Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL147C (SLN1)5.700ON1220122060400.0
Smik_9.225.700ON1230121853300.0
Skud_9.215.700ON1221122151330.0
Suva_9.415.700ON1219121850250.0
NCAS0G002505.700ON1183122635520.0
KNAG0L021105.700ON1200124334820.0
KAFR0D022405.700ON1187121832710.0
SAKL0E14872g5.700ON1140122331750.0
Kwal_55.197075.700ON1143121431070.0
ZYRO0G06644g5.700ON116695227030.0
AFR284W5.700ON1103123326220.0
KLTH0E01100g5.700ON1177100925320.0
CAGL0H06567g5.700ON116977620620.0
Kpol_2001.745.700ON111371319500.0
TBLA0I016805.700ON121477319090.0
TPHA0D045905.700ON112774418660.0
KLLA0A00638g5.700ON115575618610.0
Ecym_40205.700ON112572316970.0
NDAI0F003105.700ON125949616120.0
TPHA0E002505.700ON106872415470.0
TDEL0B022105.700ON109549614760.0
Kpol_1043.685.700ON104247312491e-152
TBLA0E021005.700ON11404309521e-109
Ecym_50775.230ON7951651668e-11
Ecym_74744.385ON4961201631e-10
ADL388W4.385ON4821201631e-10
TDEL0D003204.385ON5471331631e-10
KAFR0B069904.385ON5451201603e-10
CAGL0F09097g4.385ON6301391604e-10
KNAG0M001804.385ON6151201594e-10
Kwal_33.152885.230ON5871741586e-10
NCAS0A064504.385ON6091201577e-10
ZYRO0G00484g4.385ON6472031561e-09
KNAG0B051405.230ON6481291551e-09
KLLA0A10219g4.385ON4751201541e-09
SAKL0B12408g4.385ON4651201541e-09
CAGL0D02882g5.230ON6671491542e-09
ADR343C5.230ON7491641533e-09
Skud_8.2734.385ON6231561523e-09
KLTH0D17182g4.385ON4641201513e-09
YHR206W (SKN7)4.385ON6221561514e-09
NDAI0D034304.385ON5971171514e-09
Suva_15.4124.385ON6171561505e-09
Smik_8.2964.385ON6251201505e-09
Kpol_265.24.385ON5491451495e-09
KAFR0J007005.230ON6201271471e-08
TPHA0C001504.385ON5101201461e-08
KLTH0B02684g5.230ON5951711471e-08
TBLA0A107004.385ON5871201461e-08
TDEL0E039805.230ON7301431471e-08
Kwal_47.167704.385ON4611201433e-08
ZYRO0A11154g5.230ON7761541434e-08
Suva_10.845.230ON6951491425e-08
Kpol_1004.45.230ON7141581408e-08
TPHA0N008505.230ON6701511372e-07
NCAS0D029005.230ON7621721372e-07
Skud_12.725.230ON7021491362e-07
YLR006C (SSK1)5.230ON7121491354e-07
Smik_12.685.230ON7121491336e-07
NDAI0I020005.230ON8901451311e-06
KLLA0E09505g5.230ON6351091292e-06
TBLA0D031705.230ON7651581238e-06
SAKL0G12100g5.230ON738731085e-04
KLLA0E04533g7.222ON42181880.090
KLLA0F14256gsingletonON96683840.34
Klac_YGOB_Anc_8.348.34ON1571110840.41
TBLA0B015507.222ON39481791.1
YFL033C (RIM15)8.34ON1770110801.2
Skud_6.388.34ON1758111801.2
Kpol_1035.408.34ON1517113791.4
TBLA0E049804.385ON791100782.0
Kwal_47.181517.222ON41481772.3
SAKL0F08184g7.222ON41281762.4
CAGL0J11638g6.31ON74674772.7
KLTH0A03718g7.216ON47494762.8
Smik_6.468.34ON1760111772.8
Smik_13.1596.31ON70566763.6
Suva_6.268.34ON1753111754.2
YMR001C (CDC5)6.31ON70566754.5
Suva_13.1636.31ON70566754.6
Skud_13.1546.31ON70566745.3
TDEL0C038002.282ON56685727.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL147C
         (1220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  2331   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  2057   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1981   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1940   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1372   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1345   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1264   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1227   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1201   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1045   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1014   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   979   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   798   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   755   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   739   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   723   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   721   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   658   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   625   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   600   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   573   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   485   e-152
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   371   e-109
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    69   8e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    67   1e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    67   1e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    67   1e-10
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    66   3e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    66   4e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    66   4e-10
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    65   6e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    65   7e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   1e-09
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    64   1e-09
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    64   1e-09
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    64   1e-09
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    64   2e-09
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    64   3e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    63   3e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    63   3e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    63   4e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     63   4e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    62   5e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    62   5e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    62   5e-09
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    61   1e-08
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    61   1e-08
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    61   1e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    61   1e-08
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    61   1e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    60   3e-08
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    60   4e-08
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    59   5e-08
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    59   8e-08
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    57   2e-07
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    57   2e-07
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    57   2e-07
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    57   4e-07
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    56   6e-07
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    55   1e-06
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    54   2e-06
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    52   8e-06
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    46   5e-04
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    39   0.090
KLLA0F14256g Chr6 (1321231..1324131) [2901 bp, 966 aa] {ON} simi...    37   0.34 
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    37   0.41 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    35   1.1  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    35   1.2  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    35   1.2  
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    35   1.4  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    35   2.0  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    34   2.3  
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    34   2.4  
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    34   2.7  
KLTH0A03718g Chr1 complement(321327..322751) [1425 bp, 474 aa] {...    34   2.8  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    34   2.8  
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    34   3.6  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    33   4.2  
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    33   4.5  
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    33   4.6  
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    33   5.3  
TDEL0C03800 Chr3 (667719..669419) [1701 bp, 566 aa] {ON} Anc_2.2...    32   7.9  

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 2331 bits (6040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1148/1220 (94%), Positives = 1148/1220 (94%)

Query: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120

Query: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180
            NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL
Sbjct: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240
            NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240

Query: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300
            YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA
Sbjct: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300

Query: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAE        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS 420

Query: 421  XXXXXXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480
                              MKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG
Sbjct: 421  GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480

Query: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEERVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720

Query: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780
            SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE
Sbjct: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780

Query: 781  ITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGN 840
            ITKRNTVANESIYKKVNDREKASNDD           YDNAIFNSQFNKAPGSDDEEGGN
Sbjct: 781  ITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGN 840

Query: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960
            ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960

Query: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQL 1020
            KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQL
Sbjct: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQL 1020

Query: 1021 QEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKD 1080
            QEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKD
Sbjct: 1021 QEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKD 1080

Query: 1081 DDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNM 1140
            DDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNM
Sbjct: 1081 DDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNM 1140

Query: 1141 IFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRP 1200
            IFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRP
Sbjct: 1141 IFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRP 1200

Query: 1201 KLKTILTEFCAAYQGKKNNK 1220
            KLKTILTEFCAAYQGKKNNK
Sbjct: 1201 KLKTILTEFCAAYQGKKNNK 1220

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 2057 bits (5330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1017/1218 (83%), Positives = 1078/1218 (88%), Gaps = 1/1218 (0%)

Query: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MR  LPSK E TPPFRIGIR QLTALVSIVAL SLIILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQSSLTS+VAGNKSADNWVDSLSV+QKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180
            NLFYVAKVYDSSF  VLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLET GILTDPV+
Sbjct: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE S +AIISA+
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300
            YN+QGKASGYHF+FPPYG+ S L Q VFSIKN+TFISSAFRNGKGGSLKQTN    +N A
Sbjct: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSF LVNWVA+VSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRT+SRASSFKRGF SGF VPSSLLQFNT E        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTISAS 420

Query: 421  XXXXXXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480
                              MKSAINLGNEK+ P E+E KIPNN+TDAK+SMDGSLNHDLL 
Sbjct: 421  GHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480

Query: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            P+SLR+NDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK+L
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720

Query: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780
            SEKKQ+KEV++K+GTE+TE  E T+K D+P  SNHRK VDLES+ TS+ SNRDTS IQEE
Sbjct: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780

Query: 781  ITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGN 840
            ITKRNT ANE+IYK++ND EK S+DD           YD+AIFNSQFNKAPGSD++EGGN
Sbjct: 781  ITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGN 840

Query: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            LG+PIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960
            ANMM+GTM+LESKVGVGSKFTFTLPL QTKEISFA+M+FPFEDEFNPESRKNRRVKF+VA
Sbjct: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960

Query: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQ- 1019
            KSIKSRQSTSS+ATPATNRSSL NDVLPE+ SK +++ K   N NM RE  N  G +EQ 
Sbjct: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020

Query: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVK 1079
            LQEKN+KP IC + AE +E+ ++  KHRSR E LGSVNLDRPFLQSTGTATSSRN+PT++
Sbjct: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080

Query: 1080 DDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYN 1139
            D+DKN+TS+KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKG NYN
Sbjct: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140

Query: 1140 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1199
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1200 PKLKTILTEFCAAYQGKK 1217
            PKLKTILTEFCAAYQGKK
Sbjct: 1201 PKLKTILTEFCAAYQGKK 1218

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1981 bits (5133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 972/1221 (79%), Positives = 1052/1221 (86%), Gaps = 1/1221 (0%)

Query: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MRF LPS+ +  PPFRIGIR QLTALVSIVAL SL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120
            AAQLKSSQ+DQTLN          SRDALQSSLTSYVAGNKS DNWVDSLSV+QKFLSSS
Sbjct: 61   AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180
            NLFYVA+VYDSSF  VLNATNNGTGDLIPEDVLD+LFPLSTD PLPSSLET GILTDP++
Sbjct: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITI+MSAEGLKSVFNDTTALE S +AIISA 
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300
            YN+QG+ASGYHFVFPPYG+   + Q++F I+N+TFISS FRNGKGGSLK+TN   T+N A
Sbjct: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSF LVNWVA+VSQPESVFLSPATKL KII GTVIAIGVFVILLTLPL HWAV+P
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRT+SRASSF+RGFSSGF  PSSLLQFNT E        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSAN 420

Query: 421  XXXXXXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480
                              MKSAINLG+EK+SP EEENKIPNNH D KISMDGSLNHDLL 
Sbjct: 421  GHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480

Query: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            P+SLR+NDTDRSS+RSHILTTSANLTEARLPDY+RLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRN+LKLIFRSG            FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK+ 
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720

Query: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780
            SEK+Q+KEV++KKGTE+T+ +E+ DK DLPT    RK V+LES+  S+ S RD S IQEE
Sbjct: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780

Query: 781  ITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGN 840
            ITKRNT ANE+IYKK NDREK+SNDD           YD+AIFNSQFNKA  SD +E GN
Sbjct: 781  ITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGN 840

Query: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            +GRPIENPKTWVISIEVEDTGPGI+PSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960
            ANMMHGTMKLES+VGVGSKFTFTLPL+QTKEISFA++EFPFEDEFNPES+KNRRVKFSVA
Sbjct: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960

Query: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNG-GLEQ 1019
            KSIKSRQSTSS+ TP TN ++L NDVL E RS  + E +   N    +E +N+NG   +Q
Sbjct: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020

Query: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVK 1079
             QEKN K S+  + AE + Q ++SSK RS+ E LGSVN+DRPFLQSTGTATSSRN+PTV+
Sbjct: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080

Query: 1080 DDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYN 1139
              DK+ TS+KILVVEDNHVNQEVI+RMLNLEGI+NIELACDGQEAFDKVKELTSKGENYN
Sbjct: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140

Query: 1140 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1199
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1200 PKLKTILTEFCAAYQGKKNNK 1220
            PKL TIL+EFCAAYQGKKN K
Sbjct: 1201 PKLNTILSEFCAAYQGKKNKK 1221

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1940 bits (5025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 964/1218 (79%), Positives = 1049/1218 (86%), Gaps = 1/1218 (0%)

Query: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MRF LPS+   TPPFRI IR QLTALVSIVAL SL+ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQ+SLT YVAGNKS+DNWVDS+S++QKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180
            NLF+VAKVYDSSF  VLNATNNGTGDLIP+D+ D LFPLSTD  LPSSLET GILTDP+L
Sbjct: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240
            NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE S +AIISAV
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300
            YN+Q KA  YHFVFPPYG+ S + + +F IKN+TFISSAF+NGKGGSLK+TN    +N A
Sbjct: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300

Query: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSF LVNWVA+VSQPESVFLSP+TKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRT+SR SSFKRGFSSGFAVPSSLLQFN+ E        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSAS 420

Query: 421  XXXXXXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480
                              MKSA+N+GNEK+SP EEE + PN+H +AKISMDGSLNHDLL 
Sbjct: 421  GHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480

Query: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            P++LRH+D DRSS+RSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720
            RVRLSISLFPN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV+VRMKLLGEYDKEL
Sbjct: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720

Query: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780
            SEKKQ+KEV+++KGTE+ E++   +K+D     N +KS+D ES+ TS+ SNRDTSTIQEE
Sbjct: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEE 780

Query: 781  ITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGN 840
            ITKRNT ANE+IYKK  DREK+SNDD           YD+AIFNSQFNKA GSDD+EGG+
Sbjct: 781  ITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGD 840

Query: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            LG+PIENPKTW ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960
            ANMMHGTMKLESKVGVGSKFTFTLPL+QTKEISFA+M FPFEDEFNPESR+NRRVKF+VA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960

Query: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKND-NGGLEQ 1019
            +SIKSRQS SS+ATP  NR  LTN++L + RS  + E + + N   G+E  N+ +   +Q
Sbjct: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELDEAHQQ 1020

Query: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVK 1079
            LQEKN+K SI  + A+ NEQ S  S   SR E +GSVNLDRPFLQSTGTATS+RNIPTV 
Sbjct: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080

Query: 1080 DDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYN 1139
            + DK+++S+KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQ+AFDKVKELTS+GE+YN
Sbjct: 1081 NSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140

Query: 1140 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1199
            MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1200 PKLKTILTEFCAAYQGKK 1217
            PKLKTIL EFCAAYQGKK
Sbjct: 1201 PKLKTILIEFCAAYQGKK 1218

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 1372 bits (3552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1226 (59%), Positives = 879/1226 (71%), Gaps = 63/1226 (5%)

Query: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            M+  L     L PPFR+GIRTQLT LVS+VAL SL+ILA+TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MKVNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120
            AAQLKSSQIDQ LN          SRD LQ  LT+YVAGNK+A+NW DS  VIQKFL+S+
Sbjct: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120

Query: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180
            NLF  A++YDSSFNAVL ATNNGTGDLIPE VL  L+PL+T+ PL SSLETIGILTDPVL
Sbjct: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240
            N + Y+MSMSLPIFANPSIILTDS+VYGYITI+MSAEGLK+VFNDTTALE S +AI+S V
Sbjct: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240

Query: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300
            YN++   + YHFVF PYG+ S +    F I N++F+++A R GKGGS+K+T    T+N A
Sbjct: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300

Query: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            +GYSPC+F+ VNW+AIVSQ ESVFLSP+TKLAKII+GTV+AIGVFV L+T PLAHWAV+P
Sbjct: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRPSTP--RTISRASSFKRGFSSGF-AVPSSLLQFNTAEXXXXX 417
            IVRLQKATEL++EGRGL+ +TP  + +SR+SS K    S   +  SS+  F+        
Sbjct: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420

Query: 418  XXXXXXXXXXXXXXXXXXXXXMKSAINLGNEKMSP-PEEENKIPN-NHTDAKISMDGSLN 475
                                      +L    ++P P     +P+ + ++    M  + N
Sbjct: 421  NG------------------------HLNQRGLTPTPMPTTDLPSPSDSNFATEMISNAN 456

Query: 476  HDLLGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDAL 535
                     R  D    SNRS  LTTSANL EAR+PDYRRLFSDELSDLT+TFN MTDAL
Sbjct: 457  TSQRANSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDAL 516

Query: 536  DQHYALLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEE 595
            DQHYALLE+RVRARTKQL             KT+FIANISHELRTPLNGILGMTAISMEE
Sbjct: 517  DQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEE 576

Query: 596  TDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGK 655
            TD+ KIR+SLKLIFRSG            FSKNVL+RT LEKRDFCITDVALQIKSIFGK
Sbjct: 577  TDIAKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGK 636

Query: 656  VAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGE 715
            VAKDQRVRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V+VR+KL+GE
Sbjct: 637  VAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGE 696

Query: 716  YDKELSEKKQYKEVYIKKGTEVTEN-----LETTDKYDLPTLSNHRKSVDLESSATSLGS 770
            YD+ LS +  +K+V +K GTE  E      L    K D  T +     +    ++ +  S
Sbjct: 697  YDENLSRESNFKKVLVKSGTEFIETKAKAILGAPKKDDPKTSTESVVQIKENLNSNTSSS 756

Query: 771  NRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKA 830
            + D  +   +  K +   +E      ++    ++ +           YD+A+FN+QF K 
Sbjct: 757  SNDIISTTSDEKKYDEKEDEGEEDNSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKT 816

Query: 831  PGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGT 890
            P   ++E GNLG  + NPKTWVI+IEV+DTGPGIDPSLQ+SVF PFVQGDQTLSRQYGGT
Sbjct: 817  PELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGT 876

Query: 891  GLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESR 950
            GLGLSICRQLANMM+GTM+L+S+VGVGS FTFT+PL QT+E+   + + PFEDEFNP SR
Sbjct: 877  GLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASR 936

Query: 951  KNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREE 1010
            KNRRVKF +AKS++SR+S SS  T +T  S      L  V+ + K E K      +G  E
Sbjct: 937  KNRRVKFKLAKSLRSRKSRSSTTTFSTTNS------LHNVQEE-KEEDK------LGDNE 983

Query: 1011 KNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTAT 1070
            +  +GG E+              A    ++S    +   +  LG+VN+DRPFLQSTGTAT
Sbjct: 984  ETKDGGKEE-------------DAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTAT 1030

Query: 1071 SSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKE 1130
            S+R I TV D  K     KILV EDNHVNQEVIKRMLNLEG+ENIELA DGQ+AF++VK 
Sbjct: 1031 STRTIQTVPDAGK---KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKA 1087

Query: 1131 LTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMN 1190
            +  +GE+++MIFMDVQMPKVDGLLSTKMIR DL YT PIVALTAFADDSNIKECLE+GMN
Sbjct: 1088 MVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMN 1147

Query: 1191 GFLSKPIKRPKLKTILTEFCAAYQGK 1216
            GFLSKPIKRPK+KTIL E+C  +Q K
Sbjct: 1148 GFLSKPIKRPKVKTILEEYCPNWQMK 1173

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1345 bits (3482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1243 (58%), Positives = 853/1243 (68%), Gaps = 110/1243 (8%)

Query: 13   PPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72
            PP+R+GIR QLT LVSIVA+ SL+ILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 
Sbjct: 12   PPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71

Query: 73   LNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSS 132
            LN          SRD LQ+ L +YVAGNKS  NW+DS SV++KFL SSNLF VA+VYDSS
Sbjct: 72   LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131

Query: 133  FNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLP 192
            F  VLN TNN TGDLIPEDVL  L PLST+ PLPSSLET GI+T+PV N + YLMSMSLP
Sbjct: 132  FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191

Query: 193  IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHF 252
            IFANPSIILTDSRVYGY+T++MSAEGL SVFNDTTALE S +AI+SAVY +  K   Y F
Sbjct: 192  IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRF 251

Query: 253  VFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVN 312
            VFPP+GS S +  + F + N+TF+SSA R GKGG+LK T +      A+GYSP + NL N
Sbjct: 252  VFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLAN 311

Query: 313  WVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELIT 372
            WVAIV+Q ESVF+SPATKLAKII GTV+ IGVF +L+T PLAHWAV+PIVRLQKATELIT
Sbjct: 312  WVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELIT 371

Query: 373  EGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXXXXXXXXXXXXXX 432
            E RGLRP+TP + SRA+S  R  SS  + P                              
Sbjct: 372  ESRGLRPTTPTSGSRANSILRDKSSLISFP------------------------------ 401

Query: 433  XXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPH--------SL 484
                       N  NEK  PP +++   NN + +    +    H    PH        SL
Sbjct: 402  LHPVSTNNINNNNSNEKAQPPSDQDTNTNNSSSSIAVSNIREEH---SPHADGVFSGISL 458

Query: 485  RH--NDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALL 542
             +  +  +R SN S   TT+ NL +AR+P YR LF DELSDLTETFNTMTDALDQHYALL
Sbjct: 459  SNVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALL 518

Query: 543  EERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIR 602
            EERVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETD++KIR
Sbjct: 519  EERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIR 578

Query: 603  NSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRV 662
            NSLKLIFRSG            FSKNVL+RTKLEKR+FCITDVALQIKSIFGKVAKDQ V
Sbjct: 579  NSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHV 638

Query: 663  RLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSE 722
            RLSI L PN+IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDG VDVRMK+LG YD+ LSE
Sbjct: 639  RLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSE 698

Query: 723  KKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEIT 782
            K  + +VY+K GTE+T++  + +      + +  +  D  +S T+  +N  + T  +   
Sbjct: 699  KYNHNKVYVKPGTEITDSTPSLN------VKSEGQGKDKFTSDTASKNNTSSDTAYDATP 752

Query: 783  KRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPG-SDDEEGGNL 841
              + VA ES        E    +D           YD+AIFNSQF K     D+++   +
Sbjct: 753  TTDRVAQES-------DEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEM 805

Query: 842  GRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLA 901
            G  +E PKTWVIS EVED+GPGID  LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 806  GVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 865

Query: 902  NMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAK 961
             MM G M LESKVGVGSKFTFTLPL QT+EI+FA++E PFEDEFN +S+KNR+VKF +A+
Sbjct: 866  GMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMAR 925

Query: 962  SIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQ 1021
            S+ SR+S SS+ T   +                 H +     P      K D      + 
Sbjct: 926  SLNSRKSRSSIVTAGAS----------------SHHSVHTRTPTKSPRLKCD----RSVS 965

Query: 1022 EKNIKPSICLTGAEVN----EQNSLSSKHRSR---HEGLGSVN----LDRPFLQSTGTAT 1070
            ++ +  S   TG  +       + LS  HR+R   HE L + N    LDRPFLQSTGTAT
Sbjct: 966  DRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTAT 1025

Query: 1071 SSRNIP---TVKDDDKNET-------------------SVKILVVEDNHVNQEVIKRMLN 1108
            S+R+IP   + K++  N+                    + KILV EDNHVNQEVIKRML 
Sbjct: 1026 STRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQ 1085

Query: 1109 LEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSP 1168
            LEG+++I+LACDGQ+AFDKVK+L  KG  YN+IFMDVQMPKVDGL STKMIR DL    P
Sbjct: 1086 LEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFP 1145

Query: 1169 IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCA 1211
            IVALTAFADDSNIKECL++GM+GFLSKPIKR KLKTIL EFC+
Sbjct: 1146 IVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1264 bits (3271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1218 (55%), Positives = 836/1218 (68%), Gaps = 85/1218 (6%)

Query: 7    SKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 66
            + L   PP+RI IRTQL A+VS+VA+ SL+ILAVTTGVYFTS+YKNLR++RLYIAAQLKS
Sbjct: 19   AHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKS 78

Query: 67   SQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVA 126
            SQIDQTL           +RD LQ SL ++VAGNKS+ NW  + SV++KFLSSS+ F   
Sbjct: 79   SQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAV 138

Query: 127  KVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYL 186
            KVYD +F+ VL+ TNNGTG+ I  DVL+ LFPLST+ PL SSLET GILTDPVLN T YL
Sbjct: 139  KVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYL 198

Query: 187  MSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGK 246
            MSMSLP+FANPSIIL+ SRVYGYITIIM+A+GL SVFNDTTA+E S +AI+SAVYN+Q +
Sbjct: 199  MSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSE 258

Query: 247  ASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPC 306
               YH   PPYG  + +    F +KN +F++ A + GKGGS+K+T+ L  +  A+GYSPC
Sbjct: 259  LDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPC 318

Query: 307  SFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
            SF L NWV++VSQ ESVF  P+TKL KII G V+ I VFV+L+TLPLA++AV+PIVRL+K
Sbjct: 319  SFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKK 378

Query: 367  ATELITEGRGLRPSTPRT--ISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXXXXXX 424
            ATE+ITEGRGLRP+TP +  +SR SS +R  S   ++ SS     T              
Sbjct: 379  ATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGNSNSLN------- 431

Query: 425  XXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHS- 483
                           +++ +L +  M    E   + N+   ++I ++  +N +LL   S 
Sbjct: 432  ---------------ENSASLSSHPMVLTSENVLVTNHSGLSRIPVN--MNQELLDRASA 474

Query: 484  -----LRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538
                 L  +  DR S RS  L T  NLTEAR+P  R+LF DELSDLTETFNTMTDALD+H
Sbjct: 475  STVNTLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEH 534

Query: 539  YALLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDV 598
            Y LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE D+
Sbjct: 535  YTLLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDI 594

Query: 599  NKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658
             KIR+SLKLIFRSG            FSKNVLQRTKLEKR+FCITDVALQ+KSIFGKVAK
Sbjct: 595  TKIRSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAK 654

Query: 659  DQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK 718
            DQ VRLSI L PN++RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V V++KLLGEYD+
Sbjct: 655  DQHVRLSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDE 714

Query: 719  ELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQ 778
            E S+  ++++VY+K GTE      T+   +L  LS    +     S +S         I 
Sbjct: 715  ESSKNSKFEKVYVKGGTEF-----TSIPAELAALSKRESTAGSHFSGSSSHIKEKLDGIP 769

Query: 779  EEI---TKRNTVANESIYKKVNDREKASNDDXX---XXXXXXXXXYDNAIFNSQFNKAPG 832
              +      +   +E      + +  +SN+D              YD+AIFNSQF K P 
Sbjct: 770  ANVFASDSDSDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPD 829

Query: 833  SDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGL 892
              ++E GNLG  +   KTWV  IEV DTGPGID SLQESVF PFVQGDQTLSRQYGGTGL
Sbjct: 830  LYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGL 889

Query: 893  GLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKN 952
            GLSICRQLA MM+GTM LES VG GSKF FT+PL QT+ I   + E P+EDEFNP+S+ N
Sbjct: 890  GLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMN 949

Query: 953  RRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKN 1012
            R+VKF+VA+SI SR+S SS+ T  ++R       +  VR + + ET+   + ++    KN
Sbjct: 950  RKVKFNVARSINSRRSRSSLITSNSSR-------IATVREESRLETRS-NHSDVSTSNKN 1001

Query: 1013 DNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSS 1072
            ++                                  + E   ++NLDRPFLQSTGTA SS
Sbjct: 1002 ESAS-------------------------------PQPESGSNLNLDRPFLQSTGTAISS 1030

Query: 1073 RNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELT 1132
             N+PTV    K   ++ +LV EDNHVNQEVIKRML+LEG++NI+LACDGQ+AFD VK L 
Sbjct: 1031 ANVPTVATLGK---TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLK 1087

Query: 1133 SKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGF 1192
             +GE Y+MIFMDVQMPKVDGL +TKMIR DL Y  PIVALTAFADDSNIKECL++GM+GF
Sbjct: 1088 ERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGF 1147

Query: 1193 LSKPIKRPKLKTILTEFC 1210
            LSKPIKRP+LKTIL E+C
Sbjct: 1148 LSKPIKRPQLKTILLEYC 1165

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1227 bits (3175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1223 (54%), Positives = 826/1223 (67%), Gaps = 109/1223 (8%)

Query: 10   ELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQI 69
            +L PPF++GIRTQL ALV +VAL SL+ILAVTTGVYFT+NYK+LR+DRL++AAQLKSSQI
Sbjct: 10   KLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQI 69

Query: 70   DQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVY 129
            DQ LN          +RD LQ SL  Y AGN + +NW ++  V++KFL SS+LF VA++Y
Sbjct: 70   DQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIY 129

Query: 130  DSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSM 189
            DS+F  VLNATNNG+G+L+PE VL +LFPLSTD PL SSL+T GILTDPVLN T Y+MSM
Sbjct: 130  DSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSM 189

Query: 190  SLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASG 249
            SLPIFA+PSI+LT+S + GYIT++MSAE LK VFNDTTAL+ S +AI+SA Y++Q     
Sbjct: 190  SLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVS 249

Query: 250  YHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFN 309
            YHFVFPP+G  +D+    F+I+N +FI SAF + K GS+K+T+    ++ A+GYSPC F 
Sbjct: 250  YHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFK 309

Query: 310  LVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATE 369
             V WVA++SQPE+VFLSP+T+L  II GT + I VF+ L+T PLAHWAV+PIVRLQKATE
Sbjct: 310  QVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATE 369

Query: 370  LITEGRGLRP---STPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXXXXXXXX 426
            +IT  RGLR    S P   SR +SF++  S+  ++ S                       
Sbjct: 370  IITARRGLRSYNQSAP--ASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFELHH 427

Query: 427  XXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRH 486
                        M+  I+      + P+     P ++T+ +              HS + 
Sbjct: 428  RTSNSVDSQEARMELEIS-----GALPDTNPTTPTSYTNDQ--------------HSYKS 468

Query: 487  NDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERV 546
            ++             S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLE+RV
Sbjct: 469  DN----------FVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRV 518

Query: 547  RARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLK 606
            RARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K++NSLK
Sbjct: 519  RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLK 578

Query: 607  LIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI 666
            LIFRSG            FSKNVLQRTKLE+R+F I DVALQ+KSIFGK+AKDQ V LSI
Sbjct: 579  LIFRSGELLLHILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSI 638

Query: 667  SLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQY 726
             L PN+IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD + S+   Y
Sbjct: 639  ILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNY 698

Query: 727  KEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNT 786
             +V+IK GTE+ +   +  K  L TL  + K   ++    S  S  D+  ++EE    + 
Sbjct: 699  NDVFIKPGTEIPD--ASASKSSLSTL-EYTKVDAIQRRLASKSS--DSQKLKEEPIASSD 753

Query: 787  VA-----NESIYKKVNDREKASN---DDXXXXXXXXXXXYDNAIFNSQFNKAP--GSDDE 836
            V+     +ES      D +K SN    D           YD+AI ++Q  K P  G+ ++
Sbjct: 754  VSSSDGKDESEADTDTDTDKRSNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGED 813

Query: 837  EGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSI 896
             G +LGR +E  KTWVI+IEVEDTGPGI+P+L ESVF PFVQGDQTLSRQYGGTGLGLSI
Sbjct: 814  SGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSI 873

Query: 897  CRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVK 956
            CRQLA MM GTMKLESKVGVGSKFTFT+PL QT+E+SF D+E PFEDEFN  S+KNR+VK
Sbjct: 874  CRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVK 933

Query: 957  FSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGG 1016
            F + K+     S  S + P+ N S                                 N G
Sbjct: 934  FKMNKN-----SGGSKSRPSVNTSL--------------------------------NSG 956

Query: 1017 LEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIP 1076
             +   EK     + L+ +EV+               +GSV +DRPFLQSTGTATS+R+I 
Sbjct: 957  TDSTAEK-----MALSESEVS---------------VGSVRVDRPFLQSTGTATSTRSIT 996

Query: 1077 TVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGE 1136
            TVK     E   KILV EDN+VNQEV+KRMLNLEG+ +I+LACDGQEAFDKVK L    +
Sbjct: 997  TVK---SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEAND 1053

Query: 1137 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1196
            +Y +IFMDVQMP+VDGLLSTKMIR++L Y+ PIVALTAFADDSNIK CL+SGMNGFLSKP
Sbjct: 1054 HYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKP 1113

Query: 1197 IKRPKLKTILTEFCAAYQGKKNN 1219
            IKRPKLK++L+EFC  +  K+N+
Sbjct: 1114 IKRPKLKSVLSEFCPDFVEKRNS 1136

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1214 (53%), Positives = 816/1214 (67%), Gaps = 118/1214 (9%)

Query: 11   LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
            L  P  + IRTQLTALV +VAL SLIILAV TGVYFTS++K+LR++RL++AAQLKSSQID
Sbjct: 17   LRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQID 76

Query: 71   QTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYD 130
            Q LN          +RD LQ++LT Y+AGN S +NW D+ + + KFL SSNLF +A+VYD
Sbjct: 77   QNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYD 136

Query: 131  SSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMS 190
            SSF  VLN +NNG+G+LIPE++L  LFPLSTD  LPSSLE  G+LTDPVLN + YLMSMS
Sbjct: 137  SSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMS 196

Query: 191  LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGY 250
            LPIFANPSIIL+ ++VYGYIT+++SAEGLKSV+NDTTAL+ S++ I+S VY+   + +GY
Sbjct: 197  LPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-ELAGY 255

Query: 251  HFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNL 310
            H VFPPY    D+  + + I+N +F+  A ++GKGGS+K T   + +  A+GYSPC+  L
Sbjct: 256  HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTL 315

Query: 311  VNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATEL 370
              WVAI++QPE++FLSP+T+LAKII GT IAI V   ++T PL+HWAVQPIVRLQKATE+
Sbjct: 316  AQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEI 375

Query: 371  ITEGRGLRPSTPRTI--SRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXXXXXXXXXX 428
            IT GRGLR     T+   + +S    FSS F   S                         
Sbjct: 376  ITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGS------------------------- 410

Query: 429  XXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLL-------GP 481
                        S    G +K  P   +     N +DA   ++     D+         P
Sbjct: 411  -------VRRSGSVARAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTP 463

Query: 482  HSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYAL 541
            +S+ +      S R     TS NL EAR+P Y+RLFSDELS+LTETFNTMTD LD+HYAL
Sbjct: 464  YSMMNESQAVKSER---YITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYAL 520

Query: 542  LEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKI 601
            LE+RVRART+QL             KTVFIANISHELRTPLNGILGMTAI+M E D  K+
Sbjct: 521  LEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKV 580

Query: 602  RNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQR 661
            ++SLKLIFRSG            FSKNVL+RTKLE+RDF I D+ALQ++SIFGK+AKDQ 
Sbjct: 581  KSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQH 640

Query: 662  VRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELS 721
            V L+IS+ PNL+R+MVLWGDSNRI+QIVMNLVSNALKFTPVDG VDV+ +LLGEYD+E S
Sbjct: 641  VNLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKS 700

Query: 722  EKKQYKEVYIKKGTEV-TENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQE- 779
            +  +YKEV++   TE  T + E  D+       N    VD +++  SL S  +++  +  
Sbjct: 701  KASEYKEVFVLPPTESRTSSTEAKDE------KNAESCVDSDTNVLSLPSTAESTDEKNV 754

Query: 780  EITKRN---TVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDE 836
            +I +R+    + +E+I     D E   N+D           YD+AIF ++  K   +++ 
Sbjct: 755  KIGQRSESEAIDSEAIESSDEDDE---NEDTKSIGSGNTSSYDDAIFQTRLRKDSSNEEN 811

Query: 837  EGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSI 896
            E G   R +E+PK WVIS+EV DTGPGIDP+L ESVF PFVQGDQTLSRQYGGTGLGLSI
Sbjct: 812  EEG---RALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSI 868

Query: 897  CRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVK 956
            CRQLA MMHGTMKL+S+VGVGSKF+FT+PL QTKE+ F D+E PFEDEFNP+S+KNR+  
Sbjct: 869  CRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRK-- 926

Query: 957  FSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGG 1016
                  +K R   S+  + + + SS T             E     +P +     N  G 
Sbjct: 927  ------VKFRMGKSNKRSKSRSESSGT-------------EGNGGNSPGVEGSGGNSPG- 966

Query: 1017 LEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIP 1076
                           TG+EV+               +GSV +DRPFLQSTGTA S+  + 
Sbjct: 967  ---------------TGSEVS---------------VGSVRVDRPFLQSTGTALSTTLVT 996

Query: 1077 TVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGE 1136
            T    D+     KILV EDN+VNQEVIKRMLNLEG+E++ELACDGQ+AFDKVK   + G+
Sbjct: 997  TSSLADRR----KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGK 1052

Query: 1137 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1196
            +Y++IFMDVQMP+VDGL +T+MIR++LGY+ PIVALTAFADDSNIKECL++GMNGFLSKP
Sbjct: 1053 HYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKP 1112

Query: 1197 IKRPKLKTILTEFC 1210
            IKRPK+K IL E+C
Sbjct: 1113 IKRPKIKAILKEYC 1126

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/952 (58%), Positives = 670/952 (70%), Gaps = 52/952 (5%)

Query: 14  PFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73
           P R+GIR QLTALVSIVAL SLIILAV+TGVYFT NYKNLRS+RLY+AAQLKS+QIDQ L
Sbjct: 14  PIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQIDQNL 73

Query: 74  NXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSF 133
           N          SRD LQ +L +YVAGNK+  NWVDS +VIQKFL+SS LF VA +YD++F
Sbjct: 74  NYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYDATF 133

Query: 134 NAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPI 193
             VL+ATNNGTG+ IPE  LD L PLS + PLPSSL++ GILT+PVLN T YLMSMSLPI
Sbjct: 134 TPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMSLPI 193

Query: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFV 253
           FANPSIILT S VYGYITI+MSA+ LK+VF+DTTALE S +AI+SAVY+     S Y+FV
Sbjct: 194 FANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSYNFV 253

Query: 254 FPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNW 313
           F P G  S +  +   IKN TF+SSA R GKGG+L++T  L T+  A+GYSPCS   VNW
Sbjct: 254 FAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVFVNW 313

Query: 314 VAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373
           +A+V Q E+VF+ PATKL KII+GTV+ IGVFV L+T PLAHWAV+PIVRLQKATELITE
Sbjct: 314 IAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELITE 373

Query: 374 GRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXXXXXXXXXXXXXXX 433
           GRGLR S+P   S   S +  F   F  PS+                             
Sbjct: 374 GRGLRASSPGAGSSNVSRRSSF---FHRPSNC---------------------------- 402

Query: 434 XXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRHNDTDRSS 493
                ++S +   + +        +I +       +M+GS+NH L    S+  +  +  S
Sbjct: 403 --GSSIRSRVTDNHNEKGHDLHGEQIQHGF----FAMNGSINHSLAA--SIASSGNEALS 454

Query: 494 NRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQL 553
           ++S  LTTSANL EAR+P YRR FSDELS+LT+TFNTMTDALDQHYALLE+RVRART+QL
Sbjct: 455 DKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQL 514

Query: 554 XXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGX 613
                        KTVFIANISHELRTPLNGILGMTAISMEE D++KI+NSLKLIFRSG 
Sbjct: 515 EAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGE 574

Query: 614 XXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLI 673
                      FSKNVL+RTKLEKR+F +TDVALQIKSIFGKVAKDQRVRLSI+L+PNLI
Sbjct: 575 LLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLI 634

Query: 674 RTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKK 733
           RTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V M LLGEYD E SE + +K+VY+  
Sbjct: 635 RTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIP 694

Query: 734 GTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIY 793
           GTE   N E  DK  +      ++   +E++     SN   S+ +   T+     N++  
Sbjct: 695 GTEPKGNDE-KDKGGI----EEKERFSIENTPNDTSSN---SSNKHSDTETTPGLNDTDE 746

Query: 794 KKVND-----REKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPIENP 848
           K+ +D      E   + D           Y++ +F+SQF K P   D+    LG  +++ 
Sbjct: 747 KQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELGVEVKDK 806

Query: 849 KTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM 908
           K WVISI VEDTGPGID SL ESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM
Sbjct: 807 KKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM 866

Query: 909 KLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960
            L+SK+GVGS+FTFT+PL QT+EI+F D+   FEDEFNP+S+KNR+VKF +A
Sbjct: 867 DLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIA 918

 Score =  241 bits (615), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/166 (69%), Positives = 135/166 (81%), Gaps = 6/166 (3%)

Query: 1055 SVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIEN 1114
            SV LDRPFLQSTGTA+S+ N+ T        T  KILV EDN VNQEVIKRMLNLEG+ N
Sbjct: 955  SVRLDRPFLQSTGTASSNTNLGTTS------TINKILVAEDNDVNQEVIKRMLNLEGVHN 1008

Query: 1115 IELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTA 1174
            IEL CDGQEA DKVK+L   GE+YN+IFMDVQMPK+DGLLSTKMIRRDL YT PIVALTA
Sbjct: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068

Query: 1175 FADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKNNK 1220
            FADDSNI+ECL++GM+GFL+KPIKR +L+ I+ EFC   Q ++ +K
Sbjct: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDK 1114

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1233 (47%), Positives = 749/1233 (60%), Gaps = 162/1233 (13%)

Query: 1    MRFG-LPSKLE-LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRL 58
            MR G L  +L  L PPF+ G+RTQLT LV I+AL SLIILA TTGVYFTSNY+ LR+DRL
Sbjct: 1    MRLGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRL 60

Query: 59   YIAAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLS 118
            ++AA+L SSQ+DQ+L           ++D +Q++L+ Y AGN+SA+NW+++  ++  FL 
Sbjct: 61   HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE 120

Query: 119  SSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDP 178
             S  FY+A +YD  +  VL+  NN T   + E+ L  L PL  D    +    + + T P
Sbjct: 121  RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP 180

Query: 179  VLNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIIS 238
              N T  LMSM+LP+ A  S I+    V G++TI+MSA+ + +V NDT+ L  S ++I++
Sbjct: 181  -YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILT 236

Query: 239  AVYNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNIL---- 294
             + N +G    Y FVFPP  +   + +  + IKN +F+  AF N     +  T+      
Sbjct: 237  GIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFG 296

Query: 295  ----STRNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLT 350
                  +  A+GYS C F  ++WVA+VSQ ESVFLSPA KL KII GTV+ + VF+ ++T
Sbjct: 297  ALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVT 356

Query: 351  LPLAHWAVQPIVRLQKATELITEGRGLRP--STPRTISRASSFKRGFSSG--FAVPSSLL 406
              LA WAV+PIVRLQKATE I  GRGLR    + R+ S+ +S  R  S G   ++P  L 
Sbjct: 357  FILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELF 416

Query: 407  QFNTAEXXXXXXXXXXXXXXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDA 466
            +                                          +SP   EN   N+ + +
Sbjct: 417  E--------------------------------------KKHHVSPFVTENHAANSGSCS 438

Query: 467  KISMDGSLNHDLLGPHSLRHNDTDRSSNRSHIL-------TTSANLTEARLPDYRRLFSD 519
             +S     +H+    H  R++D + S+N   IL       T++ N  + R+P YRRLF+D
Sbjct: 439  SMS-----DHERYLHHIARYHDGETSTN---ILSDHEKGSTSATNWIDTRVPVYRRLFTD 490

Query: 520  ELSDLTETFNTMTDALDQHYALLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELR 579
            ELS+LT+TFNTMTD LD+ Y +LE+RVRARTKQL             KTVFIANI HELR
Sbjct: 491  ELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELR 550

Query: 580  TPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRD 639
            TPLNGILGMTAI+M E D  KI+NSLKLIFRSG            FSKNVL+RTKLE+R 
Sbjct: 551  TPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERH 610

Query: 640  FCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKF 699
            F I D+ALQ+KSIFGK+AKDQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKF
Sbjct: 611  FSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKF 670

Query: 700  TPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSV 759
            TPVDG VDVR+KL+GEYD   SE   + EVYI  GTEVT     +   ++PT+       
Sbjct: 671  TPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVT----NSSVNNIPTV------- 719

Query: 760  DLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYD 819
                              +E+  +    A+++  +K  D E   + D           YD
Sbjct: 720  ---------------VEEEEKACEEEPTADDTPERKKKDSETVDDADAISISSSVATSYD 764

Query: 820  NAIFNSQFNKAPGSDDEEGGN---LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPF 876
            +A+ ++Q  K P   D E  +       +E P++WVI IEV+DTGPGI+PSL ESVF PF
Sbjct: 765  DAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPF 824

Query: 877  VQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFAD 936
            VQGDQTLSRQYGGTGLGLSICRQLA MM GTMKLESKVG GSKFTFT+PL QT  + F D
Sbjct: 825  VQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFND 884

Query: 937  MEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKH 996
             +  FEDEFN  S+KNR+VKF + +S KSR                          KGK 
Sbjct: 885  GDTLFEDEFNIFSKKNRKVKFQLNRSGKSR--------------------------KGK- 917

Query: 997  ETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEG-LGS 1055
                           N++ G   + E  I+                 S  +S  E   GS
Sbjct: 918  --------------MNNSNGAGSIAESAIE-----------------SFGKSESEASFGS 946

Query: 1056 VNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENI 1115
            V +DRPFLQSTGTATS+R++PT+      E+S++ILV EDN+VNQEVIKRML+LEG  NI
Sbjct: 947  VRVDRPFLQSTGTATSTRSVPTLS---SAESSLRILVAEDNNVNQEVIKRMLHLEGAHNI 1003

Query: 1116 ELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAF 1175
            +LACDG++A+ KV  L  +GE+Y++IFMDVQMP++DGLL+TK++R+ L Y  PIVALTAF
Sbjct: 1004 DLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAF 1063

Query: 1176 ADDSNIKECLESGMNGFLSKPIKRPKLKTILTE 1208
            ADDSNIKECLESGMN FL+KPIKRP LK IL E
Sbjct: 1064 ADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1009 (51%), Positives = 677/1009 (67%), Gaps = 91/1009 (9%)

Query: 3   FGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62
            G  +K +L PPF I IRTQLTALV +VAL SLIILAV TGVYFTS++K++R++RLY+A+
Sbjct: 9   LGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVAS 68

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNL 122
           QLK+SQIDQ L           +RD LQ++LT Y+AGN + +NW D+++ + KFL SSNL
Sbjct: 69  QLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNL 128

Query: 123 FYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNS 182
           F +A+VYDSSF  VLNA+NN +G+L+PE VL  LFPLST+  LPSSLE  G+LTDPVLN 
Sbjct: 129 FSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLND 188

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYN 242
           T YLMSMSLPIFANPSIIL+ S+VYGYIT+++SAEGLK+VFNDTTALE S++ ++S VY+
Sbjct: 189 TGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD 248

Query: 243 SQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALG 302
           ++ + +GYH VFPPYG  SD+  K ++I ND+F+  AF+  KGGS+K T+ L ++  A+G
Sbjct: 249 NR-ELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIG 307

Query: 303 YSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           YSPCS +LV WVAI++QPES FL P+T+LA+II GT +AI V    +T PL+HWAVQPIV
Sbjct: 308 YSPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIV 367

Query: 363 RLQKATELITEGRGLRPSTPRTI--SRASSFKRGFSSGFAVPSSLLQFNTAEXXXXXXXX 420
           RLQKATE+IT GRGLR     T+   + SS    FSS    P+S+ +             
Sbjct: 368 RLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALH-PASIRR------------- 413

Query: 421 XXXXXXXXXXXXXXXXXXMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHD--- 477
                                ++   ++    PE      N +   +I  DG  N++   
Sbjct: 414 -------------------SGSVARSSKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAA 454

Query: 478 LLGPHSLRHND--TDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDAL 535
           L   HS       +++ S RS    TS NL EAR+P Y RLFSDELS+LTETFNTMTD L
Sbjct: 455 LQKVHSPTPGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDEL 514

Query: 536 DQHYALLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEE 595
           D+HYALLE+RVRART+QL             KTVFIANISHELRTPLNGILGMTAI+M E
Sbjct: 515 DRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAE 574

Query: 596 TDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGK 655
            D+ K+++SLKLIFRSG            FSKNVL+RTKLE+RDF + ++ALQ++SIFGK
Sbjct: 575 NDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGK 634

Query: 656 VAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGE 715
           +AKDQ V L+IS+ PN++RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+  LLGE
Sbjct: 635 LAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGE 694

Query: 716 YDKELSEKKQYKE---VYIKKGTEVTENLETTDKYDLPTLSNHRKSVDL------ESSAT 766
           YD+  +    +     V I++  + +  L  T+K  +  ++    S +        +S T
Sbjct: 695 YDESKASNGCFDRAAVVPIQESEKESSTLGPTEKGGIKDVTESASSSNATWPPSPSTSET 754

Query: 767 SLGSNRDTST----------------------------------IQEEITKRNTVANESI 792
           S GS  +T++                                   + E++ ++   NE+ 
Sbjct: 755 SNGSKAETTSGKLTESSEEDEKEEKLDHDDKDEGDEESEEEEYRGEAEVSGKDDTNNETQ 814

Query: 793 YKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWV 852
            +  N+ +   N+D           YD+AIF+S+  K    ++E+    GRP+E+P+   
Sbjct: 815 REDSNENQ---NEDARSIESENASSYDDAIFHSRLRKGNSGENED----GRPLEHPRRLA 867

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLES 912
           I++EV+DTGPGI+P+LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MM+G+M L+S
Sbjct: 868 IAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDS 927

Query: 913 KVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAK 961
           KVGVGSKFTFT+PL QTKE+ F + E PFEDEFNP+S+KNR+VKF V+K
Sbjct: 928 KVGVGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKVSK 976

 Score =  231 bits (590), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/171 (62%), Positives = 138/171 (80%), Gaps = 7/171 (4%)

Query: 1053 LGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGI 1112
            +GSV +DRPFLQSTGTA S+R++ T    +K     K+LV EDN+VNQEVIKRMLNLEG+
Sbjct: 1006 VGSVRVDRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVIKRMLNLEGL 1061

Query: 1113 ENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1172
            ++++LACDGQ+AFDKVK     G+ Y++IFMDVQMP+VDGL +T+MIR +L YT PIVAL
Sbjct: 1062 DDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVAL 1121

Query: 1173 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY---QGKKNNK 1220
            TA+ADD NIKEC+++GMNGFL+KPI+RPK+K IL+E+C  Y    G+K  K
Sbjct: 1122 TAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/776 (59%), Positives = 539/776 (69%), Gaps = 48/776 (6%)

Query: 455  EENKIP--NNHTDAKISMDGSLNHDLLGPH-SLRHNDTDRSSNRSHILTTSANLTEARLP 511
            E+N  P  ++ +D+  + DGSL+HDL     S R +D DRSS+RS  LTTS NL EARLP
Sbjct: 415  EKNHRPAYDSASDSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLP 474

Query: 512  DYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLXXXXXXXXXXXXXKTVFI 571
            DYRRLFSDELSDLT TFN MTDALDQHYALLE+RVRARTKQL             KTVFI
Sbjct: 475  DYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFI 534

Query: 572  ANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQ 631
            ANISHELRTPLNGILGMTAISMEETD+ KIRNSLKLIFRSG            FSKNVL+
Sbjct: 535  ANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLK 594

Query: 632  RTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMN 691
            RT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSISL PN+IRTMVLWGDSNRIIQIVMN
Sbjct: 595  RTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMN 654

Query: 692  LVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPT 751
            LVSNALKFTPVDG V+VR+KLLGEYD+E ++   +K+++          +  +D +    
Sbjct: 655  LVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIH---------TIADSDAHQQHP 705

Query: 752  LSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASN-----DD 806
            +S+    V        L  +  TS+        +   NE  Y + +D    +N     DD
Sbjct: 706  VSSSPNGV--------LVKHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDD 757

Query: 807  XXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDP 866
                       YDNA+FN+QF K P   ++    LG  + + KTWV +IEVEDTGPGIDP
Sbjct: 758  LSSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDP 817

Query: 867  SLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPL 926
             L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKLESKVGVGSKFTFT+PL
Sbjct: 818  KLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPL 877

Query: 927  NQTKEISFADMEFPFEDEFNPESRKNRRVKF-SVAKSIKSRQSTSSVATPATNRSSLTND 985
             QT+ I F + E  FEDEFNPES+KNRRVKF    +S+ SR+S +SV         +TN 
Sbjct: 878  KQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDSTRSLHSRRSRTSV-------DRITNH 930

Query: 986  VLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSK 1045
               +  S+G   +  +       E K+++  +EQ  E +  P +   G E + + S SS 
Sbjct: 931  SGDKQSSEGHSTSFKIS------EVKDED--IEQSPEPDNLPKV---GDENDSKASSSSS 979

Query: 1046 HRSR-HEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIK 1104
                  E    V+LDRPFLQSTGTATSSRN+PT+ D        KILV EDNHVNQEVIK
Sbjct: 980  KSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPTMAD---VTMRFKILVAEDNHVNQEVIK 1036

Query: 1105 RMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLG 1164
            RMLNLEGI NI+LACDGQ+AFDKV+ L  + ++Y+MIFMD+QMPKVDGLLSTKMIRRDL 
Sbjct: 1037 RMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLN 1096

Query: 1165 YTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKNNK 1220
            Y   IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKLK IL E+C  +   K +K
Sbjct: 1097 YKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSK 1152

 Score =  534 bits (1376), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 255/369 (69%), Positives = 297/369 (80%)

Query: 11  LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
           L PPFRIGIR QLTALVSIVA  SLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ+D
Sbjct: 14  LKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLD 73

Query: 71  QTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYD 130
           Q LN          SRD LQ++L SYVAGNK+ +NW +S +VIQKFLSSSNLF++++VYD
Sbjct: 74  QNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYD 133

Query: 131 SSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMS 190
             F  VLN TNNGTGD +PE + + LFPLSTD PLPSSL T G+LTDPVLN TDYLMSMS
Sbjct: 134 YDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMS 193

Query: 191 LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGY 250
           LPIFANPSII +D +VYGYIT++MSAEGL+SVFNDTTALE S +AI+SA Y++  K   Y
Sbjct: 194 LPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSY 253

Query: 251 HFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNL 310
            FVFPPYG    +  + F + + +F++ AF+  KGGS+K+T    T++ A+GY PCSFN 
Sbjct: 254 RFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNF 313

Query: 311 VNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATEL 370
           VNWVA+VSQ ESVFLSP+TKL KII+GTV+ I VFV LLT PLA WAV+PIVRLQKATEL
Sbjct: 314 VNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATEL 373

Query: 371 ITEGRGLRP 379
           I EGRGLRP
Sbjct: 374 IAEGRGLRP 382

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/713 (57%), Positives = 481/713 (67%), Gaps = 67/713 (9%)

Query: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLXXXXXXX 560
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLE+RVRARTKQL       
Sbjct: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEA 515

Query: 561  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXX 620
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ +LKLIFRSG        
Sbjct: 516  EAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILT 575

Query: 621  XXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWG 680
                FSKNVL+RT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 576  ELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635

Query: 681  DSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEV-TE 739
            DSNRIIQIVMNLVSNALKFTP+DG VDVR+KLLGEYD+E S    YKEVYIK GTE+   
Sbjct: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG 695

Query: 740  NLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDR 799
            N + TD          +K  +L       G    + +     +K + +  +      +D 
Sbjct: 696  NGKKTDMV-------RKKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDN 748

Query: 800  EKASND-DXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVE 858
            E  +ND +           YD+A    QF K P  DD+E   LG  +  PKTWVIS+EVE
Sbjct: 749  EDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKE-ETLGVELSEPKTWVISVEVE 807

Query: 859  DTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGS 918
            DTGPGI+P LQE+VF PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGTMKLES VGVGS
Sbjct: 808  DTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGS 867

Query: 919  KFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATN 978
            KF FT+PL QT+EI F D +  FEDEFN ES+KNRR+KF +  S KS  S          
Sbjct: 868  KFIFTVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHDS---------- 915

Query: 979  RSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNE 1038
                 ND   E    G   ++D+ + N   E K++NG                       
Sbjct: 916  -----NDEDEE----GIKSSRDIDSSN--NEHKDENGT---------------------- 942

Query: 1039 QNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTV--KDDDKNETSVKILVVEDN 1096
                S  + S+      V LDRPFLQSTGTATSS+ IPT+  K+D   E S++ILV EDN
Sbjct: 943  ----SPDNHSK------VRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDN 992

Query: 1097 HVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLST 1156
            HVNQEVIKRMLNLE I+NI+LACDGQ+AFDKVK L    E Y++IFMDVQMPKVDGL+ST
Sbjct: 993  HVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVST 1052

Query: 1157 KMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            KMIR+DL Y  PIVALTAFA+D NIKECL++GM+GFL KPIKRPKLK IL E+
Sbjct: 1053 KMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

 Score =  491 bits (1265), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 240/370 (64%), Positives = 295/370 (79%), Gaps = 3/370 (0%)

Query: 13  PPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72
           PP+RI IR QLTALVS+VA+ SLIILAVTTGVYFT NYK LRS RL IAA+LKSSQIDQT
Sbjct: 11  PPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQIDQT 70

Query: 73  LNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSS 132
           LN          SRD LQ++L +Y AGNK+ +NW++S +V+QKFLSSS+LFYVA++YD +
Sbjct: 71  LNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDLN 130

Query: 133 FNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLP 192
           F  V+NATNNGTGDLIP +VL  LFPLST+  LPSSL   GILTDPVLN + YLMSMSLP
Sbjct: 131 FKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSLP 190

Query: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHF 252
           I  NPSIIL+ SRVYGYITI+MSA+GLK+V+ + TALE+S + +ISA+YN QGK  G+HF
Sbjct: 191 ILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFHF 250

Query: 253 VFPPYGSRSDLPQKV-FSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLV 311
           VF       D    + + I+N T++SSA   GK GS+K+T     R  A+GYSPCSF+L 
Sbjct: 251 VFEV--ENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLS 308

Query: 312 NWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELI 371
           NWVA+V+QPE+VFLSP+TKL KII+GTV+AI VFV L+T PL+HWAV+PIVRLQKATELI
Sbjct: 309 NWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELI 368

Query: 372 TEGRGLRPST 381
           ++GRGL+P++
Sbjct: 369 SQGRGLKPTS 378

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/773 (53%), Positives = 491/773 (63%), Gaps = 96/773 (12%)

Query: 503  ANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLXXXXXXXXX 562
            + + E ++P YRRLF DELS+LT+TFNTM+DALDQHYALLEERVRARTKQL         
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 563  XXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXX 622
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I++SLKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 623  XXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDS 682
              FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 683  NRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLE 742
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDKE S+   YKEV++K GTE  EN  
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 743  TTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE---ITKRNTVANESIYKKVNDR 799
                  L  L N  K +   S+ +     R    I E+   I+  +  +N +    +++R
Sbjct: 712  KI----LQKL-NTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766

Query: 800  EKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVED 859
             +   DD           YD  +FN QF K  G  D +   LG  I+ PKTWVI IEVED
Sbjct: 767  TR---DDTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVED 823

Query: 860  TGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSK 919
            TGPGI P+LQESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM LESKVG GSK
Sbjct: 824  TGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSK 883

Query: 920  FTFTLPLNQTKEISFA---DMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPA 976
            FTFT+PL QT+EI      D+   F+DEFN  S+KNR+VKF++               P+
Sbjct: 884  FTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAI---------------PS 928

Query: 977  TNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEV 1036
            +  ++L N  L   +SKG   +  VG                ++Q  N          ++
Sbjct: 929  SPGTTLANSSLKSRKSKGSLNSSFVG----------------EIQNVNEAEEDAYNSKDI 972

Query: 1037 NEQNSLSSKHRSRHEGLGSV--NLDRPFLQSTGTATSSRNIPTVKD-------------D 1081
            N    L  +H S      +   +LDRPFLQSTGTATS+  IP +KD             +
Sbjct: 973  NSSGELKIRHISTSTSNNNSIPSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDE 1032

Query: 1082 DKNETSVK-------------------------------ILVVEDNHVNQEVIKRMLNLE 1110
             K++ S K                               ILV EDNHVNQEVIKRML LE
Sbjct: 1033 GKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLE 1092

Query: 1111 GIENIELACDGQEAFDKVKELTS-----KGENYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1165
             + NI+LACDG+EA+ KVKE+TS     K   Y++IFMDVQMP++DGL STK+IR +L Y
Sbjct: 1093 KLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKY 1152

Query: 1166 TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKN 1218
            T PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKLK IL EFC  Y  + N
Sbjct: 1153 TKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYHLQNN 1205

 Score =  491 bits (1265), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 239/385 (62%), Positives = 295/385 (76%), Gaps = 1/385 (0%)

Query: 11  LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
           L PP  IGIRTQLTALV  VA  SLIILAV TG+YFT NYK++R DRL IAA+LKSSQ+D
Sbjct: 11  LRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVD 70

Query: 71  QTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYD 130
           QTLN           RD LQ+++ +Y AGNKS+  W DS  V++KFLSSS++F ++++YD
Sbjct: 71  QTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYD 130

Query: 131 SSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMS 190
           ++FN V+NATNNGTG+++P DVL  L PLS+  PLP+SL + G+LTDPVLNST YLMSMS
Sbjct: 131 ANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLMSMS 190

Query: 191 LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKA-SG 249
           LPI ANPSIILTDS+VYGYITIIMSAE L SV+NDTTALE S +AI+S  Y+    + + 
Sbjct: 191 LPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTE 250

Query: 250 YHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFN 309
           YHFVFPPYG+   +    + ++N +F+  A  N K GS+ +T      + A+GYSPCSF+
Sbjct: 251 YHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFD 310

Query: 310 LVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATE 369
           LV+WVAIVSQPESVFLSP+TKL +II GTV+AI VFV  +T PL+HWAV+PIVRLQKATE
Sbjct: 311 LVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATE 370

Query: 370 LITEGRGLRPSTPRTISRASSFKRG 394
           LI EGRGLR S+ RT+SR  S K G
Sbjct: 371 LIAEGRGLRSSSNRTLSRNGSLKFG 395

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/744 (54%), Positives = 495/744 (66%), Gaps = 78/744 (10%)

Query: 483  SLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALL 542
            S+  N  D  S+ S    TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQHY LL
Sbjct: 450  SMGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLL 509

Query: 543  EERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIR 602
            EERVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE DV+KIR
Sbjct: 510  EERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIR 569

Query: 603  NSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRV 662
             +LKLIFRSG            FSKNVLQRTKLEKRDFCIT+VALQIKSIFGK+AKDQ V
Sbjct: 570  GNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHV 629

Query: 663  RLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSE 722
            +LSI L PN++R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ LLGEYD+E S+
Sbjct: 630  KLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSK 689

Query: 723  KKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNR-DTSTIQEEI 781
             + YK+VY+K+GTE+  N+       L T  N+  S     S T L ++  +T TI ++ 
Sbjct: 690  AEDYKKVYVKQGTELPLNIS-----HLKTEENNDIS---RKSETELNNDENETHTISKDD 741

Query: 782  TKRNTV--ANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGG 839
            T  +++   NE +  ++++ +K                YD+     Q  K+   DD+E  
Sbjct: 742  TADSSIKIGNEDV--EISEVDKMG---MASLVTTSSKSYDDTALMKQLIKSTDLDDDEN- 795

Query: 840  NLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQ 899
             LG  ++  KTWVIS+EV+DTG GIDP LQESVF PFVQGDQ LSRQYGGTGLGLSIC+Q
Sbjct: 796  KLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQ 855

Query: 900  LANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSV 959
            L+ MM+GTM+LES+VGVGSKF FTLPL QT+EIS  D E  F DEFN  S+KNR+VKF  
Sbjct: 856  LSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNRKVKFKF 914

Query: 960  AKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQ 1019
            + S     S  S+ T  +  SSL N          +H T  + + +            + 
Sbjct: 915  SGS----SSAKSIKTRNSIGSSLNN----------RHSTTSIDSSSS-----------DS 949

Query: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTV- 1078
             +E N++PS                          SV L+RPFLQSTGTATS++N+PT+ 
Sbjct: 950  DEEDNVRPS--------------------------SVRLNRPFLQSTGTATSTQNVPTLN 983

Query: 1079 -KDDDKNETSV-------KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKE 1130
               DDK++  V        ILV EDNHVNQEVIKRML LEGI NI+LA DGQ+AFDK K 
Sbjct: 984  AHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKM 1043

Query: 1131 LTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMN 1190
            L+    NY++IFMDVQMP++DGL +TKMIR +L YT PIVAL+AF  + N+KECL+ GMN
Sbjct: 1044 LSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMN 1103

Query: 1191 GFLSKPIKRPKLKTILTEFCAAYQ 1214
             FLSKPIKRP LK IL ++   +Q
Sbjct: 1104 DFLSKPIKRPDLKIILKKYIEDFQ 1127

 Score =  454 bits (1167), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 238/405 (58%), Positives = 302/405 (74%), Gaps = 5/405 (1%)

Query: 5   LPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 64
           +P K    PP+RI IR QLTALVS+VA+ SLIILAVT GVYFT+NYKNL++ RLYIAAQL
Sbjct: 4   IPKKF-WKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQL 62

Query: 65  KSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFY 124
           K+SQIDQTLN          S + LQ+SL SY AGN S+ NW +S  V++KFL+SS+LF 
Sbjct: 63  KASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFS 122

Query: 125 VAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTD 184
           VA++YD++FN ++NATNN +G+ +PE V+D LF LS +  LPSSLETIGI TDPVLN ++
Sbjct: 123 VARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSN 182

Query: 185 YLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQ 244
           +LMSMSLPIFANPSIIL+DSR+YGY+++IMSAEGLKSVFNDTTALE+S + +ISA Y+  
Sbjct: 183 FLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSIT 242

Query: 245 GKASGYHFVFPPYGSRSDLPQKV-FSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGY 303
                ++F+F      +D    + + I NDTF+ +   NGKGG++K+TN       A+GY
Sbjct: 243 TNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGY 302

Query: 304 SPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVR 363
           S CSF+LVNW+AIV+QPE+ F   ATKL +II+G V+A+ VFV LLT PL+HWAVQP++R
Sbjct: 303 SSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIR 362

Query: 364 LQKATELITEGRGLRPSTP---RTISRASSFKRGFSSGFAVPSSL 405
           LQKATE I EGRGLRP  P    ++SR SS K   S    V SSL
Sbjct: 363 LQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL 407

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/756 (53%), Positives = 488/756 (64%), Gaps = 106/756 (14%)

Query: 490  DRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRAR 549
            D SS  S     S NL EA +P YRR F DELS+LT+TFNTMTD LD+HYALLEERVRAR
Sbjct: 476  DSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRAR 535

Query: 550  TKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIF 609
            TKQL             KTVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIF
Sbjct: 536  TKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIF 595

Query: 610  RSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLF 669
            RSG            FSKNVL+RTKLE+RDF + D+ALQIKSIFGK+AKDQ V+LSI+L 
Sbjct: 596  RSGELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALT 655

Query: 670  PNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEV 729
            PN IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KLLGEYD + SE   Y+EV
Sbjct: 656  PNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEV 715

Query: 730  YIKKGTEVTENLE-----------------------TTDKYDLPTLSNHRKSVDLESSAT 766
            ++  G+E  ++ E                       T D    PT      S+ +ES  +
Sbjct: 716  FVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETS 775

Query: 767  SLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQ 826
            + G++ D S+I   + +     NE      +++EK S              YD+AIF+SQ
Sbjct: 776  TEGNDNDESSI---VLESKHEENE------DEKEKMS-----ILSTSTSSSYDDAIFHSQ 821

Query: 827  FNKAPGSDDEEG-GNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSR 885
            F K   S D +   N  R ++ PKTWVIS+EVEDTG GIDPSLQESVF PFVQGDQTLSR
Sbjct: 822  FKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSR 881

Query: 886  QYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEF 945
            QYGGTGLGLSICRQLA MM GTMKL+SKVGVGSKF FT+PL QTKEI F   E  FEDEF
Sbjct: 882  QYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEF 941

Query: 946  NPESRKNRRVKFSV---AKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKD-V 1001
            N  SRKNR+VKF +    KS+++++S SS+   + N  S           K  + T++ V
Sbjct: 942  NIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVS---------ERKASNSTENSV 992

Query: 1002 GNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRP 1061
            GN  + R                  P +  TG                            
Sbjct: 993  GNVRVDR------------------PFLQSTG---------------------------- 1006

Query: 1062 FLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDG 1121
                T T+T  R+I +V  +    T  ++LV EDN+VNQEVIKRML LEG+ ++++ACDG
Sbjct: 1007 ----TATST--RSISSVASE---VTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDG 1057

Query: 1122 QEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNI 1181
            QEA++KV+E+   GE+Y+MIFMDVQMP+VDGLL+TKMIR DL Y  PIVALTA+ADDSNI
Sbjct: 1058 QEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNI 1117

Query: 1182 KECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKK 1217
            K CLESGM+GFL KPIKRP LK I+ ++C+  + ++
Sbjct: 1118 KVCLESGMDGFLPKPIKRPLLKKIIAQYCSKKEKQR 1153

 Score =  454 bits (1168), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/368 (59%), Positives = 276/368 (75%)

Query: 11  LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
            TPPF +G+RTQL  LV  + + SL I+ VTTGVYFT+NYK++R++RL +AAQLKSSQ+D
Sbjct: 18  FTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVD 77

Query: 71  QTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYD 130
           Q LN          +RD LQ +L ++ AGN S DNW  +   ++KFL SS LF  A+VYD
Sbjct: 78  QNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYD 137

Query: 131 SSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMS 190
           +SFN V+N+TNNG+GD IPE+VL  LFPLS   PL SSL T GI+TDPV N T+YL+SMS
Sbjct: 138 TSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMS 197

Query: 191 LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGY 250
           LP+  NPSIIL  + + GYIT+I SAE LK+V NDT AL+ S+++I+SAV++S    +GY
Sbjct: 198 LPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGY 257

Query: 251 HFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNL 310
           HFVFPP+G+ S   +  F IKN TFI+ AF NGK GS+ +TN++  RN A+GYSP +F L
Sbjct: 258 HFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKL 317

Query: 311 VNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATEL 370
           VNWVA+V+QPE VFLSP  +L KII GTV AI VF+ LLT P+AHWAVQPIVRLQKATE+
Sbjct: 318 VNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEI 377

Query: 371 ITEGRGLR 378
           IT GR L+
Sbjct: 378 ITSGRDLK 385

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/723 (51%), Positives = 462/723 (63%), Gaps = 96/723 (13%)

Query: 493  SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQ 552
            S R    TTSAN  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLE+RVRARTKQ
Sbjct: 469  SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQ 528

Query: 553  LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612
            L             KT+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG
Sbjct: 529  LEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG 588

Query: 613  XXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672
                        FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PNL
Sbjct: 589  ELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNL 648

Query: 673  IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIK 732
            IR MVLWGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD+E SEK    EV+IK
Sbjct: 649  IRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIK 708

Query: 733  KGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE--ITKRNTVANE 790
            +GTE+++  ET + +D                           TI EE  ++      ++
Sbjct: 709  QGTEISD--ETKNVFD---------------------------TITEEKYVSCSGESTDD 739

Query: 791  SIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNL---GRPIEN 847
            +I       +K    D           YD+AIF+S+F K P   D + G+L   G+  E 
Sbjct: 740  TIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EK 798

Query: 848  PKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 907
             K WVISIEVEDTGPGIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GT
Sbjct: 799  KKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGT 858

Query: 908  MKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQ 967
            MKL S+VGVGSKF FT+PL QT  +   D E  FEDEFN +S+ NRRVKF + K  KSRQ
Sbjct: 859  MKLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQ 918

Query: 968  STSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKP 1027
            S+ SV               PE+         D    +MGR E   +    ++     +P
Sbjct: 919  SSLSV---------------PEISG-----VPDSPLNSMGRSESELSVSSVRVD----RP 954

Query: 1028 SICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETS 1087
             +  TG   + ++                      + + G+  S+  +   +D++ N+  
Sbjct: 955  FLQSTGTATSTRS----------------------IPTVGSLESNFKVLVAEDNNVNQEV 992

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            +K               RML LEGI +IELACDG+EA +KV  LT++ ++YN++FMDVQM
Sbjct: 993  IK---------------RMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQM 1037

Query: 1148 PKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1207
            PK+DGL++T+ IR++L YT PIVALTAFADDSNIK CLESGM+GFLSKPIKR KL+ IL 
Sbjct: 1038 PKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILL 1097

Query: 1208 EFC 1210
            E+C
Sbjct: 1098 EYC 1100

 Score =  336 bits (861), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 187/368 (50%), Positives = 257/368 (69%), Gaps = 5/368 (1%)

Query: 13  PPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72
           PP++ G+ TQLT LV I+AL SLIILAVTTGVYFT+NYK+LR+DRL +AAQL S+QI+QT
Sbjct: 25  PPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQINQT 84

Query: 73  LNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSS 132
           LN          SRD++Q++L SY  GN S+ N  ++  V+ KFL SSN  +   +YDS+
Sbjct: 85  LNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYDSA 144

Query: 133 FNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLP 192
           FN VL+ + N TG++I +D+L  L PLS+++PLPSS+   G+L++PV N + + MSMSLP
Sbjct: 145 FNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMSMSLP 204

Query: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHF 252
           + A  SI+   S   GYIT++MSA+ + SV     AL  ST+++++ VY+     + Y  
Sbjct: 205 VSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSYQV 264

Query: 253 VFPPYGSRSDLP---QKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFN 309
           +FPP  S   +P   + VF I N++F+ +AF N   GS+ +TN     N A+GY+ CSF 
Sbjct: 265 LFPP--SIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFK 322

Query: 310 LVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATE 369
           LVNWVA+V+Q E+VFLSP+TKL KII GTVI I  F+ ++T  +A+WAV+PIVRLQKATE
Sbjct: 323 LVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATE 382

Query: 370 LITEGRGL 377
           LI  GRGL
Sbjct: 383 LIAAGRGL 390

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/496 (65%), Positives = 374/496 (75%), Gaps = 11/496 (2%)

Query: 493  SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQ 552
            S +S  LTTSANL EAR+PDYRRLFSDELSDLT+TFNTMTDALDQHYALLE+RVRARTKQ
Sbjct: 514  STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573

Query: 553  LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612
            L             KTVFIANISHELRTPLNGILGMTAISMEETD++KIR+SLKLIFRSG
Sbjct: 574  LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633

Query: 613  XXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672
                        FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAKDQRV+LSI+L PN 
Sbjct: 634  ELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693

Query: 673  IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIK 732
            IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V++KL+GEYD+ LS K  +KEVY+K
Sbjct: 694  IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753

Query: 733  KGTEV---TENLETTDK-YDLPTLSNHRKSV-----DLESSATSLGSNRDTSTIQEEITK 783
            +GTE+   +  +E T++    P   N+  S      D  +S TS    +    + +E   
Sbjct: 754  QGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIA 813

Query: 784  RNTVANESIYKKVN-DREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPG-SDDEEGGNL 841
                 NE+     N D +  S  D           YD+AIFNSQF K+PG  DD+E  + 
Sbjct: 814  TKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDA 873

Query: 842  GRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLA 901
            G  IE+PKTWVI I VEDTGPGID +LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 874  GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLA 933

Query: 902  NMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAK 961
            NMMHGTMKL+S+VGVGS FTFT+PL QT+EI+F DME PFEDEFNPESRKNR+VKF +A+
Sbjct: 934  NMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKLAR 993

Query: 962  SIKSRQSTSSVATPAT 977
            SI+S++S +S  T  T
Sbjct: 994  SIRSKKSRASTVTFGT 1009

 Score =  556 bits (1432), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 268/390 (68%), Positives = 316/390 (81%), Gaps = 2/390 (0%)

Query: 5   LPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 64
           +P K  L PPFRIGIR QLTALVSIVA  SL+ILA+TTGVYFT+NYKNLRSDRLYIAAQL
Sbjct: 3   IPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQL 62

Query: 65  KSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFY 124
           KSSQIDQTLN          SRD LQ +LT+YVAGNKS +NW DS S++QKFLSSSNLF 
Sbjct: 63  KSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFS 122

Query: 125 VAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTD 184
           VAKVYD+SF  VLN TNNGTGD IP+ +L  L PLST+ PL SSLET GILTDPVLNS+ 
Sbjct: 123 VAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSST 182

Query: 185 YLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQ 244
           YLMSMSLPIFANPS+IL +SRVYGY+T++MSAEGL++VFNDTTALE S +AI+SAVYN+ 
Sbjct: 183 YLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNV 242

Query: 245 GKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYS 304
              + Y FVF P G+ S +    + + N +F+SSA R GKGGSLK T    ++N A+GYS
Sbjct: 243 SALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYS 302

Query: 305 PCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRL 364
           PC+F+ VNWVA+VSQ ESVFLSP+TKLAKII GTV+AIGVFV ++T PLAHWAV+PIVRL
Sbjct: 303 PCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRL 362

Query: 365 QKATELITEGRGLRPSTP--RTISRASSFK 392
           QKATELI+EGRGL+ + P  R++SR +S K
Sbjct: 363 QKATELISEGRGLKSTNPDSRSVSRNNSLK 392

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/724 (48%), Positives = 441/724 (60%), Gaps = 115/724 (15%)

Query: 493  SNRSHILT-TSANLT------EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEER 545
            S+RS +L+ TS N          R+P +    +DEL++L ETFN M D+LD+H  LLEER
Sbjct: 446  SSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEER 505

Query: 546  VRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSL 605
            V+ARTK+L             KTVFIANISHELRTPLNGILGMTAI++EE D  K++ SL
Sbjct: 506  VKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSL 565

Query: 606  KLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLS 665
            KLI+RSG            FSKNVLQ+TKLEK  FCI D+ALQIKSIFGK+AKDQ V  S
Sbjct: 566  KLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFS 625

Query: 666  ISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQ 725
            I + PNLIRTMV +GDSNRIIQ++MNLVSNALKFTP+DG VDVR+KLLGEYD+E S    
Sbjct: 626  ILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNN 685

Query: 726  YKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRN 785
            Y +VYIK+GT       T D   +PT          E  +  +     +S+I +  +K  
Sbjct: 686  YDKVYIKEGTSF-----TGDNDAIPT----------EPISDKISFAGGSSSIHDYCSK-- 728

Query: 786  TVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPI 845
            T  N++I  ++   +   +D             +N + +   NK PG +      LG PI
Sbjct: 729  TDENDNIKTEIKSDDSTISD----------YSEENIMGSYYENKNPGQE-----LLGVPI 773

Query: 846  ENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMH 905
              PK WVIS++VEDTGPGI P+LQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLA++MH
Sbjct: 774  PKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMH 833

Query: 906  GTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKS 965
            GTM+L+S  G+GSKFTFT+PL Q ++I F++ E  FEDEFN  S+KNR+V F   K + S
Sbjct: 834  GTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDK-VTS 892

Query: 966  RQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNI 1025
            R   S  A                                    EKND+           
Sbjct: 893  RGIPSKAA------------------------------------EKNDD----------- 905

Query: 1026 KPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNE 1085
                    A  N Q +L+++ +S+             L+ T    S  NI        ++
Sbjct: 906  --------ANTNGQTTLNAEAKSKT------------LKPTHITISEDNI--------DQ 937

Query: 1086 TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDV 1145
               K+L+VEDN VNQEVIKR+L LE I+ IE A DGQEA D VK+  S+ + +++IFMD+
Sbjct: 938  HDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDI 997

Query: 1146 QMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTI 1205
            QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SGMN FL+KPIKR +LK I
Sbjct: 998  QMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEI 1057

Query: 1206 LTEF 1209
            + EF
Sbjct: 1058 IKEF 1061

 Score =  399 bits (1025), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 271/373 (72%), Gaps = 1/373 (0%)

Query: 8   KLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           +L  +PP+ + +R QL  L  IV++ SL+IL+++TGVYFT+NYK+LR+++L+IAAQLKSS
Sbjct: 7   RLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSS 66

Query: 68  QIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAK 127
           Q+DQ+LN            D L  +L  Y +GNK+ +NWV+S+S +  FL+SS++F  A 
Sbjct: 67  QLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRAT 126

Query: 128 VYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLM 187
           +YD++F  + N +NNGTG  IP+D++  L PLS+D  LP+S+ TIG LTDPVLN+++YLM
Sbjct: 127 IYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLM 186

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVY-NSQGK 246
           S+SLPIF NPSIIL+DSRVYGY+TII  A  + +VFNDTTALE+S +AIISA Y NS   
Sbjct: 187 SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTY 246

Query: 247 ASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPC 306
           A GYHFVFPPYGS + +    + + N++F+  AF     GS+  T    +   A+GYS C
Sbjct: 247 ADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTC 306

Query: 307 SFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
           +F+L NWVA+VSQPESVF S   KL KII+GTV+ I   V  +T  ++++ V+PI++L++
Sbjct: 307 TFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQ 366

Query: 367 ATELITEGRGLRP 379
           ATELI+ GRGLRP
Sbjct: 367 ATELISRGRGLRP 379

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/496 (61%), Positives = 352/496 (70%), Gaps = 20/496 (4%)

Query: 466 AKISMDGSLNHDLLGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLT 525
            + S +GS N+D   P SL  N  + SS+R+    TS+NL EAR+P YR  FSDE S+LT
Sbjct: 417 GRASTEGSFNYDQAVP-SLNSN-AEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELT 474

Query: 526 ETFNTMTDALDQHYALLEERVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGI 585
           +TFNTMT+ALDQHYALLE+RVRARTKQL             KTVFIANISHELRTPLNGI
Sbjct: 475 DTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGI 534

Query: 586 LGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDV 645
           LGMTAISMEE D++KI++SLKLIFRSG            FSKNVLQRTKLEKRDF ITDV
Sbjct: 535 LGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDV 594

Query: 646 ALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGT 705
           A+QIKSIFGKVAKDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG 
Sbjct: 595 AVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGK 654

Query: 706 VDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSA 765
           V VRM+LLGEYDK+ SE + +K VY+  GTE  E     D    P +    K  DLE   
Sbjct: 655 VSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE-----DGLIPPPVKQFEKQEDLEKEK 709

Query: 766 TSLGSN-RDTSTIQEEITKRNTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFN 824
            S   N  + ST   E T  +         K  D +++  DD           YD+ IF+
Sbjct: 710 ISEKHNEEEASTSDSEKTNLD--------DKTPDSKRSDADDQVSLISISTSSYDDTIFH 761

Query: 825 SQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLS 884
           +QF K   S  +E G+L   +E+PK W IS+EVEDTGPGIDPSL ESVF PFVQGDQ LS
Sbjct: 762 TQFKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALS 818

Query: 885 RQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDE 944
           RQYGGTGLGLSICRQLA MM+GTMKL+SK+GVGSKFTFTLPL QT+EI F D E  FEDE
Sbjct: 819 RQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFED-ENAFEDE 877

Query: 945 FNPESRKNRRVKFSVA 960
           FNP S+KNR+VKF VA
Sbjct: 878 FNPLSKKNRKVKFKVA 893

 Score =  494 bits (1273), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (78%)

Query: 1   MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60
           MR G  +K + +PPFRI IRTQLTALVS+VAL SLIILAVTTGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYV 60

Query: 61  AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120
           AAQLKSSQIDQ LN          S+  LQ+SL +YV+GNK+  NWVDS SV+QKFLSSS
Sbjct: 61  AAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSS 120

Query: 121 NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180
            LF VA+VYD+ F  VLNATNNGTGD++ +DVL  L PLS++  LP+SLE+ G+LTDPVL
Sbjct: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180

Query: 181 NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TIIMSA+ LKSV++D TALE S++ I+SA+
Sbjct: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240

Query: 241 YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300
           Y        Y FVF PYG+   +  + + I N++F+S+A R GK GS ++T++   R +A
Sbjct: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300

Query: 301 LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
           +GYSPCSF  VNWVAI+SQ E+VF+ P+T+L KII G V+ IG FV + T PLAHWAVQP
Sbjct: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQP 360

Query: 361 IVRLQKATELITEGRGLRPSTP 382
           IVRLQKATE+ITEGRGLR  TP
Sbjct: 361 IVRLQKATEIITEGRGLRSGTP 382

 Score =  247 bits (631), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 137/158 (86%), Gaps = 3/158 (1%)

Query: 1053 LGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGI 1112
            +G+V+LDRPFLQSTGTA+SS+N+  V + +K   S +ILV EDNHVNQEVIKRML LEGI
Sbjct: 931  VGNVSLDRPFLQSTGTASSSKNVTVVSNVNK---SYRILVAEDNHVNQEVIKRMLTLEGI 987

Query: 1113 ENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1172
            + I+LA DGQ+AFDKVK L  KGE+Y +IFMDVQMPKVDGLL+TKMIR+DL Y  PIVAL
Sbjct: 988  DRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVAL 1047

Query: 1173 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1210
            TAFADDSNI+ CLE+GMNGFLSKPIKRPKLKTI+ ++C
Sbjct: 1048 TAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  485 bits (1249), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 251/473 (53%), Positives = 320/473 (67%), Gaps = 45/473 (9%)

Query: 485 RHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEE 544
           + N TD SS+ S  +    NL + ++P  RR   DELS+LTET+  MTDALD+H  LLE 
Sbjct: 431 KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEY 490

Query: 545 RVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604
           RV+ RTKQL             KTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I++S
Sbjct: 491 RVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSS 550

Query: 605 LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664
           LKLI+RSG            FSKNVL++TKLEK  FC+ D+ALQI+SIFGK++KDQ V+L
Sbjct: 551 LKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKL 610

Query: 665 SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKK 724
           SI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDG + V +KLLGEYDK+ S  +
Sbjct: 611 SIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAE 670

Query: 725 QYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKR 784
            YK+VY+K+                   SN  K   L     +L S++DT ++ + I+ +
Sbjct: 671 NYKDVYMKEIRN----------------SNGDKIKPL----MTLISSKDTMSVADNISNK 710

Query: 785 NTVANESIYKKVNDREKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRP 844
           +  +         D E+++N               N I++++F       D +   +G P
Sbjct: 711 SVAS---------DTERSTN---------------NTIYSNKFKNGSNFQDTDDA-IGVP 745

Query: 845 IENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMM 904
           ++  + WVIS+EVEDTGPGI+PSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLAN+M
Sbjct: 746 LDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLM 805

Query: 905 HGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKF 957
           HGTMKLES+VGVGSKF FT+PL QT+EI F   E  FEDEFN  S+KNR VKF
Sbjct: 806 HGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF 858

 Score =  423 bits (1088), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 263/363 (72%)

Query: 14  PFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73
           P+++ +RTQLT LV  VA+ SL+ILA++TGVYFT NY++LR  +LYIAA+LKSSQIDQT+
Sbjct: 13  PYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTI 72

Query: 74  NXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSF 133
           N           RD ++S+LT Y AGN+SA+NW  +  V+  FL SS +F    +YDS F
Sbjct: 73  NLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQF 132

Query: 134 NAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPI 193
           N +LN TNN T D IP+DVL  L PLS    LPS L T G+LTDPVLN + YLMSMSLPI
Sbjct: 133 NLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPI 192

Query: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFV 253
            ANPS+ L+DSRV+GY+T++MSAE +++V NDTTALE S +A+IS+   +      YHFV
Sbjct: 193 IANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYHFV 252

Query: 254 FPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNW 313
           FPP+G+  D+    + ++N TF+S AF + +GGS+ ++  L ++  A+GY PCSF L NW
Sbjct: 253 FPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLANW 312

Query: 314 VAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373
           V  VSQPE VF+S + KL KII GTVIAI VFV ++T PL+ W+VQPIVRLQKATE+I++
Sbjct: 313 VGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISK 372

Query: 374 GRG 376
             G
Sbjct: 373 RDG 375

 Score =  188 bits (477), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 3/134 (2%)

Query: 1077 TVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGE 1136
            ++K D KN    K+L+VEDN VNQ V+ RML LEGIEN  +ACDGQEA +K+KE+ S+GE
Sbjct: 909  SIKYDVKN---FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGE 965

Query: 1137 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1196
             Y ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KP
Sbjct: 966  YYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKP 1025

Query: 1197 IKRPKLKTILTEFC 1210
            IKR +LK ILTEFC
Sbjct: 1026 IKREQLKGILTEFC 1039

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  371 bits (952), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/430 (48%), Positives = 273/430 (63%), Gaps = 12/430 (2%)

Query: 507 EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLXXXXXXXXXXXXX 566
           E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE+RV  RTKQL             
Sbjct: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEA 541

Query: 567 KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFS 626
           KTVFIANISHELRTPLNGILGMT+ S+EE D+ KI++ LKLIFRSG            FS
Sbjct: 542 KTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFS 601

Query: 627 KNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP-NLIRTMVLWGDSNRI 685
           KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L I L P   +++++ +GDSNRI
Sbjct: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRI 661

Query: 686 IQIVMNLVSNALKFTP-VDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTE-VTENLET 743
           +Q++MNL+SNA+KFTP V+G V+V M LLGEYD+E S+ + Y +V IK  T+ VTE+ E 
Sbjct: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721

Query: 744 TDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEI-----TKRNTVANESIYKKVND 798
                   ++   KS    ++AT+  S R  S   + +     T   T  +     + N 
Sbjct: 722 IKSKIRCKIT---KSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNS 778

Query: 799 REKASNDDXXXXXXXXXXXYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVE 858
                N+            YDN +FN +  K  G  D         IE  K WVI  EV 
Sbjct: 779 NVSTVNNSSISLDSESSKMYDNLMFN-RLIKREGDGDINDIKALEQIEGNKKWVIRFEVI 837

Query: 859 DTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGS 918
           D GPGID +L +SVF PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GS
Sbjct: 838 DNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGS 897

Query: 919 KFTFTLPLNQ 928
           KF +T+PL Q
Sbjct: 898 KFIYTIPLLQ 907

 Score =  355 bits (911), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/376 (48%), Positives = 254/376 (67%), Gaps = 4/376 (1%)

Query: 7   SKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 66
           +K  + PP+R  +R QLT LV IVA+ SL  LA+ TGVYFT++YK+L  +RLYIA+QLKS
Sbjct: 13  NKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKS 72

Query: 67  SQIDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVA 126
           SQIDQTLN          SR+ +Q+ + S   G  +A   ++S SV+ KF+ +S+LFY  
Sbjct: 73  SQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYT 132

Query: 127 KVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLS-TDTPLPSSLETIGILTDPVLNSTDY 185
            +YD +  +++N+TNN +G  +   +L  L PLS T+T +P  +   GILTDP+LNST Y
Sbjct: 133 MIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKY 192

Query: 186 LMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYN 242
           LMSMSLPI   ++  + I   S +YGY+T++MSAE LKSVFNDT  L  ST A++SA+Y 
Sbjct: 193 LMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYT 252

Query: 243 SQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALG 302
           +      +HFVFPP+     +  +  +IKN TF   AF   K GS K+  +++ +N A+G
Sbjct: 253 NDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIG 312

Query: 303 YSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           Y+P +F L  WVA+V+ P+  F S + KL KII GTV+ I VFV L++LPL++WAVQPIV
Sbjct: 313 YAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIV 372

Query: 363 RLQKATELITEGRGLR 378
           RLQ+A+ELIT+ RGLR
Sbjct: 373 RLQRASELITKRRGLR 388

 Score =  161 bits (407), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 105/156 (67%), Gaps = 4/156 (2%)

Query: 1058 LDRPFLQSTGTATSSRNIPTVKDDDKNETSV----KILVVEDNHVNQEVIKRMLNLEGIE 1113
            LD+  LQ T           + D D     +    K+LV EDN VNQEVIKRML LE I 
Sbjct: 981  LDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENIS 1040

Query: 1114 NIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALT 1173
            +IELA DG EAF+KVK+     + Y++IFMD+QMPK+DGL ST  IR++L Y   IVALT
Sbjct: 1041 DIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALT 1100

Query: 1174 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            AFAD+SNIKEC ++GM+GF+ KPIKR  L T+L EF
Sbjct: 1101 AFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 34/165 (20%)

Query: 1073 RNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELT 1132
            R  P  +  DK    + +L+VEDN +NQ ++   L    I + E+A +G EA +K ++  
Sbjct: 534  RPSPIKRTRDKVFPKINVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKWRQ-- 590

Query: 1133 SKGENYNMIFMDVQMPKVDGLLSTKMIR-------------------RDLG-------YT 1166
                  ++I MD+Q+P + GL +TK IR                   RD         + 
Sbjct: 591  ---GGIHLILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFR 647

Query: 1167 SP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            SP  IVALTAF+  ++ +E L +G N +L+KP+    L + +TE+
Sbjct: 648  SPVIIVALTAFSSHADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 384

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T +IR      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 385  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP 
Sbjct: 320  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 373

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T +IR      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 374  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 12/133 (9%)

Query: 1082 DKNETSV-----KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGE 1136
            D N+TSV      +L+VED+ V  ++  + L   G   +E+  DG  A   +++      
Sbjct: 323  DTNDTSVLKEGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF----- 376

Query: 1137 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1196
             Y+++ MD+ MP +DG  +T ++R    +T PI+A+T   +D ++   L+ GMN  L+KP
Sbjct: 377  RYDLVLMDIVMPNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKP 435

Query: 1197 IKRPKLKTILTEF 1209
              +  L ++L  +
Sbjct: 436  FTKDDLHSMLIRY 448

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ ++ ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 408

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T +IR      +PI+A+T   +D ++   L+ GMN  L+KP  R  L ++L  +
Sbjct: 409  LDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 74/139 (53%), Gaps = 10/139 (7%)

Query: 1071 SSRNIPTVKDDDKN---ETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDK 1127
            SS +  T K+ D+N        +L+VED+ V+ ++  + L   G   +++  DG  A   
Sbjct: 385  SSNSSSTTKEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISN 443

Query: 1128 VKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLES 1187
            +++       Y+++ MD+ MP +DG  +T ++R      +PI+A+T   +D ++   L+ 
Sbjct: 444  LEKF-----RYDLVLMDIVMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQH 497

Query: 1188 GMNGFLSKPIKRPKLKTIL 1206
            GMN  L+KP  R  L +IL
Sbjct: 498  GMNDILAKPFTRNDLHSIL 516

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 65/120 (54%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ ++ ++  + L   G   +++  DG  A       T +   Y+++ MD+ MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAI-----TTLENSRYDLVLMDIVMPN 458

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T +IR      +PI+A+T   DD ++   L+ GMN  L+KP  R  L ++L  +
Sbjct: 459  LDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 83/174 (47%), Gaps = 33/174 (18%)

Query: 1059 DRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELA 1118
            D PFL+S     ++ +I      DK    + +LVVEDN +NQ ++   L    I + ++A
Sbjct: 394  DSPFLRSAMETFTTESI----TRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVA 448

Query: 1119 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRR-----DLGYTSP----- 1168
             +G EA D+ KE        ++I MD++MP + G+ + K IRR      +G   P     
Sbjct: 449  KNGIEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEH 503

Query: 1169 -------------IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
                         IVALTA    S+  E L +G N +L+KP+    L   +TE+
Sbjct: 504  APAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V+  +  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 436

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T +IR +    +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 437  LDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 495

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 92/203 (45%), Gaps = 13/203 (6%)

Query: 1012 NDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGS---VNLDRPFLQSTGT 1068
            N   G+  +Q K   P      A V     LS+   S H  + +   + L  P +    T
Sbjct: 296  NSTAGMSPMQNKPFDPLNSAVNAMVPGPVPLSAS-LSNHNAVNAAAELQLPLPNMNHGPT 354

Query: 1069 ATSSRN--IPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFD 1126
             T+ +   +P   D         +L+VED+ V  ++  + L   G   +E+  DG  A  
Sbjct: 355  ITTDKGDKLPETYDSFVLREGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAIS 413

Query: 1127 KVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLE 1186
             +++       Y+++ MD+ MP +DG  +T ++R      +PI+A+T   +D ++   L+
Sbjct: 414  TLEKF-----RYDLVLMDIVMPNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQ 467

Query: 1187 SGMNGFLSKPIKRPKLKTILTEF 1209
             GMN  L+KP  +  L ++L  +
Sbjct: 468  HGMNDILAKPFTKDDLHSMLIRY 490

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 13/129 (10%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE        ++IFMD+Q+
Sbjct: 517  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 570

Query: 1148 PKVDGLLSTKMIR-----RDLGYTSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRP 1200
            P + G+ + K IR     R     +P  IVALTA     + ++ L SG N +L+KP+   
Sbjct: 571  PVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLH 630

Query: 1201 KLKTILTEF 1209
             L   +TE+
Sbjct: 631  WLSKKITEW 639

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V  ++  + L   G  ++E+  DG  A       T + + ++++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIS-----TLEKQRFDLVLMDIVMPN 384

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T ++R      +PI+A+T   DD ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 385  LDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V  ++  + L   G  ++E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 362

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T ++R      +PI+A+T   +D ++   LE GMN  L+KP  +  L ++L  +
Sbjct: 363  LDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 33/149 (22%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + ++A +G+EA DK KE      N ++IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWKE-----GNLHLIFMDLQL 516

Query: 1148 PKVDGLLSTKMIR---RDLGYT----------------------SP--IVALTAFADDSN 1180
            P + G+ + K IR   ++ G                        SP  IVALTA     +
Sbjct: 517  PVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED 576

Query: 1181 IKECLESGMNGFLSKPIKRPKLKTILTEF 1209
             +E L SG N +L+KP+    L   +TE+
Sbjct: 577  KREALISGCNDYLTKPVNLLWLSKKITEW 605

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 82/164 (50%), Gaps = 34/164 (20%)

Query: 1074 NIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTS 1133
            ++P+ +  D+    + +L+VEDN +NQ ++   L    I + E+A +G EA +K +    
Sbjct: 495  SVPSNQTRDRVFPKINVLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWR---- 549

Query: 1134 KGENYNMIFMDVQMPKVDGLLSTKMIR---RDLG-----------------------YTS 1167
            KG   ++I MD+Q+P + G+ + K IR   R  G                       + +
Sbjct: 550  KG-GIHLILMDLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRA 608

Query: 1168 P--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            P  IVALTAF+  ++  E L +G N +L+KP+    L   +TE+
Sbjct: 609  PVIIVALTAFSSHADRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 81/156 (51%), Gaps = 18/156 (11%)

Query: 1065 STGTATSSRNIPTVKDDDK-------NETSVK----ILVVEDNHVNQEVIKRMLNLEGIE 1113
            S  T+T S  +P++ D++        N  +++    +L+VED+ V+ ++  + L   G  
Sbjct: 345  SPATSTVSLQLPSLPDENSLTPNAQANTVTLRKGFHVLLVEDDVVSIQLCSKFLRKYGCT 404

Query: 1114 NIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALT 1173
             +++  DG  A   +++       Y+++ MD+ MP +DG  +T ++R      +PI+A+T
Sbjct: 405  -VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 457

Query: 1174 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
                + ++   L+ GMN  L+KP  R  L +IL  +
Sbjct: 458  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 65/120 (54%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ +  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 307  VLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 360

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 361  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 78/156 (50%), Gaps = 18/156 (11%)

Query: 1065 STGTATSSRNIPTVKDDD------KNET-----SVKILVVEDNHVNQEVIKRMLNLEGIE 1113
            S  T+T S  +P + D +      +N T        +L+VED+ V+ ++  + L   G  
Sbjct: 343  SPATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT 402

Query: 1114 NIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALT 1173
             +++  DG  A   +++       Y+++ MD+ MP +DG  +T ++R      +PI+A+T
Sbjct: 403  -VQVVSDGLSAISTLEKYR-----YDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 455

Query: 1174 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
                + ++   L+ GMN  L+KP  R  L +IL  +
Sbjct: 456  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 64/117 (54%), Gaps = 7/117 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V+ ++  + L   G   +E+  DG  A   ++        Y+++ MD+ MP 
Sbjct: 426  VLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDIVMPN 479

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 1206
            +DG  +T +IR +    +PI+A+T   +D ++   L+ GM   L+KP  R  L ++L
Sbjct: 480  LDGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 80/156 (51%), Gaps = 18/156 (11%)

Query: 1065 STGTATSSRNIPTVKDDDK-------NETSVK----ILVVEDNHVNQEVIKRMLNLEGIE 1113
            S  T+T S  +P + D++        N  +++    +L+VED+ V+ ++  + L   G  
Sbjct: 344  SPTTSTVSLQMPNLPDENSLTPNAQGNAVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGC- 402

Query: 1114 NIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALT 1173
             +++  DG  A   +++       Y+++ MD+ MP +DG  +T ++R      +PI+A+T
Sbjct: 403  TVQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 456

Query: 1174 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
                + ++   L+ GMN  L+KP  R  L +IL  +
Sbjct: 457  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 65/120 (54%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP 
Sbjct: 381  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPN 434

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T ++R      +PI+A+T    + ++   L+ GMN  L+KP  R  L +IL  +
Sbjct: 435  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 75/145 (51%), Gaps = 9/145 (6%)

Query: 1067 GTATSSRNIPTVKDDDKNE--TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEA 1124
            G+A  +     + D D NE      +L+VED+ V+ ++  + L   G   +++  DG  A
Sbjct: 359  GSADINSKNDDIGDVDSNELKKGFHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAA 417

Query: 1125 FDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKEC 1184
               +++       ++++ MD+ MP +DG  +T +IR +    +PI+A+T   +  ++   
Sbjct: 418  ISILEKF-----RFDLVLMDIVMPNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITY 471

Query: 1185 LESGMNGFLSKPIKRPKLKTILTEF 1209
            L+ GMN  L+KP  R  L +IL  +
Sbjct: 472  LQHGMNDILAKPFTRKDLYSILIRY 496

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (55%), Gaps = 11/127 (8%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + ++A +G+EA     E+   G   ++IFMD+Q+
Sbjct: 475  INVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAV----EMWKNG-GLHLIFMDLQL 528

Query: 1148 PKVDGLLSTKMIR---RDLGYTSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKL 1202
            P + G+ + K IR   ++    +P  IVALTA     + +  L SG N +L+KP+    L
Sbjct: 529  PVLSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWL 588

Query: 1203 KTILTEF 1209
               +TE+
Sbjct: 589  SKKITEW 595

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V+ ++  + L   G   +++  DG  A   +++       ++++ MD+ MP 
Sbjct: 352  VLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKY-----RFDLVLMDIVMPN 405

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T +IR +    +PI+A+T   +  ++   L+ GMN  L+KP  R  L ++LT +
Sbjct: 406  LDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTRY 464

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 82/171 (47%), Gaps = 32/171 (18%)

Query: 1061 PFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACD 1120
            PF+ S   + ++ +I      DK    + +LVVEDN +NQ ++   L    I + ++A +
Sbjct: 383  PFILSAMESVTTESI----TRDKVFPKISVLVVEDNMINQAILSSFLRKHKI-HYKVAKN 437

Query: 1121 GQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRR-----DLGYTSP------- 1168
            G EA D+ KE        ++I MD++MP + G+ + K IR+      +G   P       
Sbjct: 438  GVEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAEL 492

Query: 1169 ----------IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
                      IVALTA    ++  E L +G N +L+KP+    L   +TE+
Sbjct: 493  KGLTCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITEW 543

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ V  ++  + L   G   + +  DG  A   ++        ++++ MD+ MP 
Sbjct: 418  VLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVLE-----NHRFDLVLMDIVMPN 471

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T ++R    YT PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 472  LDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 28/143 (19%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ +++  L    I + ++A +GQEA D+ KE        ++IFMD+Q+
Sbjct: 501  ITVLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWKE-----GGIDLIFMDLQL 554

Query: 1148 PKVDGLLSTKMIRRDL------GYTSP---------------IVALTAFADDSNIKECLE 1186
            P   G+ + K IR DL        T P               IVA TA    ++ +E L 
Sbjct: 555  PVFSGMDAAKKIR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALL 613

Query: 1187 SGMNGFLSKPIKRPKLKTILTEF 1209
            SG N +L+KP+    L   + E+
Sbjct: 614  SGCNDYLTKPVNLHWLSKKINEW 636

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1090 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1149
            +L+VED+ +  ++  + L ++    +E+  DG  A   +++       ++++ MD+ MP 
Sbjct: 304  VLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVMPN 357

Query: 1150 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            +DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 358  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 416

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 73/154 (47%), Gaps = 32/154 (20%)

Query: 1082 DKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMI 1141
            DK    + +L+VEDN +NQ ++   L    I   ++A +GQEA D  +E        ++I
Sbjct: 559  DKVFPKINVLIVEDNVINQTILSSFLRKHKI-FYKVAKNGQEAIDVWRE-----GGIHLI 612

Query: 1142 FMDVQMPKVDGLLSTKMIR---RDLGY---------------------TSP--IVALTAF 1175
            FMD+Q+P + G+ + K IR   R+ G                       +P  IVA TA 
Sbjct: 613  FMDLQLPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTAS 672

Query: 1176 ADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
               S+ KE L SG N +L+KP+    L   + E+
Sbjct: 673  KSQSDKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 33/149 (22%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 486  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 539

Query: 1148 PKVDGLLSTKMIR-----------RDLGYTSP----------------IVALTAFADDSN 1180
            P + G+ + K IR           + L  + P                IVALTA     +
Sbjct: 540  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMD 599

Query: 1181 IKECLESGMNGFLSKPIKRPKLKTILTEF 1209
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 600  KRKALVSGCNDYLTKPVNLHWLSKKITEW 628

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 72/158 (45%), Gaps = 37/158 (23%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + ++A +G+EA DK KE        ++IFMD+Q+
Sbjct: 511  INVLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWKE-----GGLHLIFMDLQL 564

Query: 1148 PKVDGLLSTKMIRR------------------------------DLGYTSPIVALTAFAD 1177
            P + G+ + K IR                                 G    IVA TA   
Sbjct: 565  PVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNS 624

Query: 1178 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQG 1215
             ++ +E L SG N +L+KP+    L   +TE+    QG
Sbjct: 625  LTDKREALISGCNDYLTKPVNLHWLSKKITEW-GCMQG 661

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 34/151 (22%)

Query: 1087 SVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQ 1146
            ++ +L+VEDN +NQ ++   L    I +  +A +G+EA +K KE        ++IFMD+Q
Sbjct: 470  NITVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWKE-----GGIHLIFMDLQ 523

Query: 1147 MPKVDGLLSTKMIR-----RDLGYTSPI-----------------------VALTAFADD 1178
            +P + G+ + K IR     + +G  +P+                       VA TA    
Sbjct: 524  LPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSL 583

Query: 1179 SNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
            ++ +E L SG N +L+KP+    L   +TE+
Sbjct: 584  TDKREALVSGCNDYLTKPVNLHWLSKKITEW 614

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 79/172 (45%), Gaps = 35/172 (20%)

Query: 1057 NLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIE 1116
            NL    L S  T TS +  P           + +L+VEDN +NQ ++   L    I + +
Sbjct: 524  NLSHDALLSGITTTSEKVFP----------KINVLIVEDNVINQAILGSFLRKHKI-SYK 572

Query: 1117 LACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIR---------------- 1160
            +A +G+EA D  KE        ++IFMD+Q+P + G+ + + IR                
Sbjct: 573  VAKNGKEAVDIWKE-----GGLHLIFMDLQLPVLSGIEAARQIRAFEKENGIGIQEHSNS 627

Query: 1161 -RDLGYTSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209
             +     +P  IVALTA     + +  L SG N +L+KP+    L   +TE+
Sbjct: 628  LKKNKTKAPVIIVALTASNSQDDKRNALISGCNDYLTKPVNLHWLSKKITEW 679

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 33/149 (22%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 493  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 546

Query: 1148 PKVDGLLSTKMIRR--------------------DLGYT-----SP--IVALTAFADDSN 1180
            P + G+ + K IR                     D G +     +P  IVALTA     +
Sbjct: 547  PVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMD 606

Query: 1181 IKECLESGMNGFLSKPIKRPKLKTILTEF 1209
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 607  KRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 33/149 (22%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 504  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 557

Query: 1148 PKVDGLLSTKMIR-----RDLGY--------------------TSP--IVALTAFADDSN 1180
            P + G+ + K IR       +G                      +P  IVALTA     +
Sbjct: 558  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMD 617

Query: 1181 IKECLESGMNGFLSKPIKRPKLKTILTEF 1209
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 618  KRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 33/149 (22%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 503  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 556

Query: 1148 PKVDGLLSTKMIR-----RDLGY--------------------TSP--IVALTAFADDSN 1180
            P + G+ + K IR       +G                      +P  IVALTA     +
Sbjct: 557  PVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMD 616

Query: 1181 IKECLESGMNGFLSKPIKRPKLKTILTEF 1209
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 617  KRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 73/145 (50%), Gaps = 29/145 (20%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE        ++IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 723

Query: 1148 PKVDGLLSTKMIR-----RDLGYT----------------SP--IVALTAFADDSNIKEC 1184
            P + G+ + + IR     + +G                  +P  IVALTA     + ++ 
Sbjct: 724  PVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKA 783

Query: 1185 LESGMNGFLSKPIKRPKLKTILTEF 1209
            L SG N +L+KP+    L   +TE+
Sbjct: 784  LLSGCNDYLTKPVNLHWLSKKITEW 808

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 11/109 (10%)

Query: 1053 LGSVNLDRPFLQSTGTATSSR-NIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEG 1111
            + S  L RP  + T  +   + N+P  K   +    + +L+VEDN +NQ ++   L   G
Sbjct: 362  ISSPELPRPLSRRTTPSLDKQGNLPKYKVFPR----INVLIVEDNAINQAILALFLRKNG 417

Query: 1112 IENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIR 1160
            I + ++A DG EA +K KE    G+++ +I MD+Q+P + GL +TK IR
Sbjct: 418  I-SYKVAKDGVEAIEKWKE----GDSH-LILMDLQLPLLSGLEATKKIR 460

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 73/158 (46%), Gaps = 37/158 (23%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + IL+VEDN +NQ ++   L    I   ++A +G+EA DK KE        ++IFMD+Q+
Sbjct: 565  INILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE-----GGIHLIFMDLQL 618

Query: 1148 PKVDGLLSTKMIR---RDLGY-------------------------TSP--IVALTAFAD 1177
            P + G  + K IR   + +G                           +P  IVA TA   
Sbjct: 619  PVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNS 678

Query: 1178 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQG 1215
             ++ +  L +G N +L+KP+    L   +TE+    QG
Sbjct: 679  LADKRAALIAGCNDYLTKPVNLHWLSKKITEW-GCMQG 715

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (61%), Gaps = 6/73 (8%)

Query: 1088 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1147
            + +L+VEDN +NQ ++   L    I + ++A +G+EA DK K+        ++I +D+Q+
Sbjct: 462  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWKQ-----GGIHLILLDLQL 515

Query: 1148 PKVDGLLSTKMIR 1160
            P + G+ +TK IR
Sbjct: 516  PILSGIEATKEIR 528

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVF-HPFV-----QGDQTLS---------RQYGGTGLGLSIC 897
           + I + D G GIDP +++ VF + F      + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           +    + +GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>KLLA0F14256g Chr6 (1321231..1324131) [2901 bp, 966 aa] {ON} similar
            to uniprot|P12954 Saccharomyces cerevisiae YJL092W HPR5
            DNA helicase and DNA-dependent ATPase involved in DNA
            repair required for proper timing of commitment to
            meiotic recombination and the transition from Meiosis I
            to Meiosis II potential Cdc28p substrate
          Length = 966

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 12/83 (14%)

Query: 1069 ATSSRNIPTVKDDDKNETSVKIL--VVEDNHVNQEVI----KRMLNLEGIENIELACDGQ 1122
            +T+ R I +  D D+   S+++L  + E N +N + I    KR +NL  +E ++L C+  
Sbjct: 441  STTIRKIKSAFDKDRCRNSLEVLKELCESNDLNNQKISAALKRFINL--VEKLKLKCEEY 498

Query: 1123 EAFDKVKELTSK----GENYNMI 1141
            + +D +KEL ++    GE Y+++
Sbjct: 499  DTYDGLKELFAEIYMLGELYSVL 521

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 54/110 (49%), Gaps = 6/110 (5%)

Query: 1103 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRR- 1161
            I R    E +E+I  +       +++    + G  +++I   +++PK+  +   K+IR  
Sbjct: 1449 IHRYRVAEDLESIGCSVVSAGNGEELVRRATTGVKFDLIITAMKLPKLGAIDIAKLIRHT 1508

Query: 1162 -DLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1210
              +  T+PIVALT +  D+   +  +      L KP+   +L+ +++++ 
Sbjct: 1509 NSVNCTTPIVALTVYYHDAKESKVFDD----VLEKPVSVEQLRKLVSKYA 1554

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVFH-------------PFVQGDQTLSR--QYGGTGLGLSIC 897
           +SI V D G GI P  +  +               P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           R  A +  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 55/110 (50%), Gaps = 6/110 (5%)

Query: 1103 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRD 1162
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++++ 
Sbjct: 1645 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1704

Query: 1163 LGY--TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1210
             G   T+PIVA+T +  ++      +      L KP+K  +LK ++ ++ 
Sbjct: 1705 NGANSTTPIVAITNYFQEAATSRVFDD----VLEKPVKLDELKKLVAKYA 1750

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 1103 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRD 1162
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++R+ 
Sbjct: 1633 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQT 1692

Query: 1163 LGY--TSPIVALTAFADDSNIKECLESGM-NGFLSKPIKRPKLKTILTEFC 1210
             G   T+PIVA+T +      +E + S + +  L KP+   +LK ++ ++ 
Sbjct: 1693 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1738

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 12/113 (10%)

Query: 1103 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRD 1162
            I R     G+E++        A D++    + G  +++I   +++PK+  +   K+++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1163 LGY--TSPIVALTAFADDSNIKECLESGMNGF---LSKPIKRPKLKTILTEFC 1210
             G   T+PIVA T + +++       S  N F   L KPI    L+ +++++ 
Sbjct: 1454 NGINSTTPIVAATCYFEEA-------SNTNVFSDVLEKPISIQTLRKLISKYA 1499

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 12/100 (12%)

Query: 1112 IENIELACDGQEAFDKVKELTSKGENYNMIFMDVQM-----PKVDGLLSTKMIRRDLGYT 1166
            +E   +  D  + + K KE     + Y+++ +D  +     P ++ +LS+      + Y 
Sbjct: 511  LEQYRITVDIMQDWPKTKEKIL-NKCYDLVIIDAHVKFLNVPILESMLSS------IQYH 563

Query: 1167 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 1206
             PI+ +T+  +D  +   L+ G+N  L KP    KL   L
Sbjct: 564  PPIILMTSSLNDQQLIFYLQHGINSILEKPFHSHKLLKFL 603

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F        T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           +    M +GT+ ++S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F       Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           +    M  G++ ++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
            {ON} highly similar to uniprot|P32562 Saccharomyces
            cerevisiae YMR001c CDC5 involved in regulation of DNA
            replication
          Length = 746

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 1153 LLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1206
            LLS   I + + +T+ +  +  F D+ N+   LE   NG L + IK+      P+++  +
Sbjct: 125  LLSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFM 184

Query: 1207 TEFCAAYQGKKNNK 1220
            T+ C   Q   +N+
Sbjct: 185  TQICGGIQYMHSNR 198

>KLTH0A03718g Chr1 complement(321327..322751) [1425 bp, 474 aa] {ON}
            similar to uniprot|P40533 Saccharomyces cerevisiae
            YIL039W Hypothetical ORF
          Length = 474

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 3/94 (3%)

Query: 1049 RHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLN 1108
            R EG   +    PF +  G  T         DD   E   + L+   NH++++V KR+LN
Sbjct: 304  RFEGSTVLLTHVPFYKKEGLCTDGELFRYYPDDYPREPYKQNLLRSQNHLSEDVTKRVLN 363

Query: 1109 L---EGIENIELACDGQEAFDKVKELTSKGENYN 1139
            L    G   I L     E  + V    SK  ++N
Sbjct: 364  LIFDNGKPGIILTGHDHEGCETVYNKDSKTGDWN 397

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 1103 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRD 1162
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++++ 
Sbjct: 1635 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1694

Query: 1163 LGY--TSPIVALTAFADDSNIKECLESGM-NGFLSKPIKRPKLKTILTEFC 1210
             G   T+PIVA+T +      +E + S + +  L KP+   +LK ++ ++ 
Sbjct: 1695 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1740

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1153 LLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1206
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPEVRFFT 185

Query: 1207 TEFCAA 1212
            T+ C A
Sbjct: 186  TQICGA 191

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 56/111 (50%), Gaps = 8/111 (7%)

Query: 1103 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRD 1162
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++++ 
Sbjct: 1628 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1687

Query: 1163 LGY--TSPIVALTAFADDSNIKECLES-GMNGFLSKPIKRPKLKTILTEFC 1210
             G   T+PIV++T +      +E + S   +  L KP+   +LK ++ ++ 
Sbjct: 1688 NGVNSTTPIVSITNY-----FQEAIASKAFDDVLEKPVNLDELKRLVAKYA 1733

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
            CDC5Polo-like kinase with multiple functions in mitosis
            and cytokinesis through substrate phosphorylation, also
            functions in adaptation to DNA damage during meiosis; has
            similarity to Xenopus Plx1 and S. pombe Plo1p; possible
            Cdc28p substrate
          Length = 705

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1153 LLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1206
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1207 TEFCAA 1212
            T+ C A
Sbjct: 186  TQICGA 191

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1153 LLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1206
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1207 TEFCAA 1212
            T+ C A
Sbjct: 186  TQICGA 191

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1153 LLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1206
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1207 TEFCAA 1212
            T+ C A
Sbjct: 186  TQICGA 191

>TDEL0C03800 Chr3 (667719..669419) [1701 bp, 566 aa] {ON} Anc_2.282
            YNL039W
          Length = 566

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 10/85 (11%)

Query: 999  KDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHR-SRHEGLG--- 1054
            +D G   +  EE  ++G L Q     IKP+   T  ++ E  S+    R SR + LG   
Sbjct: 70   EDTGATAVQDEEDEEDGALSQ-----IKPNPSQTSTQIPESQSVREGRRSSRLDSLGTNQ 124

Query: 1055 -SVNLDRPFLQSTGTATSSRNIPTV 1078
             S  + RP    +GT T+ + + T+
Sbjct: 125  TSAPIFRPAFNESGTGTTGKRLSTI 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 120,832,143
Number of extensions: 5238716
Number of successful extensions: 16010
Number of sequences better than 10.0: 149
Number of HSP's gapped: 16688
Number of HSP's successfully gapped: 183
Length of query: 1220
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1099
Effective length of database: 39,606,813
Effective search space: 43527887487
Effective search space used: 43527887487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)