Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL092Wna 1ON63363333000.0
Smik_9.87na 1ON63263613970.0
Skud_9.81na 1ON64865311101e-143
Suva_9.107na 1ON65761710271e-130
NDAI0E04940singletonON193124880.019
TPHA0K018804.64ON849104716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL092W
         (633 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative pr...  1275   0.0  
Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W (...   542   0.0  
Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W ...   432   e-143
Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W...   400   e-130
NDAI0E04940 Chr5 (1121677..1122258) [582 bp, 193 aa] {ON}              39   0.019
TPHA0K01880 Chr11 (393869..396418) [2550 bp, 849 aa] {ON} Anc_4....    32   6.5  

>YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and to
           the nucleus
          Length = 633

 Score = 1275 bits (3300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/633 (97%), Positives = 620/633 (97%)

Query: 1   MVQMRSKNMAYESGTNNYSDTIANGNTLPPXXXXXXXXXXXXXETLPIACNNFCVTRQID 60
           MVQMRSKNMAYESGTNNYSDTIANGNTLPP             ETLPIACNNFCVTRQID
Sbjct: 1   MVQMRSKNMAYESGTNNYSDTIANGNTLPPRSKKGHSGRRKRSETLPIACNNFCVTRQID 60

Query: 61  DDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSG 120
           DDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSG
Sbjct: 61  DDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSG 120

Query: 121 RAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLE 180
           RAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLE
Sbjct: 121 RAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLE 180

Query: 181 AFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRAS 240
           AFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRAS
Sbjct: 181 AFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRAS 240

Query: 241 NHKKYRYKNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDP 300
           NHKKYRYKNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDP
Sbjct: 241 NHKKYRYKNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDP 300

Query: 301 KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLSDLHTNLKNSKSQQCAVE 360
           KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLSDLHTNLKNSKSQQCAVE
Sbjct: 301 KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLSDLHTNLKNSKSQQCAVE 360

Query: 361 PISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPI 420
           PISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPI
Sbjct: 361 PISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPI 420

Query: 421 TSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKD 480
           TSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKD
Sbjct: 421 TSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKD 480

Query: 481 IAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRK 540
           IAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRK
Sbjct: 481 IAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRK 540

Query: 541 CYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT 600
           CYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT
Sbjct: 541 CYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT 600

Query: 601 GSAKSENIETKSRKFPEVINPFLVNTTNKKESD 633
           GSAKSENIETKSRKFPEVINPFLVNTTNKKESD
Sbjct: 601 GSAKSENIETKSRKFPEVINPFLVNTTNKKESD 633

>Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W
           (REAL)
          Length = 632

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/636 (49%), Positives = 400/636 (62%), Gaps = 21/636 (3%)

Query: 9   MAYESGTNNYSDTIANGNTLPPXXXXXXXXXXXXXETLP-IACNNFCVTRQIDDDEQAFK 67
           MA +S TN+    + NG+ L                  P I   NF V RQ DD++QA  
Sbjct: 1   MADKSSTNDGDSLVTNGHILSQRGSKKAYNKCKKKNVAPSIRWKNFGVARQADDEQQASL 60

Query: 68  MLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSGRAKTWFD 127
           +LDK+SHLKKFS+ +GDD N+FVQWADDITD L GL CTG FLKLLISSALSGRAK WFD
Sbjct: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120

Query: 128 STTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLEAFAHKSG 187
           ST EGIDD+V+ AY+ EKFLALLSEEFDGA+ LRRE FT+LL L IDSEKSLE F++ S 
Sbjct: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180

Query: 188 RLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRASNHKKYRY 247
            LTPYYLS+ AALDLFLTKLEPQ QK+LEN  FPMTL++ALL+TACEFAKRAS+H+K R 
Sbjct: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240

Query: 248 KNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDPKRRKQNE 307
           KNT D DI T K + T + +K   TK I +N    KS++K  F +    IPD KRRKQ+E
Sbjct: 241 KNTSDFDIGTSKKRATNL-NKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRKQSE 299

Query: 308 PGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLS---DLHTNLKNSKSQQCAVEPISI 364
            G++  LV+ E K   + R VS N   SKNG +NLS   D H  LK++KSQQ A    S 
Sbjct: 300 CGIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADSATSN 359

Query: 365 LNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPITSNI 424
           L +  L++ T    LI  +V+  K E T Y+E  DG   SL  R  AVK+N+LQ ++SN 
Sbjct: 360 LINNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFMSSNS 419

Query: 425 FQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKDIAQF 484
           F++  +I  ++  S+    ++ S S T +MF    S  + +  + NE+S S+++K +  +
Sbjct: 420 FKECGKIHDSRTRSISGGNMTISSSQTMHMFSRPGSLAIDHQARNNEVSMSNRIKVVDNY 479

Query: 485 NPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRKCYPL 544
           NPF  N     L  S+S K+   SM ++ LS   GL+N     YE+++   L ++K YPL
Sbjct: 480 NPFTAN-----LKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQLSSKKSYPL 534

Query: 545 HNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKATGSA- 603
           +NFAVRTR+AHFNDRPSNY S H   + T  S +S  +IQC TR    +    K   S+ 
Sbjct: 535 NNFAVRTRNAHFNDRPSNYTSAHAITSVTYPSSSSISTIQCFTRPNSKEPSPKKVIISSC 594

Query: 604 ----KSENIETKSRK------FPEVINPFLVNTTNK 629
               K E   TKS++      F EV NPFLVN   K
Sbjct: 595 MVAQKKELANTKSKEAKNRSSFNEVTNPFLVNVIEK 630

>Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W
           (REAL)
          Length = 648

 Score =  432 bits (1110), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 278/653 (42%), Positives = 378/653 (57%), Gaps = 36/653 (5%)

Query: 9   MAYESGTNNYSDTIANGNTLPPXXXXXXXXXXXXXETLP-IACNNFCVTRQIDDDEQAFK 67
           M  +S TN  +DTI NG TLP                +  I C NF + +  DD+EQ  K
Sbjct: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTCRSRRKKSVVSSIKCKNFGLAKPADDEEQVSK 60

Query: 68  MLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSGRAKTWFD 127
           +LDK++HLKKFSA++GDD ++FVQW DDI++ L GL CTGTFLKLLISSALSGRAK WFD
Sbjct: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120

Query: 128 STTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLEAFAHKSG 187
            TTEGIDDH++K Y+ E FLALLS EFDGAR LRRE F+ELL L IDSE SLE FA+ SG
Sbjct: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGARFLRRERFSELLNLPIDSETSLEKFANISG 180

Query: 188 RLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRASNHKKYRY 247
            LTPYYLSS A LDL LTKL P LQKQL++ AFPMTL++ALL+ ACEFAK AS       
Sbjct: 181 LLTPYYLSSSATLDLLLTKLGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIE----- 235

Query: 248 KNTRDSDICTPKSKNTAIVSKLSNTKTISKNKV--------IEKSDKKNYFDKNSQHIPD 299
           +N  + +I +  + ++             K K          EK  +K Y ++    IP 
Sbjct: 236 RNDINDNIISSGATSSKKKKSTFKDSKKYKAKTTKGTTDIDFEKDVRKGYNNEMEPQIPS 295

Query: 300 PKRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTS---KNGHTNLSDLHTNLKNSKSQQ 356
            KRRKQ+E   +L L M +    L S N  AN Y     ++   N  D    LK++K Q 
Sbjct: 296 CKRRKQSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNKHQS 355

Query: 357 CAVEPISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNS 416
             V  I+ L+S    T T +  L +D+   T+++T  YD+  D  S S +    A ++++
Sbjct: 356 YVVNAIATLDSDRTFTSTTSTALADDKSEYTRDKTIFYDKPTDEPSLSSSGGNYAARRDT 415

Query: 417 LQPITSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEY--MFPPTSSATVSN--PVKKNEI 472
           L  +TS  F+ + ++   ++  +    +SN  ++  Y  M   + SA V N   VKK + 
Sbjct: 416 LHSMTSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQF 475

Query: 473 SKSSQVKDIAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSK 532
            KS+Q++DI   NPF +N+ EKK+   +  ++P  S+++N LS    L   P +   ++K
Sbjct: 476 IKSNQIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEK-PRSANIENK 534

Query: 533 MLNLKTRKCYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPAS-FDSIQCITRSKR 591
              L T+K YPLHNFAVRTR+A F++RPSNY S H  I   +R  ++    IQ  +RS  
Sbjct: 535 RSELLTQKFYPLHNFAVRTRNAQFSERPSNYTSAH-GIKGNIRPLSTNIQKIQSFSRSGS 593

Query: 592 VDAETN----------KATGSAKSENIETKSRKFPEVINPFLVNT-TNKKESD 633
             A+TN          +   S  SEN E  +R F +V NPFL NT + +K+S+
Sbjct: 594 RKADTNTEVISSHMLVQHKRSVNSENRE-GNRTFNDVTNPFLANTMSGRKQSN 645

>Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W
           (REAL)
          Length = 657

 Score =  400 bits (1027), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 255/617 (41%), Positives = 353/617 (57%), Gaps = 38/617 (6%)

Query: 48  IACNNFCVTRQIDDDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTG 107
           + C NF + R  DD++Q   + DK++HLKKFSAE+ DD N+FVQW+DDITD L GL  TG
Sbjct: 36  VRCENFGIARTDDDEKQVSMIFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTG 95

Query: 108 TFLKLLISSALSGRAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTE 167
           TFLKLLISSAL+GRAK WFDSTTEGIDDH I+ Y+ EKFLALLS EFDG R LRRE F E
Sbjct: 96  TFLKLLISSALTGRAKKWFDSTTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAE 155

Query: 168 LLTLSIDSEKSLEAFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLA 227
           LL LSI+SE SLE FA  S  LTPYYLSS AALDLFLTKL+P LQKQL + AFPMTL++A
Sbjct: 156 LLKLSINSETSLEKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIA 215

Query: 228 LLITACEFAKRASNHKKYRYKNTR---------DSDICTPKSKNTAIVSKLSNTKTISKN 278
           LL+ ACEFAK  S  +K +              D D  T K ++T   +K    K+I +N
Sbjct: 216 LLVAACEFAKGTSEERKDKNAENNNNNNDSNPIDLDPSTRKKRDTVKTNKKCKRKSIHEN 275

Query: 279 --KVIEKSDKKNYFDKNSQHIPDPKRRKQNEPGMRLFLVMDEEKNIL-TSRNVS-ANAYT 334
               I+KS+ K   ++    +  PKRR+QNE G ++ L      +IL  ++N+S  NA  
Sbjct: 276 IDNAIKKSNGKKNVNEEELQVLHPKRRRQNESGKQISLPTAALADILPLNQNISNINASN 335

Query: 335 SKNGHTNLSDLHTNLKNSKSQQCAVEPISIL--NSGSLVTGTINIDLINDEVLGTKEETT 392
            +   ++  D +T+LK++  Q        IL  N    +T      L  D+V   K ET 
Sbjct: 336 KQFNASSSLDSYTSLKSNSFQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETN 395

Query: 393 TYDERMDGNSRSLNERCCAVKKNSLQPITSNIFQKNAEIQGTKIGSVLDSGISN------ 446
            +DE ++    SL      VKK+  + ++    + N  +  + + S L    SN      
Sbjct: 396 IHDEAINDIPLSLASSNDFVKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARR 455

Query: 447 ----SFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKDIAQFNPFMTNEKEKKLNPSESF 502
                 SS   +F P  +A   +   K   ++++++ +I + NPF  NE   K + S+  
Sbjct: 456 SHATHVSSHSNIFKPAQTACYDS--NKTNFTENNKIGEINKLNPFTKNENTIKSDKSKGP 513

Query: 503 KSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRKCYPLHNFAVRTRSAHFNDRPSN 562
           K+P  S+++N+ S    L   P +++ +++ + L  +K YPLHNFAVRTR+A FNDRPSN
Sbjct: 514 KNPVTSVKVNKPSYFIDLEK-PQSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSN 572

Query: 563 YISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT----------GSAKSENIETKS 612
           Y S H  +NA        ++IQC+++  + +A+TNK            G+  S   +   
Sbjct: 573 YTSAHGNLNAIHPLSLKINNIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDND 632

Query: 613 RKFPEVINPFLVNTTNK 629
            +   V NPFL NT N+
Sbjct: 633 GRSNSVENPFLGNTLNE 649

>NDAI0E04940 Chr5 (1121677..1122258) [582 bp, 193 aa] {ON}
          Length = 193

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 2/124 (1%)

Query: 92  WADDITDILFGLCCTGTFLKLLISSALSGRAKTWFDSTTEGIDDHVIKAYSFEKFLALLS 151
           WA+ I   L      G     L+ S LS  A+ WF  T + + D  I++   + FL L+ 
Sbjct: 60  WAEKIAWTLKNSAAKGFDAASLVESRLSSPAENWFIETIKDLGD-TIESERPQFFLNLVI 118

Query: 152 EEFDGARSLRREIFTELLTLSIDSEKSLEAFAHKSGRLTPYYLSSGAALDLFLTKLEPQL 211
           E+F    +L+ +  ++L+ L I S +S   F   S  L   Y+S    L++F++K+   +
Sbjct: 119 EKFKDL-NLKTKRLSKLMNLRITSGESGHIFERTSLELPEEYISRQCLLEIFVSKVPSFI 177

Query: 212 QKQL 215
           +  L
Sbjct: 178 RDHL 181

>TPHA0K01880 Chr11 (393869..396418) [2550 bp, 849 aa] {ON} Anc_4.64
           YGR157W
          Length = 849

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 6/104 (5%)

Query: 473 SKSSQVKDIAQFNPF-MTNEKEKKLNPSESFKSPGVSMEINRL-SRIAGLRNIPGNIYED 530
           S SS  KDI +F+ + + +    K++P+  FK  G+  +IN L ++I     +P +IY +
Sbjct: 610 SVSSGDKDIFKFSKYKLEHNNTDKISPNSEFKVEGLQNDINLLPNKITVSWKLPASIYNE 669

Query: 531 SKMLNLKTRKCYPLHNFAVRTRSAHFNDRPSNYIS--PHETINA 572
              + L       + N  +RTR +  N   +   S  PH  IN+
Sbjct: 670 KSWIGL--YNVLDVGNDRLRTRVSSMNHWSATSKSAYPHNPINS 711

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,586,478
Number of extensions: 3132515
Number of successful extensions: 11307
Number of sequences better than 10.0: 202
Number of HSP's gapped: 11912
Number of HSP's successfully gapped: 213
Length of query: 633
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 517
Effective length of database: 40,180,143
Effective search space: 20773133931
Effective search space used: 20773133931
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)