKELEQIQ 885
            + + S +  TL+K +E +Q
Sbjct: 625 ISDEISNIRDTLKKHIEYLQ 644

>TDEL0F02620 Chr6 complement(487111..488346) [1236 bp, 411 aa] {ON}
            Anc_4.86 YGR149W
          Length = 411

 Score = 33.5 bits (75), Expect = 5.7,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 1255 KKDIEKLTNEISDLKGKLSSAENANADLENKFN 1287
            +K+++KL NE+  L+ +L ++ N+N  +EN +N
Sbjct: 358  EKEVDKLRNEVLSLQQQLKTSSNSNTPVENGYN 390

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 33.5 bits (75), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 101/228 (44%), Gaps = 24/228 (10%)

Query: 716 LEYEISKLKKETASFIPTKESLTRD-FEQCCKEKKELQMRLKESEISHNENKMDFSSKEG 774
           LE E S+L  E  S I T  S+  D  ++  K+ ++L+  +++ +++  E    F S E 
Sbjct: 301 LEKEESELLNE-VSRIKTSHSICNDNIKENNKQVEKLKSDIEQFKLTLKEKSETFESTEK 359

Query: 775 QYK------AKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKS 828
           +Y+      AKIKE  +  E L S L + I           +QL  A+N ++DTE+ +K 
Sbjct: 360 EYQEINASLAKIKETYSKKEELLSTLLTGITSTGDTDGGYSAQLTIAKNKLNDTEVSIKK 419

Query: 829 LLT-------ELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKEL 881
           L         EL N +  +++   E E +   + K K     L+Q    S  +P   KEL
Sbjct: 420 LSMRIDILNKELVNNQPKLQQAKIENEKIRGNVEKHKHVCLDLEQQLSKSGFDPLRTKEL 479

Query: 882 EQIQVQLKDANSQIQAYEEIISSNENA---LIELKNELAKTKENYDAK 926
           +  +      NS  Q    + + NEN    +  L        EN+DA+
Sbjct: 480 KTRE------NSLRQEIHRVETQNENLKRRVAGLDFNYTNPSENFDAR 521

>SAKL0D07920g Chr4 (659019..659546) [528 bp, 175 aa] {ON} similar to
           uniprot|Q06568 Saccharomyces cerevisiae YLR254C NDL1
           homolog of nuclear distribution factor NudE NUDEL
          Length = 175

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 53/93 (56%), Gaps = 10/93 (10%)

Query: 24  LRKLYKKIAKFERSEEEVTKLNVLVDEIK---SQYYSRISKLKQLLDESSEQKNTAKEEL 80
           ++KL  ++    R E++VT L +LVDE++   +   +++S L+Q  D S EQ    K E+
Sbjct: 54  IQKLKDQVTHPPR-EDQVTSLEILVDELEIENNSLKAQVSALQQDNDRSLEQNVMLKHEI 112

Query: 81  NGLKDQLNEERSRYRREIDALKKQLHVSHEAMR 113
           N L++ L     R  ++ D ++K LH S  +MR
Sbjct: 113 NDLREALQ----RIPKD-DKIEKDLHHS-SSMR 139

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_5.414
            YDR356W
          Length = 1009

 Score = 33.1 bits (74), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 116/230 (50%), Gaps = 30/230 (13%)

Query: 1199 KQLNDRQEEISRLQRDLIQTKEQVSINSNKILV-YESEMEQCKQRYQDLSQQQKDAQKKD 1257
            K + ++Q++I  LQR L   ++ +  + NK L  ++  +++ + +Y     ++    K+D
Sbjct: 608  KVIKEKQDQIEDLQRKLADLRDAIRTDQNKNLKKFDLRIKETEMKYT----EELGKLKED 663

Query: 1258 IEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTN-ELNELKA 1316
            +  L NE + LK +L + + +  ++E + +R   +   K ++  K+   L N + N+  +
Sbjct: 664  VRLLKNERAKLKNQLETIKESKVNMETQHDRELNEWISKFNSMSKEHNNLINRQDNKRDS 723

Query: 1317 IKDKLEQDLHFENAKVIDLDTKLKAHELQSEDV---------SRDHEKDTYRTLMEEIES 1367
             ++++ + L+ EN +++    +L+A + Q  D+         SRD  KDT +  +  ++S
Sbjct: 724  YRNEIMETLN-ENKRLL---AQLEALQNQRSDMEIEITKLSKSRDAYKDTLKNTLSNLDS 779

Query: 1368 LKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNK 1417
            + KE   +K  N ++D           EK+  + +R +  ++KL   +N+
Sbjct: 780  ITKEFSEYKRRNKNND-----------EKNESMSDRYQNMQEKLMRRINQ 818

>NDAI0D01230 Chr4 complement(293860..294366,294470..294493) [531 bp,
            176 aa] {ON} Anc_2.269 YNL044W
          Length = 176

 Score = 32.0 bits (71), Expect = 8.5,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 1106 NLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVII 1160
            N++++  SL+TKL+T +    F   KN S  + + DLQ   + +   Y  +  +I
Sbjct: 21   NMKNQFQSLQTKLSTLRSPQEFFNVKNMSKPQNVGDLQNRVSFNLNHYSSNYALI 75

>SAKL0C13750g Chr3 complement(1210007..1211494) [1488 bp, 495 aa] {ON}
            similar to uniprot|Q08287 Saccharomyces cerevisiae
            YOL144W NOP8 Nucleolar protein required for 60S ribosomal
            subunit biogenesis
          Length = 495

 Score = 32.7 bits (73), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 985  KIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQD 1044
            K E++S  +Q  +  + S+ Q T   +K L      LE      QA+L+K K++++S QD
Sbjct: 393  KKEQISNAIQEQENLQTSELQITKHNDKGL--FFPHLESPFLVSQAQLSKIKNAMHSEQD 450

Query: 1045 LLDKHERKWMEEKADYEREL 1064
            +    ++++ + +A + RE+
Sbjct: 451  IFASWDQQFWDNRATWTREM 470

>KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly
            similar to uniprot|P31111 Saccharomyces cerevisiae
            YDR285W ZIP1 Synaptonemal complex (SC) protein that
            connects homologous chromosomes partially during zygotene
            and entirely during pachytene potential Cdc28p substrate
            synaptonemal complex protein
          Length = 755

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 15/157 (9%)

Query: 1265 ISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQD 1324
            I+ L  KL++    ++ L+   N  KK+    +D+ KK+     +E N +K   + L+Q 
Sbjct: 531  ITSLDSKLTAQTEISSILQKDMNDTKKE----IDSLKKKHTQALDENNSIKHKYENLQQQ 586

Query: 1325 LHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQ-IFKTANSSSD 1383
             H  N +++    + KA EL+  +++R+      R   EE+ES        FK  N    
Sbjct: 587  FHKINVELV----QSKAKELEFGEINRN-----LREQFEELESASNHTSNSFKRVNDKVH 637

Query: 1384 AFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTS 1420
            A EK K  +  EK  ++D + +E E KL+E  N++ S
Sbjct: 638  ALEKEKSALNLEKLDLMD-KIEELEDKLKEANNQNRS 673

>Suva_16.90 Chr16 (153235..156549) [3315 bp, 1104 aa] {ON} YPL216W
           (REAL)
          Length = 1104

 Score = 33.1 bits (74), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 22/96 (22%)

Query: 25  RKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQLLDESSEQKNTAKEELNGLK 84
           R+L++   K   +++++  L VLVD + +  +S  S +KQL+DE           +  L+
Sbjct: 616 RELWQNFCKNLSTKDKIDILWVLVDMVSN--FS--SFVKQLVDE-----------IPFLR 660

Query: 85  DQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120
           D +       R E+D++KK+ H+S E ++ V+ E R
Sbjct: 661 DGI-------RSELDSIKKEYHISKEQLKSVSAELR 689

>ZYRO0B05192g Chr2 complement(420331..421653) [1323 bp, 440 aa] {ON}
           similar to uniprot|P33895 Saccharomyces cerevisiae
           YOL069W NUF2 Component of the evolutionarily conserved
           kinetochore-associated Ndc80 complex
           (Ndc80p-Nuf2p-Spc24p- Spc25p) involved in chromosome
           segregation spindle checkpoint activity and kinetochore
           clustering
          Length = 440

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 384 LQNQLEDFILELEH-KTPELISFKERTKSLEHELKRSTELLETVSL 428
           LQ QLED+  E  H   PEL S +E  K LE +LK  T++ +T+SL
Sbjct: 156 LQQQLEDYDEEATHFGGPELESLEENNKELEAQLKNLTQVQQTLSL 201

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
            some similarities with uniprot|Q22X91 Tetrahymena
            thermophila SB210 TTHERM_00561660 Viral A-type inclusion
            protein repeat containing protein
          Length = 698

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 90/377 (23%), Positives = 170/377 (45%), Gaps = 66/377 (17%)

Query: 723  LKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKM--------------- 767
            L  + ++     ESL+ D+++  KEK+EL+   K SE+  N N++               
Sbjct: 308  LNDKISALTSKNESLSDDYDKLFKEKQELES--KNSELLQNNNELRSERERWLERNENLI 365

Query: 768  ----DFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTE 823
                DF+ K  +  AKIK LE  +E +++            R  K S +K+ +N I+D  
Sbjct: 366  INSTDFNVKMEERNAKIKFLEAQIENIKAKYD---------RDTK-SDMKYFKNKIND-- 413

Query: 824  MKMKSLLTELSNKETTIEKLSSEIENLDK------ELRKTKFQYKFLDQNSDASTLEPTL 877
                 +L E  N+ + +EK+   I NL++      EL K     + +D N+  + L+  L
Sbjct: 414  -----MLRENVNQTSQMEKV---IVNLNQANYKVDELLKDNESLR-VDNNNMRADLQQKL 464

Query: 878  RKELEQIQVQLKDANSQIQAYEEI---ISSNENALIELKNELAKTKENY----------- 923
             K+++ +Q+QLK        YE++    ++ + AL+ L+ E    +E++           
Sbjct: 465  -KDIKDLQLQLKQDKVTFTKYEKLENEKTACDKALVHLRQEYRTLQESFQNLKEVHSNLD 523

Query: 924  DAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLRNEVERIQKMI 983
            D   EL +  K A +  L  L  E+G++  +   L++G      Q   L  +V++  + I
Sbjct: 524  DQNKELSQYRKAAHDA-LCELNEEVGKLEDMNAVLQDGKRIDQIQINDLNCQVKKHIETI 582

Query: 984  EKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQ 1043
            E +E+ ++  +   ++  ++ Q+   E + L +     E +    +  + K  +SLY+A+
Sbjct: 583  ELLERSNSKFRKKPQELENKIQTLQCEYERLDKQYKDRETEIQQAKLNMRKMTTSLYNAR 642

Query: 1044 DLLDKHERKWMEEKADY 1060
                 HE +     ADY
Sbjct: 643  MNASDHENRCT--AADY 657

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.317 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 172,993,532
Number of extensions: 8300981
Number of successful extensions: 89035
Number of sequences better than 10.0: 4210
Number of HSP's gapped: 77106
Number of HSP's successfully gapped: 9707
Length of query: 1679
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1556
Effective length of database: 39,377,481
Effective search space: 61271360436
Effective search space used: 61271360436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)