Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL146C (ATG32)5.699ON52952921900.0
Smik_9.235.699ON52752918950.0
Skud_9.225.699ON53753718020.0
Suva_9.435.699ON51343513620.0
ZYRO0G06666g5.699ON5035156262e-74
TDEL0B022205.699ON4895026234e-74
CAGL0H06545g5.699ON4922133892e-40
SAKL0E14850g5.699ON4703983391e-33
KNAG0L021005.699ON4445133151e-30
TBLA0E020905.699ON7491493051e-28
NCAS0G002605.699ON5103122984e-28
KLTH0E01122g5.699ON4723752799e-26
KAFR0D022505.699ON5561432659e-24
AFR283W5.699ON4523842621e-23
Ecym_40215.699ON4593982551e-22
Kwal_55.197165.699ON4673862541e-22
KLLA0A00660g5.699ON5244102062e-16
TPHA0D045805.699ON47040770.87
Ecym_63511.264ON796118732.9
NOTE: 1 genes in the same pillar as YIL146C were not hit in these BLAST results
LIST: Kpol_2001.73

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL146C
         (529 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   848   0.0  
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   734   0.0  
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   698   0.0  
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   529   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   245   2e-74
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   244   4e-74
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   154   2e-40
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   135   1e-33
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   125   1e-30
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   122   1e-28
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   119   4e-28
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   112   9e-26
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   106   9e-24
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   105   1e-23
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   102   1e-22
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   102   1e-22
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    84   2e-16
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             34   0.87 
Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}...    33   2.9  

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/529 (81%), Positives = 431/529 (81%)

Query: 1   MVLEYQQREXXXXXXXXXXXXXXXTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60
           MVLEYQQRE               TTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS
Sbjct: 1   MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60

Query: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTS 
Sbjct: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXXX 180
                  APAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFN       
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD 180

Query: 181 XXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL 240
                   SVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL
Sbjct: 181 EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL 240

Query: 241 FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL 300
           FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL
Sbjct: 241 FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL 300

Query: 301 KSFLRNXXXXXXXXXXXXTNKRDLKKMFQRLQDLSLEYGXXXXXXXXXXXAIHTKSRSYC 360
           KSFLRN            TNKRDLKKMFQRLQDLSLEYG           AIHTKSRSYC
Sbjct: 301 KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC 360

Query: 361 RXXXXXXXXXXXXXXXXXXXXXXXXFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV 420
           R                        FFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV
Sbjct: 361 RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV 420

Query: 421 KSLSLRPXXXXXXXXXXXXXDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT 480
           KSLSLRP             DTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT
Sbjct: 421 KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT 480

Query: 481 IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529
           IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL
Sbjct: 481 IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/529 (71%), Positives = 402/529 (75%), Gaps = 2/529 (0%)

Query: 1   MVLEYQQREXXXXXXXXXXXXXXXTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60
           MVL Y QRE                 I + S+AQ  ED+GLLDPHLSVLELL KTGHSPS
Sbjct: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           PMGQ+LVTSIDISG+ NVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTS 
Sbjct: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXXX 180
                  APAADIINIIKQGQEG NV S SHPF+QL K+ISLP+P +EKTP+        
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD 180

Query: 181 XXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL 240
                   SVTITKSLTSSTNSFVMPKLSL+QKNPVFRLLILGRTGS+FYQSIPKEYQSL
Sbjct: 181 EDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSL 240

Query: 241 FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL 300
           FELPKYHDSATFPQYTGI+IIFQELREMVSLLNRIVQYSQGKP+IPICQPGQ IQVKNVL
Sbjct: 241 FELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVL 300

Query: 301 KSFLRNXXXXXXXXXXXXTNKRDLKKMFQRLQDLSLEYGXXXXXXXXXXXAIHTKSRSYC 360
           KSFLRN            TN++DLKKMFQRLQDLSLEY               TKSRSY 
Sbjct: 301 KSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLEYAEDENEEGDDDET--TKSRSYY 358

Query: 361 RXXXXXXXXXXXXXXXXXXXXXXXXFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV 420
           R                        FFTSWFTWGISITIGISFGCCVTYFVTAAY+HQTV
Sbjct: 359 RYKKANNSKRKSPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTV 418

Query: 421 KSLSLRPXXXXXXXXXXXXXDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT 480
           KSLSLR              DT+NTPATASPSS+E FLWFDKGTLQINFH DG IMKSL+
Sbjct: 419 KSLSLRSSLLTSMLSLDSSSDTVNTPATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLS 478

Query: 481 IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529
           +IKETW KMN FVLHALS+PL FLENLN+SS+FSIDESNRILALGYILL
Sbjct: 479 VIKETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/537 (67%), Positives = 389/537 (72%), Gaps = 8/537 (1%)

Query: 1   MVLEYQQREXXXXXXXXXXXXXXXTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60
           MVL+Y QRE                 I   SE + GEDKGLLDPHLSVLELL KTGHSPS
Sbjct: 1   MVLDYPQRETKGSSSKNMAPNSSSMNIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           PMG +LVTSIDIS +H VNDSISGSWQAI PLDLGASF+PER SSQTTNGSILSSSDTS 
Sbjct: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXXX 180
                  APAADIINIIKQGQEGA+V SPS PF+QL K+ISLPLP K +T +        
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDN 180

Query: 181 XXX------XXXXXSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIP 234
                         S TITKSLTSSTNSFVMPKLSL+QKNPVFRLLILGRTGS+FYQSIP
Sbjct: 181 NVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240

Query: 235 KEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVI 294
           KE+QSLFELPKYHDS  FPQYTGI+IIFQELREMVSLLNRIVQYSQGKP+IPICQPGQ I
Sbjct: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300

Query: 295 QVKNVLKSFLRNXXXXXXXXXXXXTNKRDLKKMFQRLQDLSLEYGXXXXXXXXXXXA--I 352
           QVKNVLKSFLRN            TN+RDLKKMFQRLQDLSLEY               I
Sbjct: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEII 360

Query: 353 HTKSRSYCRXXXXXXXXXXXXXXXXXXXXXXXXFFTSWFTWGISITIGISFGCCVTYFVT 412
           HT SRSY R                          T WFTWG+SITIGISFGCCVTYF T
Sbjct: 361 HTNSRSYYRNKKANSSKKKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCVTYFAT 420

Query: 413 AAYEHQTVKSLSLRPXXXXXXXXXXXXXDTINTPATASPSSTEQFLWFDKGTLQINFHSD 472
           AAY+HQT KS +LR              DT+NTPAT S SS EQFLWFDKGTLQINFHSD
Sbjct: 421 AAYDHQTGKSFNLRSSILTSLLSLDSYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD 480

Query: 473 GFIMKSLTIIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529
           GFIMKSLT+IK+TW KMN FVL+ALS+PL FLENLNK+S+FS+DESNRILALGYILL
Sbjct: 481 GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/435 (63%), Positives = 305/435 (70%), Gaps = 9/435 (2%)

Query: 1   MVLEYQQREXXXXXXXXXXXXXXXTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60
           MVL+YQ RE                 I   SE Q  EDKGLLDPHLSVLELL KTG SPS
Sbjct: 1   MVLDYQHRETKGSSSKNMAPNSSSMNIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60

Query: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           P+GQ+LVTSIDIS +HNV D+ISGSWQ IQPLDLGASFIPERCSSQTTNGSILSSSDTS 
Sbjct: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXX- 179
                  APAADIINIIKQGQ+G +V SPSHPFKQL  +ISLP+P +E+T +        
Sbjct: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180

Query: 180 ----XXXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPK 235
                        SVTITKSLTSSTNSFVMPKLSL++KNPVFRLLILGRTG++FYQS PK
Sbjct: 181 IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK 240

Query: 236 EYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQ 295
           EYQSLFELPK HDS  FPQYTGIVI+FQELREMVSLLNRIV+Y+QGKP+IPICQPGQ IQ
Sbjct: 241 EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ 300

Query: 296 VKNVLKSFLRNXXXXXXXXXXXXTNKRDLKKMFQRLQDLSLEY----GXXXXXXXXXXXA 351
           VKNVLKSFL+N            TN++DLKKMFQRLQDLSLEY                 
Sbjct: 301 VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEI 360

Query: 352 IHTKSRSYCRXXXXXXXXXXXXXXXXXXXXXXXXFFTSWFTWGISITIGISFGCCVTYFV 411
           I   SRSY R                          T WFTWG+SITIGISFGCCVTYFV
Sbjct: 361 IQPYSRSYYRSKKGGSSKKKSSKSNKKSKKKKQRSSTRWFTWGVSITIGISFGCCVTYFV 420

Query: 412 TAAYEHQTVKSLSLR 426
           TAAY+HQT++SL+ R
Sbjct: 421 TAAYDHQTIRSLNSR 435

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  245 bits (626), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 177/515 (34%), Positives = 246/515 (47%), Gaps = 55/515 (10%)

Query: 37  EDKGLLDPHLSVLELLSKTGHS-PSPMGQNLVTSIDISGN-----HNVNDSISGSWQAIQ 90
           E + +LDPHLSVLELL +   + P    +  V+  DI GN        N SIS SWQ I 
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVS--DIVGNCAGTTGTGNGSISQSWQTIH 79

Query: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGANVVSPS 150
             D   S +PERC SQ T   ILSSSDTS        +P+A          +  +   P 
Sbjct: 80  RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA--------VHQQLHATPPQ 131

Query: 151 HPFKQLQKIISL----PLPGKEKTPFNXXXX---XXXXXXXXXXXSVTITKSLTSSTNSF 203
              K L+   SL    PL   E +                     + TITKSL SS+NSF
Sbjct: 132 KHTKSLEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSF 191

Query: 204 VMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQ 263
           +MPKLSL+QK   FR+L+LGR G  FY SIPK+YQ +FELP+ HD A F QYTGI+++FQ
Sbjct: 192 IMPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQ 251

Query: 264 ELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNKRD 323
           EL+EMVSLLNR+ Q +  +PVIP+CQ GQ  QV+N+L+S L+N             N+ D
Sbjct: 252 ELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPD 311

Query: 324 LKKMFQRLQDLSLEYGXXXXXXXXXXXAIHTK-SRSYCRXXXXXXXXXXXXXXXXXXXXX 382
           L  MF+ LQ+LS                   +  RS  R                     
Sbjct: 312 LLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRH 371

Query: 383 XXXFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPXXXXXXXXXXXXXDT 442
                  W  WG+S+T+G+  G C+++ V++ +       +SL                T
Sbjct: 372 NNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTW-------ISL----------------T 408

Query: 443 INTPATASPSSTEQFLW-FDKGTL---QINFHSDGFIMKSLTIIKETWGKMNTFVLHALS 498
            N      P S  + L+ FD+  L   +++  SD     +L + K+   + N  V   L 
Sbjct: 409 TNPLGPVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLG 468

Query: 499 KPLKFLENLNKSSEF----SIDESNRILALGYILL 529
           + L  +E +  ++      S + +NR+LALGY++L
Sbjct: 469 RHLSCMERIGPANCLEWPTSDEHTNRVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  244 bits (623), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 176/502 (35%), Positives = 246/502 (49%), Gaps = 48/502 (9%)

Query: 37  EDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGA 96
           E K LLDPHLSVLELL +TG +   +G+ +  + D++   N  +SIS SWQAI   D   
Sbjct: 27  EKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMA---NTTNSISSSWQAIHRNDAMI 82

Query: 97  SFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGANVVSPSHPFKQL 156
           + +PERCSSQ     ILSSSDTS        +P         Q Q+      P  PFK  
Sbjct: 83  TGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQ-----PPRLPFKLD 137

Query: 157 QKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQKNPV 216
             +I   LP +++ P                   T+TKSL++S+NSFVMPKLSL+QK+  
Sbjct: 138 VPVI---LPARDQEP---SGQTQTPDNDDERDDETLTKSLSNSSNSFVMPKLSLSQKSHK 191

Query: 217 FRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIV 276
            R+LILGR G  FYQSIPK YQ  FEL +  D + F Q+TGI+I+FQEL+EMVSLLNR+ 
Sbjct: 192 LRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEMVSLLNRVC 251

Query: 277 QYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNKRDLKKMFQRLQDLSL 336
           Q +  +PVIP+CQ GQ  QV+NVL+S L++            +N  DL  M++ L DLS 
Sbjct: 252 QCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYRFLLDLSK 311

Query: 337 ---EYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXXXXXXXXXXFFTSWFTW 393
              +                   +S+ R                            W  W
Sbjct: 312 TISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETK--INKWIVW 369

Query: 394 GISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPXXXXXXXXXXXXXDTINTPATASPSS 453
           GIS+T+G+  G C++YF ++     + KS++                 +IN      P+ 
Sbjct: 370 GISLTVGVGVGYCMSYFASSGLISMSAKSIA-----------------SIN---GCRPN- 408

Query: 454 TEQFLWFDKGTLQINFHSDGF---IMKSLTIIKETWGKMNTFVLHALSKPLKFLE---NL 507
            +  + FD  +L +  +          +L ++K+T  + N  +   L K L   E   + 
Sbjct: 409 -DNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSST 467

Query: 508 NKSSEFSIDESNRILALGYILL 529
           N     + D SNR+LALGYILL
Sbjct: 468 NYKEWGAEDNSNRVLALGYILL 489

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  154 bits (389), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 117/213 (54%), Gaps = 14/213 (6%)

Query: 203 FVMPKLSLTQK-NPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVII 261
           FVMPKLSLT K +   +LL++GR    F+Q IP+EY+  F + +  D + F  Y GIVI+
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254

Query: 262 FQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNK 321
           FQEL+E V++LNRIVQY+  KP+IPICQPGQ I+VKN+LKSFL+N             N+
Sbjct: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314

Query: 322 RDLKKMFQRLQDL--SLEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXXXX 379
           + ++K+F+    L   LE             ++  ++  Y +                  
Sbjct: 315 KSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRRKKHGGKPSTN---- 370

Query: 380 XXXXXXFFTSWFTWGISITIGISFGCCVTYFVT 412
                  ++ W TWGIS+TIG+S G   TY +T
Sbjct: 371 -------YSKWITWGISLTIGVSIGYYATYMIT 396

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  135 bits (339), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 105/398 (26%), Positives = 177/398 (44%), Gaps = 72/398 (18%)

Query: 37  EDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGN--------------HNVNDSI 82
           + + +LDPH SVL+LL + G           + I +                   +N SI
Sbjct: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86

Query: 83  SGSWQAIQPLDLGA-SFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQG- 140
           S SWQ+I+ +D    + + +  SSQ     ILSSSDTS        +P+     +   G 
Sbjct: 87  SDSWQSIKMVDYSILNSLHDTSSSQAVG--ILSSSDTSEEELDHLNSPSPSSQQVFPNGP 144

Query: 141 ----QEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSL 196
               Q  A V++ S          +LP PG  +   N                 T+T SL
Sbjct: 145 PISFQTQAGVLTAS---------ATLPNPGVLEEDDNE----------------TVTVSL 179

Query: 197 TSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQ-- 254
            +S+NSFVMP+LSL+Q++  F +L++G+    F+ ++PK YQ +F++  + +S + P+  
Sbjct: 180 AASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDF-ESISAPKVS 238

Query: 255 -YTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXX 313
            YT ++IIFQ+ +E+  +L+ +V    GK +IPICQ GQ  Q+ ++L+ F++        
Sbjct: 239 HYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMF 298

Query: 314 XXXXXTNKRDLKKMFQRLQDLSLEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXX 373
                +N +++ K+ + L  LS E                 K     +            
Sbjct: 299 QPTVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLKVRKRKKTHKKKSKGTS------- 351

Query: 374 XXXXXXXXXXXXFFTSWFTWGISITIGISFGCCVTYFV 411
                           W  WG+S+T+G+  GCC+++ +
Sbjct: 352 --------------NRWVIWGLSLTVGVGIGCCISFIL 375

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  125 bits (315), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 136/513 (26%), Positives = 215/513 (41%), Gaps = 88/513 (17%)

Query: 35  TGEDKGLLDPHLSVLELLSKT----GHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQ 90
           +G    +LDPHLSVLELL K+    GH+ +P       +  I         +S SW  ++
Sbjct: 2   SGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ--------LSESWCTVE 53

Query: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGANVVSPS 150
             +L A    ER +SQ TN  +LSSSDTS        +P       +   +        +
Sbjct: 54  RDELSAM---ERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVADTRM-------A 103

Query: 151 HPFKQLQKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSSTNSFVMPKL-- 208
            P   LQ   S  L G +                    S T++KSLTSS+NSF+MPKL  
Sbjct: 104 RPAMSLQSTSST-LDGVDDD------------------SATVSKSLTSSSNSFIMPKLYT 144

Query: 209 ---------SLTQKNPVFRLLILGRTGSSFYQ-SIPKEYQSLFEL-PKYHDSATFPQYTG 257
                    S   +   F++ +LGR    F Q ++P++++  FEL    HD A      G
Sbjct: 145 TVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQG 204

Query: 258 IVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXX 317
           I+I+ QE+RE++SLLNR+       PV+ +    + +QVKNVL++F R            
Sbjct: 205 ILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVP 264

Query: 318 XTNKRDLKKMFQRLQDLSLEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXX 377
            +N   L KMF  + +L+ +              IH   ++                   
Sbjct: 265 LSNNEALDKMFHFVDNLARQ--------QEPAGVIHNDPQT-----TQEQHPDHNEDDPH 311

Query: 378 XXXXXXXXFFTSWFTWGISITIGISFG-CCVTYFVTAAYEHQTVKSLSLRPXXXXXXXXX 436
                    F  W  WG+SI++GI  G  CV+Y V+++     V   + R          
Sbjct: 312 RGPSKPEGTFKRWLLWGVSISLGIGAGYYCVSYVVSSSM---CVSCFNFR---------- 358

Query: 437 XXXXDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKMNTFVLHA 496
                T +T A  + ++           +  +  S   +   L+I+K +  +   FV  A
Sbjct: 359 ----HTDHTLAATTSTAAAAAAAATPSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQA 414

Query: 497 LSKPLKFLENLNKSSEFSIDESNRILALGYILL 529
           + KP  +   +++S E+ + + NR L LGY ++
Sbjct: 415 MHKPFHY---IDRSQEWHLHDPNRFLQLGYAVI 444

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 2/149 (1%)

Query: 189 SVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGS-SFYQSIPKEYQSLFELPKYH 247
           ++ +TKS+TSS+NSF+MPKLS T     FR+LILG   + +FYQ+IP  Y+ LFELP  +
Sbjct: 322 NLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNN 381

Query: 248 DSATFPQYTGIVIIFQELREMVSLLNRIVQYSQG-KPVIPICQPGQVIQVKNVLKSFLRN 306
               F  Y GI I+  +L +  S+LN+I +YS   KP+IPIC+ GQ+ +VKN+LK +++ 
Sbjct: 382 FDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKT 441

Query: 307 XXXXXXXXXXXXTNKRDLKKMFQRLQDLS 335
                       TN+  +  ++  L DLS
Sbjct: 442 KDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  119 bits (298), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 112/312 (35%), Positives = 152/312 (48%), Gaps = 52/312 (16%)

Query: 39  KGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASF 98
           K LLDPHLSVLE+L +  +          T ++ S        IS SWQ I+        
Sbjct: 36  KSLLDPHLSVLEMLERKDND---------TVMEASSR------ISRSWQNIESPADSKQL 80

Query: 99  IPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGA--NVVSPSHPFKQL 156
           +  + SSQ +N   + SS +             D IN +    EG+  N  +PS     L
Sbjct: 81  LSAK-SSQVSNLVSILSSSSDTSD------EEVDRINSLNSAGEGSSKNYNNPS----PL 129

Query: 157 QKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSST---NSFVMPKLSLTQK 213
           Q  I LP                         + TITKSLTSS+   NSFVMP LSL+  
Sbjct: 130 QNPIYLP-----------EFTDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLSLSSS 178

Query: 214 NPV---FRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSAT---FPQYTGIVIIFQELRE 267
                 F++LI GR G SFY++IPK+YQ LF +P   ++ T      +T  +IIF+EL+E
Sbjct: 179 QSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKE 238

Query: 268 MVSLLNRIVQYSQGKPVIPI----CQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNKRD 323
           +VSLLNRI +    K V P     CQPGQ I+VK++LK FL+N             ++R 
Sbjct: 239 LVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDERA 298

Query: 324 LKKMFQRLQDLS 335
           L KMF+ +Q +S
Sbjct: 299 LLKMFKTMQSIS 310

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 23/150 (15%)

Query: 386 FFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLS--LRPXXXXXXXXXXXXXDTI 443
           F   W  W IS+T+G   G  ++Y V  + +   ++ ++   RP                
Sbjct: 378 FKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLS------------ 425

Query: 444 NTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKF 503
              +     S +  L+ ++ T   N +S  +   +    KET  ++N+     + KP   
Sbjct: 426 ---SLIHLKSNKNLLYLERTT--PNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAM 480

Query: 504 LENLN----KSSEFSIDESNRILALGYILL 529
            ENL      S ++  DE +RILAL Y+LL
Sbjct: 481 FENLITTTINSKDWKFDEQDRILALCYLLL 510

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  112 bits (279), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 96/375 (25%), Positives = 155/375 (41%), Gaps = 49/375 (13%)

Query: 41  LLDPHLSVLELLSKTGHSPSPMGQNLVTSI------DISGNHNVNDSISGSWQAIQPLDL 94
           +LDPHLSVL+LL +    PS +       I        SG  +VN SIS SWQ+I+  D 
Sbjct: 40  ILDPHLSVLQLLDRAD-PPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD- 97

Query: 95  GASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGANVVSPSHPFK 154
             S +  +  +   +  ILSSSDTS        +P+ +           A  + P  P  
Sbjct: 98  -CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAF----PNSATSIFPEAPH- 151

Query: 155 QLQKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQKN 214
                        E +                  + T+T SL +S+NSFVMPKLSL Q++
Sbjct: 152 -----------NLEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQS 200

Query: 215 PVFRLLILGRTGSSFYQSIPKEYQSLFELPK--YHDSATFPQYTGIVIIFQELREMVSLL 272
             F +LI+G+    FY+ IP+ Y  +FE+    +       +Y+ +++IF E +E   LL
Sbjct: 201 QKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELL 260

Query: 273 NRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNKRDLKKMFQRLQ 332
            ++  ++    +I +CQ GQ  Q+ N+L  + ++            ++ +D+ ++ + L 
Sbjct: 261 EKVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLN 318

Query: 333 DLSLEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXXXXXXXXXXFFTSWFT 392
            LS E                 +  S  R                            W  
Sbjct: 319 TLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQIT--------------------VNRWVI 358

Query: 393 WGISITIGISFGCCV 407
           W IS+T+G+  G C+
Sbjct: 359 WSISLTVGVGLGYCI 373

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  106 bits (265), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 89/143 (62%), Gaps = 7/143 (4%)

Query: 203 FVMPKLSLTQKNP------VFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYT 256
           F+MP+LSLT+K         FR+LI+GR  S  ++ IP ++Q+LF+L K +D   + ++T
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFT 283

Query: 257 GIVIIFQELREMVSLLNRIVQYSQGK-PVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXX 315
            I+++ QE RE++SLLNRI +  + K P+I IC+    +Q KNVLKS+LRN         
Sbjct: 284 AILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQP 343

Query: 316 XXXTNKRDLKKMFQRLQDLSLEY 338
              +N  +L +M   L++ S+++
Sbjct: 344 FVISNTEELDRMLVFLKETSIKF 366

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 61/143 (42%), Gaps = 20/143 (13%)

Query: 387 FTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPXXXXXXXXXXXXXDTINTP 446
           +  W  WGIS++IG+  G C++YF ++ +                         D+I + 
Sbjct: 434 YNKWIIWGISLSIGVGIGYCISYFGSSPW--------------SSLVQYFNPESDSI-SA 478

Query: 447 ATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKFLEN 506
               P S E F+         +  +  +  KS+  +K +  K+   +   + KPL     
Sbjct: 479 TVPVPLSNESFVLLHDS--DNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSY 536

Query: 507 LNKSSEFSIDESNRILALGYILL 529
           LN     + D+++ +LALGYIL+
Sbjct: 537 LNG---LNTDDASSLLALGYILI 556

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 17/76 (22%)

Query: 40  GLLDPHLSVLELLSK------------TGHSPSPMGQNLVT---SIDISG--NHNVNDSI 82
            +LDPHLSVLELL +               +P  +   + T   + + SG    +V D I
Sbjct: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDII 88

Query: 83  SGSWQAIQPLDLGASF 98
           S SW  IQ  DL  S 
Sbjct: 89  SQSWHTIQRRDLEESL 104

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 92/384 (23%), Positives = 154/384 (40%), Gaps = 54/384 (14%)

Query: 37  EDKGLLDPHLSVLELLSK-TGHSPSPMGQNLVTSIDISG-NHNVNDSISGSWQAIQPLDL 94
           + KG+LDPHLSVLE+L +  G     + +  V ++       +++ SIS SWQAI+  D 
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDY 86

Query: 95  GASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGANVVSPSHPFK 154
                     +  ++  ILSSSDTS                     +E A +   +H   
Sbjct: 87  SFLSGTHEVGAMHSSVGILSSSDTS---------------------EEEAEMRPSAHGTV 125

Query: 155 QLQKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQKN 214
            L   ++        +P                   T+T S+ SS+ S VMPKLSL+Q+ 
Sbjct: 126 HLGSSLA--------SPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRL 177

Query: 215 PVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFP---QYTGIVIIFQELREMVSL 271
              +LL++G+    F+ +IPK YQ LF++        +    +Y  ++++F ++ +   L
Sbjct: 178 GEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPEL 237

Query: 272 LNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNKRDLKKMFQRL 331
           L+ + + +    VIP+CQ GQ   +  +LK +               +N  +  ++ + L
Sbjct: 238 LDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHL 297

Query: 332 QDLSLEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXXXXXXXXXXFFTSWF 391
            +L  E              +  KS+   R                            W 
Sbjct: 298 HNLCNE------SESGYETELTVKSKKQHRRPRKKDAGPVA--------------LRHWA 337

Query: 392 TWGISITIGISFGCCVTYFVTAAY 415
            W  S TIGI  GCC++   T  +
Sbjct: 338 IWTASFTIGIGIGCCISLMATTRF 361

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 106/398 (26%), Positives = 159/398 (39%), Gaps = 74/398 (18%)

Query: 39  KGLLDPHLSVLEL-----LSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQPLD 93
           + +LDPHLSVLE+     L+K        G + V+     G   ++ SIS SWQ+I+  D
Sbjct: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84

Query: 94  -LGASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPA----------ADIINIIKQGQE 142
            L  S   +    Q +   ILSSSDTS        +P           + IINI  Q   
Sbjct: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSASSAFDSRIINIAGQ--- 141

Query: 143 GANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSSTNS 202
            A   + SH   + +                               +VT+  SL ++  S
Sbjct: 142 -AFSATLSHLRSEDED--------------------------DDGETVTV--SLPNTMTS 172

Query: 203 FVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFE---LPKYHDSATFPQYTGIV 259
            VMPKLSL+ +    ++LI+G+    F+ SIPK YQ +FE   L    D     +Y+ I+
Sbjct: 173 LVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIM 232

Query: 260 IIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXT 319
           +IF ++     LL+RI        +IPICQ GQ   + ++LK ++              +
Sbjct: 233 VIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMS 292

Query: 320 NKRDLKKMFQRLQDLS--LEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXX 377
           N  +  ++ + L  LS   + G            +  K++                    
Sbjct: 293 NHHEKHRLLKHLHQLSSGSDSGYETEVTVEPVKKLPRKAKK------------------- 333

Query: 378 XXXXXXXXFFTSWFTWGISITIGISFGCCVTYFVTAAY 415
                    F  W  W  SITIGI  GCCV+  V+  Y
Sbjct: 334 --RPSKPSTFRDWVVWTASITIGIGIGCCVSLMVSTRY 369

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 102/386 (26%), Positives = 157/386 (40%), Gaps = 55/386 (14%)

Query: 40  GLLDPHLSVLELLSKTG-HS-PSPMGQNLVTS---IDISGNHNVNDSISGSWQAIQPLDL 94
            +LDPHLSVL+LL +   HS P     + + S   +  S +  +  SIS SWQ+I+  D 
Sbjct: 30  SILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDY 89

Query: 95  GASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGANVVSP--SHP 152
               +    S Q     ILSSSDTS        +P+ +          GA  V P  SH 
Sbjct: 90  SILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPNEYAFAN----GAKTVFPEASHA 143

Query: 153 FKQLQKIISLPLPGKEKTPFNXXXXXXXXXXXXXXXSVTITKSLTSSTNSFVMPKLSLTQ 212
                       P                       + T+T SL +S+NSFVMPKLSL Q
Sbjct: 144 ------------PEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQ 191

Query: 213 KNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATF-----PQYTGIVIIFQELRE 267
               F +LI+G+    FY+ IP+ YQ +FE+    D+ +F      Q++ I++IF + + 
Sbjct: 192 PLRKFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTDPKN 248

Query: 268 MVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNXXXXXXXXXXXXTNKRDLKKM 327
             SLL  +   S    +I +CQ GQ  Q+ N+L  F +             ++ +D+ ++
Sbjct: 249 GQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRL 306

Query: 328 FQRLQDLSLEYGXXXXXXXXXXXAIHTKSRSYCRXXXXXXXXXXXXXXXXXXXXXXXXFF 387
            + L  LS E                 +     R                          
Sbjct: 307 LRYLYTLSNEIDSEYDTEVGPRKVRKRRKSYKKRETPAA--------------------V 346

Query: 388 TSWFTWGISITIGISFGCCVTYFVTA 413
             W  W IS+T+G+  G C++  +++
Sbjct: 347 NRWVIWSISLTVGVGIGYCISCLLSS 372

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 92/410 (22%), Positives = 163/410 (39%), Gaps = 71/410 (17%)

Query: 41  LLDPHLSVLELLSKTGHSPSPMGQNLVTSIDI------SGNHNVND--------SISGSW 86
           +LDPH SV++LL+  G         L+ + D+      S N + ND         ++ SW
Sbjct: 41  ILDPHDSVMDLLN--GQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98

Query: 87  QAIQP-----LDLGASFIPERCSSQTTN---GSILSSSDTSXXXXXXXXAPAADIINIIK 138
           QAI       L+ G        S+   N   G +LSS DTS        AP+ ++    +
Sbjct: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSASQQ 157

Query: 139 QGQ------------EGANVVSPSHPFKQLQKIISLPLPGKEKTPFNXXXXXXXXXXXXX 186
             Q            +  N  +  H F     + S        T                
Sbjct: 158 HNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKS--------TKTGQFSKAELGAGTGE 209

Query: 187 XXSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLIL--GRTGSSFYQSIPKEYQSLFELP 244
             ++ +    + + + FVMPKLSL++    F++LIL  G + +SFY  + + ++ +F++ 
Sbjct: 210 DETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVG 269

Query: 245 KYHDSATFP--QYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKS 302
           K ++++     +YT  +IIF + +++ ++LNR+ +      +IPICQ GQ   V   +K+
Sbjct: 270 KLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKT 329

Query: 303 FLRNXXXXXXXXXXXXTNKRDLKKMFQRLQDLSLEYGXXXXXXXXXXXAIHTKSRSYCRX 362
           F  +            ++  ++  + + L  L +E                TK R   + 
Sbjct: 330 FANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIPKK----TKPRKGAK- 384

Query: 363 XXXXXXXXXXXXXXXXXXXXXXXFFTSWFTWGISITIGISFGCCVTYFVT 412
                                      W+ W ISI +G+  GCCVT++ +
Sbjct: 385 -----------------KKPAPHLAKRWWFWPISIALGVGIGCCVTFYFS 417

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 193 TKSLTSSTNSFVMPKLSLTQKNPVFRLL-ILGRTGSSFYQ 231
           + S TSS+N FVMP+LS ++K    + + ++G    SFYQ
Sbjct: 110 SASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 37 EDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAI 89
          E + +++PH SVL+LL      P P    +  S +   + N    +S SWQ +
Sbjct: 13 ERRSVIEPHYSVLDLLEANMGGPPPSANVISNSTNTQNDWNAIIDLSDSWQIL 65

>Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}
           similar to Ashbya gossypii AFR085W
          Length = 796

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 58/118 (49%), Gaps = 9/118 (7%)

Query: 192 ITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEY---QSLFELPKYHD 248
           + + L+S+ N+ +   LS+  ++     L LG T +SF +   ++Y        L K ++
Sbjct: 684 VVQDLSSARNANI---LSIEDEHDWGSNLNLGNTSNSFNEIAKRQYLPSDPTLLLAKINE 740

Query: 249 SATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRN 306
            A   Q   ++     LREMVS +N++   ++G+  I +   G  +  ++ ++  LR+
Sbjct: 741 EA---QINKVIRARAPLREMVSYMNKLRMLTKGRGSIHMDYWGMELASQDRIRDILRD 795

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,164,516
Number of extensions: 1581730
Number of successful extensions: 4213
Number of sequences better than 10.0: 22
Number of HSP's gapped: 4258
Number of HSP's successfully gapped: 44
Length of query: 529
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 415
Effective length of database: 40,409,475
Effective search space: 16769932125
Effective search space used: 16769932125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)