Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL091C (UTP25)2.292ON72172134210.0
Smik_9.882.292ON72472430840.0
Skud_9.822.292ON72272429660.0
Suva_9.1082.292ON72272429310.0
NDAI0B035302.292ON73971824910.0
NCAS0B062302.292ON72371924040.0
KAFR0J013402.292ON72873023870.0
KNAG0A054002.292ON72173423290.0
SAKL0E07546g2.292ON71872523120.0
TBLA0B059702.292ON71972522950.0
TDEL0G022202.292ON71070822630.0
Kpol_1039.462.292ON70456322390.0
KLLA0E08229g2.292ON70471222260.0
TPHA0D015202.292ON71672122170.0
KLTH0G10494g2.292ON74775122050.0
ZYRO0A02002g2.292ON70971221900.0
CAGL0D04180g2.292ON70057021850.0
Kwal_27.115032.292ON72772721850.0
Ecym_33312.292ON70871521470.0
ADL209C2.292ON70456620640.0
Smik_4.4908.469ON587251940.010
Ecym_13958.469ON565374890.043
Skud_4.5058.469ON604249890.046
TBLA0C055802.164ON540115780.94
KLLA0C15433g8.469ON539199761.7
YDR243C (PRP28)8.469ON588257742.7
TPHA0C018608.469ON607278734.2
NCAS0G025602.164ON556109716.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL091C
         (721 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...  1322   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...  1192   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...  1147   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...  1133   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   964   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   930   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   924   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   901   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   895   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   888   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   876   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   867   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   862   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   858   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   853   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   848   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   846   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   846   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   831   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   799   0.0  
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    41   0.010
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...    39   0.043
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    39   0.046
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...    35   0.94 
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...    34   1.7  
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...    33   2.7  
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...    33   4.2  
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...    32   6.7  

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score = 1322 bits (3421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/721 (91%), Positives = 659/721 (91%)

Query: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXXX 60
           MSDSSVREKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHR        
Sbjct: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSD 60

Query: 61  XXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTE 120
                              YDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTE
Sbjct: 61  VDSGDDFDIEDEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTE 120

Query: 121 HGPVDDQLEIENGLLGNHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKLSNA 180
           HGPVDDQLEIENGLLGNH                    QDPFESHFNQVPEKFVDKLSNA
Sbjct: 121 HGPVDDQLEIENGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNA 180

Query: 181 FKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQNGLL 240
           FKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQNGLL
Sbjct: 181 FKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQNGLL 240

Query: 241 DKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKN 300
           DKKTDPLTALQKKLVDPMFQYKDIL               LYALHVLNHIYKTRDRILKN
Sbjct: 241 DKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKN 300

Query: 301 NQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRD 360
           NQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRD
Sbjct: 301 NQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRD 360

Query: 361 DSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILEN 420
           DSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILEN
Sbjct: 361 DSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILEN 420

Query: 421 TDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYI 480
           TDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYI
Sbjct: 421 TDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYI 480

Query: 481 NEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIF 540
           NEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIF
Sbjct: 481 NEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIF 540

Query: 541 QRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKT 600
           QRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKT
Sbjct: 541 QRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKT 600

Query: 601 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNP 660
           TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNP
Sbjct: 601 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNP 660

Query: 661 EFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEF 720
           EFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEF
Sbjct: 661 EFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEF 720

Query: 721 K 721
           K
Sbjct: 721 K 721

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score = 1192 bits (3084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/724 (81%), Positives = 625/724 (86%), Gaps = 3/724 (0%)

Query: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSAR-TEGGSTETLEDVAEDIDHRXXXXXXX 59
           M+  SVREKND+FRGYRKRGRQELRKIKRSS R T+  S   ++ VA++I H        
Sbjct: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60

Query: 60  XXXXXXXXXXXXXXX-XXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHEN 118
                                YDALLTILKSEHPEPKRR+ +ADE NKA A+   +E+ N
Sbjct: 61  DIGSEEDNLDVEDEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120

Query: 119 TEHGPVDDQLEIENGLLGNHXXXXXXXXXXXXXXXXXXX-XQDPFESHFNQVPEKFVDKL 177
            E+ PVD+QLEIENGLLG+                      QDPFESHFNQV EK+VD L
Sbjct: 121 VEYEPVDEQLEIENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVDDL 180

Query: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQN 237
           SNAFK+KS+KYKSVK SL D ESYIYAKP ++GEEALVESPYRSSSIYSYFLKQRLKVQN
Sbjct: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN 240

Query: 238 GLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRI 297
           GLLDKK DPLT +QKKL+DPMFQYKDIL               LYALHVLNHIYKTRDRI
Sbjct: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRI 300

Query: 298 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 357
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ
Sbjct: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360

Query: 358 FRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 417
           FRDDSLPP+SKPKSFQHIF+GNT+DFFVVGLKFTRKAIKLYSNFYQSDII+CSPLGIQMI
Sbjct: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420

Query: 418 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRM 477
           LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDH+NKIPDQQHEADFSRIRM
Sbjct: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480

Query: 478 WYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIR 537
           WYINEQAKLFRQTMVFTKYISPAANSLINGRC NMAGRWKNHKVIGSE+SSIGQ GLK+R
Sbjct: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540

Query: 538 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMK 597
           QIFQRFDIIGNSIIEEPDYRFKFFTSVIIP IVKS GYEDGIL+YIPDYTDFIRIRNYMK
Sbjct: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600

Query: 598 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 657
           EKTTILFGDINEYS+QRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP
Sbjct: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660

Query: 658 NNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEI 717
           NNPEFYNE VRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE+
Sbjct: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720

Query: 718 YEFK 721
           YEFK
Sbjct: 721 YEFK 724

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/724 (78%), Positives = 608/724 (83%), Gaps = 5/724 (0%)

Query: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSAR-TEGGSTETLEDVAEDIDHRXXXXXXX 59
           MS +SVRE  D+ RG+RKRGRQELRKIKRSS R TE    + ++ VAE+   R       
Sbjct: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVS 60

Query: 60  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENT 119
                               YDALLTILKSEHPEPKR + +A+ES+    +   D +EN 
Sbjct: 61  DVGSEDDLDVGDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQ--SDGNENA 118

Query: 120 EHGPVDDQLEIENGLLGNHXXXXXX--XXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKL 177
           E  PVDDQLEIENGLLG+                       QDPFESHFNQVPEK VD L
Sbjct: 119 ESEPVDDQLEIENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDL 178

Query: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQN 237
           SNAFK+K+++YKSVK  L+  ESYIYA+PVV+GEE+ VESPY+SSSIYSYFLKQRLK+QN
Sbjct: 179 SNAFKSKNIRYKSVKAPLNGDESYIYAQPVVVGEESSVESPYKSSSIYSYFLKQRLKIQN 238

Query: 238 GLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRI 297
           GL DKK DPL ALQ+KLVDPMFQYKDIL               LY LHVLNHIYKTRDRI
Sbjct: 239 GLQDKKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRI 298

Query: 298 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 357
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR+VAYRVVDKIISKSGIDQVDKKGKFYDQ
Sbjct: 299 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQ 358

Query: 358 FRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 417
           FRDDSLPPKSKP+SFQHIF+GNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI
Sbjct: 359 FRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 418

Query: 418 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRM 477
           LENTDKKKRQDDFLSSIE+MVIDQLHSIEYQNISHI TIFDHLNKIPDQQHEADFSRIRM
Sbjct: 419 LENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRM 478

Query: 478 WYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIR 537
           WYINEQAK FRQTMVFTKYISP  NSLINGRCRNMAGRWKNH+ IG E SSIGQ GLKIR
Sbjct: 479 WYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIR 538

Query: 538 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMK 597
           QIFQRFD IGNSI+EEPDYRFKFFTSV+IP IVKSTGYEDGILIYIPDYTDFIRIRNYMK
Sbjct: 539 QIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMK 598

Query: 598 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 657
           EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRY+IKGVKSV+FYKPP
Sbjct: 599 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPP 658

Query: 658 NNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEI 717
           NNPEFY+E VRFIGKNAF GNTDLNISTVRCIYSKLDG+SLERIVGTKRAAVLSHAQKE+
Sbjct: 659 NNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEV 718

Query: 718 YEFK 721
           YEFK
Sbjct: 719 YEFK 722

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score = 1133 bits (2931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/724 (78%), Positives = 606/724 (83%), Gaps = 5/724 (0%)

Query: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSAR-TEGGSTETLEDVAEDIDHRXXXXXXX 59
           MS  S RE +++FRG+RKRGRQE+RKIKR++AR TE   T  ++ VAE+           
Sbjct: 1   MSGKSARENDEHFRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAIS 60

Query: 60  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRRRREAD-ESNKAPAEVGEDEHEN 118
                               YDALLTILKSEHPEPKR++ +A  E+N+A  + G +E  N
Sbjct: 61  DAGSESDLDIGDEEEKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNE--N 118

Query: 119 TEHGPVDDQLEIENGLLGNHXXXXXXXXXXXXXXXXXXX-XQDPFESHFNQVPEKFVDKL 177
           T+  PVDDQLEIENGLL +                      QDPFESHFNQV EK+VD +
Sbjct: 119 TDSEPVDDQLEIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDV 178

Query: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQN 237
           SNAFK  ++KYKSVK  L D ES IY+KPVV G+E  VE PY+SSSIYSYFLKQRLK+QN
Sbjct: 179 SNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDETPVERPYKSSSIYSYFLKQRLKIQN 238

Query: 238 GLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRI 297
           GLLDKK DPLT+LQKKLVDPMFQYKDIL               LY LH LNHIYKTRDRI
Sbjct: 239 GLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRI 298

Query: 298 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 357
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR+ AY VVDKII KSGIDQVDKKGKFYDQ
Sbjct: 299 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQ 358

Query: 358 FRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 417
           FRDDSLPP SKPKSFQHIFRGNT+DFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI
Sbjct: 359 FRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 418

Query: 418 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRM 477
           LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDH+NKIPDQQHEADFSRIRM
Sbjct: 419 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 478

Query: 478 WYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIR 537
           WYINEQAKL RQTMVFTKYISPAANSLINGRCRN+AGRWKNHKVI SE SSIGQ GLKIR
Sbjct: 479 WYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIR 538

Query: 538 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMK 597
           QIFQRFDIIGNSIIEEPDYRFKFFTSVIIP IVKSTGYEDGILIYIPDYTDFIRIRNYMK
Sbjct: 539 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMK 598

Query: 598 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 657
           EKTTILFGDINEYSSQ+QLNANRSLFQQGR+KV+LYTERLHHYRRYEIKGVK+V+FYKPP
Sbjct: 599 EKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPP 658

Query: 658 NNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEI 717
           NNPEFYNE VR+IGKNAFLGNTDLNISTVRC+YSKLDGLSLERIVGTKRA VLSHAQKE+
Sbjct: 659 NNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEV 718

Query: 718 YEFK 721
           YEFK
Sbjct: 719 YEFK 722

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/718 (66%), Positives = 551/718 (76%), Gaps = 14/718 (1%)

Query: 16  YRKRGRQELRKIKRSSARTEGGSTETLE--DVAEDIDHRXXXXXXXXXXXXXXXXXXXXX 73
           +RKRGRQELR I+RS+A+     +   E  D  E +                        
Sbjct: 24  HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDED 83

Query: 74  XXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQL----- 128
                 Y ALLTIL++EHPEPK +R+  ++  K   +V +    NT     +D +     
Sbjct: 84  ERKGKVYGALLTILETEHPEPKHKRQPKEKLLKE--QVSDSNLNNTGDRETEDSIIEEDE 141

Query: 129 --EIENGLLGNHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKLSNAFKTKSV 186
             +IENGLL                       QDPFESHFN+  E+FVDKL  AF+++ +
Sbjct: 142 TEQIENGLLDRDDEQSDDDQLNDSNDVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201

Query: 187 KYKSVKGSLSDSESYIYAKPVVIGEEA---LVESPYRSSSIYSYFLKQRLKVQNGLLDKK 243
           KYK+ K  + DS S I +KP + GEE     + S     SI+SYF+KQRLK+QN LL+ K
Sbjct: 202 KYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPK 261

Query: 244 TDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQR 303
            DPLT LQK+L+DPMFQYKDIL               LYALH LNH+YKTRDRILKNNQR
Sbjct: 262 VDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQR 321

Query: 304 LQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 363
           LQDN DTE+LDQGFTRPKVLIVVPTR+ AY V DKII KSG+DQVDKKGKFYDQF+DDSL
Sbjct: 322 LQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSL 381

Query: 364 PPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDK 423
           PP SKPKSFQ IF+GNTNDFFV+GLKFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDK
Sbjct: 382 PPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDK 441

Query: 424 KKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQ 483
           KKRQDDFLSSIEL+++DQLHS+EYQN++HIFTIFDHLNKIP +QH+ADFSRIRMWYIN+Q
Sbjct: 442 KKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQ 501

Query: 484 AKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRF 543
           AKLFRQTMVFTKY+SPAAN++IN RCRN  GRWKNHK++  E SSIG+ GLKI+QIFQRF
Sbjct: 502 AKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRF 561

Query: 544 DIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTIL 603
           DI+G SI++EPDYRFK FTSVIIP IVKST Y+DGILIYIPDYTD++RIRNY+KEKT IL
Sbjct: 562 DIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRIL 621

Query: 604 FGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFY 663
           FGDINEYS QR+LN+NRSL QQGR+KV+LYTERLHHYRRYEIKGVKSVVFYKPP NPEFY
Sbjct: 622 FGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFY 681

Query: 664 NEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           NEVVRFIGKNAFLGNTDLNISTVR +Y KLDGLSLERIVGTKRA +L HAQ E+YEFK
Sbjct: 682 NEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/719 (64%), Positives = 546/719 (75%), Gaps = 20/719 (2%)

Query: 15  GYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXXXXXXXXX 74
           G +KRGRQELR I+RS A  +  S E       D + +                      
Sbjct: 13  GSKKRGRQELRTIRRS-AGAKVSSQEVFNSSIVDDEEQELNESNESEQEEDIDEEEKKNK 71

Query: 75  XXXXXYDALLTILKSEHPE----PKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEI 130
                Y ALLTILKSEHPE     K+R  ++       +E+  D+ ++ E   +D+  +I
Sbjct: 72  V----YGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDE---IDEAQQI 124

Query: 131 ENGLLGNHXXXXXXXXXXXXXXXX-----XXXXQDPFESHFNQVPEKFVDKLSNAFKTKS 185
           E+GL                             QDPFESHFNQV EK  D L+ AF T S
Sbjct: 125 EDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGS 184

Query: 186 VKYKSVKGSLSDSESYIYAKPVVIGEEALVE---SPYRSSSIYSYFLKQRLKVQNGLLDK 242
           VKYKS K  + D+++ I + P +IG+E   E   S  +SSSI+SYFLKQRL+V N +LD 
Sbjct: 185 VKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDS 244

Query: 243 KTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQ 302
           K DPL  LQK+LVDPMFQY+DIL               LYALH LNH+YKTRDRILK+N 
Sbjct: 245 KKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNG 304

Query: 303 RLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDS 362
           RLQDN DTE+ DQGFTRPKVLIVVPTR+ AY V+ KIISKSG+DQVDKKGKF DQF D++
Sbjct: 305 RLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDET 364

Query: 363 LPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTD 422
           LPP SKPKSFQHIF+GNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTD
Sbjct: 365 LPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTD 424

Query: 423 KKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINE 482
           KK RQDDFLSSIE+++IDQLHSIEYQN++H+FTIFDHLNKIP+QQHEADFSRIRMWYIN+
Sbjct: 425 KKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYIND 484

Query: 483 QAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQR 542
           QA+LFRQTM+FTKY++PAAN+LIN RCRN AGRWKNH++I  E S+I Q GLK++Q FQR
Sbjct: 485 QARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQR 544

Query: 543 FDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTI 602
           FD++G S+I+EPDYRFK F+SVIIP IVKST Y DGILIYIPDYTD++RIRNY+KEKTT+
Sbjct: 545 FDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTL 604

Query: 603 LFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEF 662
           LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYE+KGVKSVVFYKPP NPEF
Sbjct: 605 LFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEF 664

Query: 663 YNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           YNEVVR+IGK+AFLGN DLNISTVR +Y KLDGLSLERIVG+KRA +L HAQ E+YEF+
Sbjct: 665 YNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/730 (64%), Positives = 559/730 (76%), Gaps = 29/730 (3%)

Query: 11  DNFRGYRKRGRQELRKIKRSSAR-----TEGGSTETLEDVAEDIDHRXXXXXXXXXXXXX 65
           D + G RKRGR+ELR I+R+  R      E G+  ++ +   +++               
Sbjct: 9   DGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDE 68

Query: 66  X--XXXXXXXXXXXXXYDALLTILKSEHPEPKRRRREA------DESNKAPAEVGEDEHE 117
                           Y ALLTILKSEHPEPK++++E       D   +  ++  E+E +
Sbjct: 69  VGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEEED 128

Query: 118 NTEHGPVDDQLEIENGLLGNHXXXXXXXXXXX--XXXXXXXXXQDPFESHFNQVPEKFVD 175
            T+        +IEN L+G+H                      QDPFE+HFN V EKF D
Sbjct: 129 ETQ--------QIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTD 180

Query: 176 KLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYR----SSSIYSYFLKQ 231
           KL  +FK   +KYKS K  +S+ E  I++KPV+  +E  +ESP       SSI+SYFLKQ
Sbjct: 181 KLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDE--IESPVELSVNKSSIHSYFLKQ 238

Query: 232 RLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIY 291
           RLK+QN L+D K DPLT LQK+LVDPMFQYKDIL               LY+LHVLNH+Y
Sbjct: 239 RLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLY 298

Query: 292 KTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKK 351
           KTRD+ILKNNQRLQDN DTE LDQGFTRPKVLIVVPTR+ AY+V++KII+KSGIDQVDKK
Sbjct: 299 KTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKK 358

Query: 352 GKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSP 411
           GKF DQF +DSLPP SKPKSFQ IF+GNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSP
Sbjct: 359 GKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSP 418

Query: 412 LGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEAD 471
           LGIQMILENTDKKKRQDDFLSSIELM+IDQLHSIEYQNISH+FTI +H+NKIP +QH+AD
Sbjct: 419 LGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDAD 478

Query: 472 FSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQ 531
           FSR+RMWYIN+QAKLFRQTM+FTKYISP ANSL+NG+C+N +GRWKNHKVI + +SSI +
Sbjct: 479 FSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISK 538

Query: 532 SGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIR 591
            G+KIRQIFQRF+ +  S+++EPDYRFKFFTSV +P IVK+TGYEDG LIYIP+YTD+IR
Sbjct: 539 VGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIR 598

Query: 592 IRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSV 651
           +RNY+K+KTTILFGDINEYS Q+QLN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVK+V
Sbjct: 599 VRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNV 658

Query: 652 VFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLS 711
           VFY+PP NPEFY EVVR+IGKNAFLGNTDLNISTVRC+YSKLD LSLE IVG+KRA VL 
Sbjct: 659 VFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLC 718

Query: 712 HAQKEIYEFK 721
           HAQ E+YEFK
Sbjct: 719 HAQNEVYEFK 728

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/734 (62%), Positives = 543/734 (73%), Gaps = 49/734 (6%)

Query: 18  KRGRQELRKIKRSSART-------EGGSTE-----------TLEDVAEDIDHRXXXXXXX 59
           KRGR+ELR +KR++ R        E    E            + D AED D         
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGD--------- 57

Query: 60  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRRR--READESNKAPAEVGEDEHE 117
                               Y ALLTILKSEHPE K+R+  + +D        V +D HE
Sbjct: 58  -------GSDSDAEARKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHE 110

Query: 118 NTEHGPVDDQLEIENGLLGNHXXXXXXXXXXXXXXX-XXXXXQDPFESHFNQVPEKFVDK 176
             E    ++Q  I+N +L N                      QDPFESHFNQ PE  ++ 
Sbjct: 111 ELEEENEEEQ--IDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINT 168

Query: 177 LSNAFKTKSVKYKSVKGSLSD-----SESYIYAKPVVIG----EEALVESPYRSSSIYSY 227
           L  AFK+K ++Y+SVK   +       E  IY++P V G     + L+ES  + S I SY
Sbjct: 169 LDAAFKSKQLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCS-IGSY 227

Query: 228 FLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVL 287
           FLK+RLK+QN LL+ K D L ++QK+LVDPMFQYKDIL               LYALH L
Sbjct: 228 FLKKRLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHAL 287

Query: 288 NHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQ 347
           NH+YKTRDRILKNNQRLQ+N DTE LDQGFTRPKVLI+ PTR+ AY +V  II+KSGIDQ
Sbjct: 288 NHVYKTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQ 347

Query: 348 VDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDII 407
           VDK+GKF DQF +DSLPP SKPKSFQ IF+GNTNDFFV+G+KFTRKAIKLYSNFYQSDII
Sbjct: 348 VDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDII 407

Query: 408 VCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQ 467
           VCSPLG+QMI+ENTDKKKRQDDFLSSIE+ +IDQLHSIEYQNISH++TIF+HLN IPD+Q
Sbjct: 408 VCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQ 467

Query: 468 HEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENS 527
           H+ADFSRIRMWYIN+QA+ FRQTMVFTKYISP ANS+ING+CRN +GRWKNH+++ +E S
Sbjct: 468 HDADFSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEAS 527

Query: 528 SIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYT 587
            IG+  L++RQIFQRF++ G SI++EPDYRFKFFTSVIIPGI+KSTGYEDGILIYIP+YT
Sbjct: 528 HIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYT 587

Query: 588 DFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKG 647
           D++R+RNY+KEKT ILFGDINEYSSQ+QL ANRSLFQQGRLKV+LYTERLHHYRRYEIKG
Sbjct: 588 DYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKG 647

Query: 648 VKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRA 707
           VKSV+FYKPP++PEFY EVVR IG+NAFLGNTDLNISTVRCIYSKLD L+LE +VGT+RA
Sbjct: 648 VKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRA 707

Query: 708 AVLSHAQKEIYEFK 721
            VL H Q EIYEFK
Sbjct: 708 GVLCHGQNEIYEFK 721

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/725 (61%), Positives = 542/725 (74%), Gaps = 29/725 (4%)

Query: 8   EKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXX 67
           E +  ++  +K GR+ELR I R++AR    S +  E+  E                    
Sbjct: 12  ESHGGYKKAKKTGRKELRTITRANARHANESKDDFEN--EPDMSSEEEELADNKPRSDEE 69

Query: 68  XXXXXXXXXXXXYDALLTILKSEHPEPK-RRRREADESNKAPAEVG------EDEHENTE 120
                       Y+ALLT+L+SEHP  K ++ RE  +  +   + G      EDE E  E
Sbjct: 70  EEEDIETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIE 129

Query: 121 HGPV---DDQLEIENGLLGNHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKL 177
           +  V   DD+ ++ + + G+                      D FE HFN V E    KL
Sbjct: 130 NALVETNDDEDDVGSDINGDEDDEDKA---------------DSFELHFNNVSELQATKL 174

Query: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEE-ALVESPYRSSSIYSYFLKQRLKVQ 236
           ++AF+ K ++YKSVK  +++ E +IY++P V GE+ + V +P    S++SYF+KQ+LK+Q
Sbjct: 175 ASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQ 234

Query: 237 NGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDR 296
           N LLD K + L  LQK LVDPMFQY+D+L               LYALHVLNH+YKTRDR
Sbjct: 235 NNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSYEQEEEYRD-LYALHVLNHVYKTRDR 293

Query: 297 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 356
           IL+N+Q+LQDN D E LDQGFTRPKVLIVVPTR+VAY++V KII KSG+DQVDK+GKF D
Sbjct: 294 ILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQD 353

Query: 357 QFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQM 416
           QF D SLPP SKPKSF+HIF+GNTNDFFV+G KFTRK +KLYSNFYQSD+I CSPLGIQ+
Sbjct: 354 QFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQL 413

Query: 417 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIR 476
           ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQN+SHI TIF H+NKIP QQH+ADFSRIR
Sbjct: 414 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIR 473

Query: 477 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKI 536
           MWYINEQA LFRQTMVFTKY SP ANSLING+CRN AGRWKNH ++  E SSI Q GLK+
Sbjct: 474 MWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKV 533

Query: 537 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYM 596
           RQIFQRFD++G S ++EPDYRFKFFTSVII  I+KSTGYEDGIL+YIPDYTD++R+RN++
Sbjct: 534 RQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHL 593

Query: 597 KEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 656
           +EKTT+LFGDINEYS Q+QL +NR+LFQQG++KV+LYTERLHH+RRYEIKGVKSV+FYKP
Sbjct: 594 REKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKP 653

Query: 657 PNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 716
           P NPEFY EVVR+IGK+AFLG+ DLNISTVRC+Y KLDGLSLER+VGTKRAAVL+H Q E
Sbjct: 654 PTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNE 713

Query: 717 IYEFK 721
           IYEFK
Sbjct: 714 IYEFK 718

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/725 (60%), Positives = 537/725 (74%), Gaps = 14/725 (1%)

Query: 4   SSVREKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXXXXXX 63
           S  + +N+   GY KRGR + R IK+SS   +   TE    V E I+             
Sbjct: 2   SGFKPQNNYSEGYGKRGRSQKRSIKKSSG-AKRFKTEDTRIVKETIEDESSDEDVSNTSI 60

Query: 64  XXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRR---RREADESNKAPAEVGEDEHENTE 120
                           YDAL+TILKSEH EPK R      + E +    ++ EDE   TE
Sbjct: 61  DKEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETE 120

Query: 121 HGPVDDQLEIENGLLG---NHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKL 177
                 + EIEN LL    +                      DPF+SHFNQ  E+F +K 
Sbjct: 121 ------EQEIENNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKF 174

Query: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVI-GEEALVESPYRSSSIYSYFLKQRLKVQ 236
           ++AFK K +KY+S+K  +++ ES IY++P ++  E+  V+SP   SSI+SY LK+RLK+ 
Sbjct: 175 ADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKIN 234

Query: 237 NGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDR 296
           N LLD   + LT +QK+LVDPMFQYKDIL               LY LHVLNHIYKTRDR
Sbjct: 235 NDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDR 294

Query: 297 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 356
           ILKNN ++QDNPD E LDQGFTRPKVLIV PTR+  Y +V++II KSGIDQ+DKK KF D
Sbjct: 295 ILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRD 354

Query: 357 QFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQM 416
           QF ++SL P SKPKSFQ +F+GN+ND+FV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+ M
Sbjct: 355 QFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHM 414

Query: 417 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIR 476
           ILENTDKKKRQDDFLSSIELM+IDQLHS+E+QNISH+ +IF+H+NKIP +QH+ DFSRI+
Sbjct: 415 ILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIK 474

Query: 477 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKI 536
           MWYIN+QAKLFRQTM+FTKYISP+AN  +NG+C+N +GRWKNHK+I    SSIGQ GL++
Sbjct: 475 MWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRV 534

Query: 537 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYM 596
           +Q+F RFDIIG SI++EPDYRFK+FTSVI+  I KST YEDG+LIYI DYTD++R+RNY+
Sbjct: 535 KQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYL 594

Query: 597 KEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 656
           KEKTTILFGDINEYS Q+Q+N+NR+LFQQ R+KV+LYTERLHH+RRYEIKGVK++VFYK 
Sbjct: 595 KEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKA 654

Query: 657 PNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 716
           P NPEFYNEVVR+IGKNAF GNTD+NIS VR IYSKLDGL+LERI+GTKRAAVL+H Q E
Sbjct: 655 PTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNE 714

Query: 717 IYEFK 721
            YEFK
Sbjct: 715 TYEFK 719

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/708 (61%), Positives = 525/708 (74%), Gaps = 13/708 (1%)

Query: 15  GYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXXXXXXXXX 74
           G  KRGR+ELR I+R          E L + +E                           
Sbjct: 15  GTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEG--EVKNHHNGMQHNEEIANVEEDEEN 72

Query: 75  XXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIENGL 134
                Y ALLTIL SEHP+PK ++    +S K      ED   + E    D+  ++E+ L
Sbjct: 73  KRRKVYGALLTILNSEHPKPKPKQEVTVQSRK------EDSESDVEEDERDEVEQLEDNL 126

Query: 135 LGNHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGS 194
                                   QD F+SHFNQVPE  VDKL  AFK + +KYKS K  
Sbjct: 127 -ARVDENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVP 185

Query: 195 LSDSESYIYAKPVVIGEEAL-VESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKK 253
           + ++ES +Y+KP+++ +++  +E P R  S+ SY  KQRLK+QN L   + + LT+ Q+ 
Sbjct: 186 IGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENLTSTQRT 242

Query: 254 LVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHL 313
           LVDPM QY D+L               LYALHVLNH+YKTRD+ILKNNQR+ DNPD ++L
Sbjct: 243 LVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYL 302

Query: 314 DQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQ 373
           DQGFTRPKVLIVVPTR+ AY+V++KII KSGIDQ+DKKGKF DQF ++SLPP SKPKSFQ
Sbjct: 303 DQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQ 362

Query: 374 HIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSS 433
           H+F+GNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSS
Sbjct: 363 HVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSS 422

Query: 434 IELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVF 493
           IE+ + DQLHSIEYQN+SH+ TIFDHLN IP +QH+ DF R+R+WYINEQAKLFRQTM+F
Sbjct: 423 IEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIF 482

Query: 494 TKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEE 553
           TKY+SP AN+LIN +C+NM GRWKNH  I    SSIG+ GLK+RQIFQR D+   SI+EE
Sbjct: 483 TKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEE 542

Query: 554 PDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQ 613
            D+RFKFFTSVIIP I+KSTGYEDGIL+YIPDY DFIR+RNYMKEKTTI+FGDINEYS+Q
Sbjct: 543 SDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQ 602

Query: 614 RQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKN 673
           +QLN+NR+LFQQGR KV+LYTERLHH+RRYEIKGVKSVVFY+PP NPEFY+EVVRFI K+
Sbjct: 603 KQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKS 662

Query: 674 AFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           A LG TDLNISTVR IYSKLDG+SLERIVGTKRAA+L+H Q E+YEFK
Sbjct: 663 AALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/563 (70%), Positives = 485/563 (86%), Gaps = 1/563 (0%)

Query: 160 DPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEE-ALVESP 218
           D FESHFN V +  VD +S  FK K +KYKS+K SL   ES I+ KP+++ ++   +++P
Sbjct: 142 DTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNP 201

Query: 219 YRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXX 278
             +SS  SYF+KQRLK+QN LLD   + LT L+KKL+DPMFQYKD+L             
Sbjct: 202 VLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEY 261

Query: 279 XXLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDK 338
             LY+LHVLNHIYKTRD+ILK+NQRLQ+N D E LDQGFTRPKVLIVVPTR+ AY+VV+ 
Sbjct: 262 RELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVET 321

Query: 339 IISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLY 398
           II KSG+DQ+DKKGKF DQF DDSLPP SKPKSF+H+F+GNTNDFFV+G+KFTRKAIKLY
Sbjct: 322 IIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLY 381

Query: 399 SNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 458
           SNFYQSDII+CSPLGIQMILENTDKKKRQDDFLSSIE+M++DQLHSIEYQNISH++TI +
Sbjct: 382 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILE 441

Query: 459 HLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKN 518
           H+NKIP QQ EADFSRIRMWYIN+QAK  RQTM+FT+YISP AN++ING+C NMAGRWKN
Sbjct: 442 HINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKN 501

Query: 519 HKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDG 578
           +++I SE+SSIGQ G+KI+QIFQRFD++G ++++E DYRFK+FTSV++  IVKSTGYEDG
Sbjct: 502 NQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDG 561

Query: 579 ILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLH 638
           IL+YIP+YTD++R+RNYMKEKTTILF +INEYS+Q+QL++NRS+FQQGR KV+LYTERLH
Sbjct: 562 ILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLH 621

Query: 639 HYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSL 698
           HYRRYE+KG+KSV+FYKPP NPEFYNEV+RF  KNAFLG +D+NIST+R +YSKLDGL+L
Sbjct: 622 HYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLAL 681

Query: 699 ERIVGTKRAAVLSHAQKEIYEFK 721
           +RIVG+KRAA+L H Q E Y+FK
Sbjct: 682 QRIVGSKRAAILCHGQNESYDFK 704

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/712 (61%), Positives = 524/712 (73%), Gaps = 16/712 (2%)

Query: 14  RGYRKRGRQELRKIKRSSA-RTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXXXXXXX 72
           R   K GR++LR+I R+   R       T+ D+  D                        
Sbjct: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPD-----NESDSDNAEPSVAAEREDV 59

Query: 73  XXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIEN 132
                  Y+ALLT+LKSEHPE K +  +  + +   AE  ED  EN      D+Q  IEN
Sbjct: 60  EQHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAE--EDSPENDGINSEDEQQNIEN 117

Query: 133 GL--LGNHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKS 190
            L  +                        DPFESHF++  E  +      FK K+VKYKS
Sbjct: 118 ALDDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKS 177

Query: 191 VKGSLSDSESYIYAKPVVIGEEALVESPYRS-SSIYSYFLKQRLKVQNGLLDKKTDPLTA 249
            K  +S+ ES IY+KP +  EE L   P +   ++ SYF+KQ+LK+ N   +    PLT 
Sbjct: 178 SKTDVSEEESLIYSKPCLDDEEVL---PVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTE 233

Query: 250 LQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQDNPD 309
           +QK+LVDPMFQYKD+L               LY+LH LNH+YKTRDRILKNNQ+LQ+N D
Sbjct: 234 IQKELVDPMFQYKDMLYEYDDYADEDQYRD-LYSLHALNHVYKTRDRILKNNQKLQENND 292

Query: 310 TEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKP 369
            E LDQGFTRPKVLIVVPTR+ A+++V KI+ KSG+DQ DKK KF DQF +DSLPP SKP
Sbjct: 293 EELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKP 352

Query: 370 KSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDD 429
           KSFQHIF+GNTNDFFV+GLKFTRK++K+YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDD
Sbjct: 353 KSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDD 412

Query: 430 FLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQ 489
           FLSSIE+M+IDQLHSIEYQN  H+ TIF H+NKIP+QQ EADFSRIRMWYINEQAK FRQ
Sbjct: 413 FLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQ 472

Query: 490 TMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNS 549
           T+VFTKYISP ANS++NG+CRN+AGRWKNH+ I  E SSIGQ GLK+RQIFQRFD+ G +
Sbjct: 473 TIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGT 532

Query: 550 IIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINE 609
            ++EPDYRFKFFTSVI+P IVKSTGYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+INE
Sbjct: 533 ALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINE 592

Query: 610 YSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRF 669
           YS+Q+QL +NR+ FQ G++KV+LYTERLHH+RRYEIK VKSV+FYKPP NPEFY+EVVR 
Sbjct: 593 YSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRN 652

Query: 670 IGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           IGKN FLGN D+NISTVRCIYSK+DGLSLER+VG+KRAAVL+H Q E+YEFK
Sbjct: 653 IGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/721 (60%), Positives = 537/721 (74%), Gaps = 21/721 (2%)

Query: 14  RG-YRKRGRQELRKIKRSS---ARTEGGSTET---LEDVAEDIDHRXXXXXXXXXXXXXX 66
           RG ++KRGR +LR I+RS     R  G + +T     D ++  D                
Sbjct: 4   RGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPAD-ALVSGEEAESESDDA 62

Query: 67  XXXXXXXXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDD 126
                        Y ALLTILKSEHPE K+++++ ++  +      +DE+       V D
Sbjct: 63  KDEEDVGKKRNQVYGALLTILKSEHPEKKKQKKKFNQEKEDAYNASDDEYN------VSD 116

Query: 127 QLEIENGLLGNHXXXXXXXXXXXXXXXXXXXXQDP---FESHFNQVPEKFVDKLSNAFKT 183
           + EIENGL                         D    F+ HFNQVPE  VDK+SN F  
Sbjct: 117 KQEIENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPENVVDKISNGFDN 176

Query: 184 KSVKYKSVKGSLSDSES--YIYAKPVVI-GEEALVESPYRSSSIYSYFLKQRLKVQNGLL 240
           K +KY S K  L   E   +IY+KP+V  G +  VESP + SS+ SYF+K+RL++ N LL
Sbjct: 177 KKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLL 236

Query: 241 DKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKN 300
           D K D LT LQK LVDPMFQY DIL               LY LH+LNH+YKTRD++LK+
Sbjct: 237 DGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKD 295

Query: 301 NQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRD 360
           NQRLQ+N ++E LDQGFTRPKVLIVVPTR+ AY VV+ II KSG+DQV+KKGKF  QF +
Sbjct: 296 NQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFE 355

Query: 361 DSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILEN 420
           DSLPP SKPKSFQ IF+GNTNDFFV+GLKFTRKA+KLYSNFYQSD+I+CSPLG+ MI EN
Sbjct: 356 DSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITEN 415

Query: 421 TDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYI 480
           TDKKK+QDDFLSSIE+ ++DQLHS+EYQNISHI  IF+HLNKIP +QH+ADFSRIRMWYI
Sbjct: 416 TDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYI 475

Query: 481 NEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIF 540
           N+QA+LFRQTM+FTKY+SP AN++ING+CRN+AGRW+N   + SE SS+G+ GLKIRQIF
Sbjct: 476 NDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIF 535

Query: 541 QRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKT 600
           QRFD++G ++ +EPD+RFKFF SV++  I+KSTGYEDGIL+YIP+Y+D++R+RNYMKEKT
Sbjct: 536 QRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKT 595

Query: 601 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNP 660
           T+LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVKSV+FY PP NP
Sbjct: 596 TLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNP 655

Query: 661 EFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEF 720
           EFYNEVVRFIGKNAFLGN D+NI+TVR +YSKLD LSLERIVGT+RAAVLS A+ E+YEF
Sbjct: 656 EFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEF 715

Query: 721 K 721
           K
Sbjct: 716 K 716

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/751 (57%), Positives = 534/751 (71%), Gaps = 41/751 (5%)

Query: 2   SDSSVREKNDNFRGYR--KRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXX 59
           S S+++  N+    YR  K GR++LR I+++S    G + E+    A + ++        
Sbjct: 7   SSSAIKGSNE----YRSSKSGRKQLRTIRKASGPRRGLAEES----ANEENNGSETEAED 58

Query: 60  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRRRREADE--SNKAPAEVGEDEHE 117
                               Y ALLT+LK+EH  P RR+ + D+  ++  P    +DE E
Sbjct: 59  KLAAPELNEPAQDQRAGGEAYAALLTLLKAEHGGPARRKTKTDDKKTSADPTSNVKDEEE 118

Query: 118 NTEHG------PVDDQLEIENGLLGNHXXXXXXX--------------------XXXXXX 151
           +            D++  IEN L+  H                                 
Sbjct: 119 SESRDNEDEEEDEDEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAA 178

Query: 152 XXXXXXXQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGE 211
                   D  E HFN V EK  + L  AFK K V+Y+S K  +  ++ +IY++P ++ E
Sbjct: 179 GFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNE 238

Query: 212 EA-LVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXX 270
            A  V +P  S S+ SYF+KQRLK+QN LLD + D LT LQK++VDPMFQY+D+L     
Sbjct: 239 PASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDLLYEYED 297

Query: 271 XXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRE 330
                     LYALHVLNHIYKTRDRILKNNQRLQ+NPD E LDQGFTRPKVLIV PTR+
Sbjct: 298 YDKETEYRD-LYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRD 356

Query: 331 VAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKF 390
            AY ++ KII KSG+DQVDKK KF DQF  ++LPP  KPKSFQ +F+GNTNDFFV+G KF
Sbjct: 357 AAYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKF 416

Query: 391 TRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNI 450
           TRK IKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+
Sbjct: 417 TRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNM 476

Query: 451 SHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCR 510
            H+ +IF+H+NKIP QQH+ADFSRI+MWYIN+QAKLFRQT++FTK+ SP ANSLING+CR
Sbjct: 477 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCR 536

Query: 511 NMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIV 570
           N AGRWKNH+VI  ENSS+GQ G++ R IFQRFD++G S+ EEPD RFK F SVI+P IV
Sbjct: 537 NYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIV 596

Query: 571 KSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKV 630
           KSTGYEDGIL+YIPDYTDF+R+RNY++EKTTILFGDINEYS QRQL +NR++FQQGR+KV
Sbjct: 597 KSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKV 656

Query: 631 MLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIY 690
           +LYTERLHH+RRYEIKGVK+V+FYKPP NPEF+ EV R++GK+AFLG  DLNIS VRC++
Sbjct: 657 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLF 716

Query: 691 SKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           SKLDGLSLERIVGT+RAAVL+H   E YEFK
Sbjct: 717 SKLDGLSLERIVGTERAAVLTHGPNETYEFK 747

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/712 (59%), Positives = 514/712 (72%), Gaps = 11/712 (1%)

Query: 10  NDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXXXX 69
            D   G RKRGR++LR I+R  AR +    E +E+    +                    
Sbjct: 9   TDAIDGSRKRGRKDLRSIRR--ARND---KEPVEEPEIPVASEEDGELSEDSEEDATNEV 63

Query: 70  XXXXXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLE 129
                     Y ALLTILKSEHPE ++R R   + +       +DE    E G V+  L 
Sbjct: 64  QEQEDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSEDEKGEVEANLV 123

Query: 130 IENGLLGNHXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVPEKFVDKLSNAFKTKSVKYK 189
              G                         +DPFESHFN   E  +D L  A+K K +  K
Sbjct: 124 DTPG----EEEPQSEEELSEGDEDESEDERDPFESHFNMQSES-IDSLDEAWKQKKIVNK 178

Query: 190 SVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTA 249
           S K  + D ES IY K  + G+    E P     + SY LK++LK+QN LL+ + D LT 
Sbjct: 179 SGKIRVDDDESLIYTK-TLAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTP 237

Query: 250 LQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQDNPD 309
           LQ+K+VDP+FQY+D+L               LY LHVLNHIYKTRDRILK+NQRL  NPD
Sbjct: 238 LQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPD 297

Query: 310 TEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKP 369
            E LDQGFTRPKVLIV PTR+ AY++V K+I KSG+DQVDKK K  DQF +D LPP SKP
Sbjct: 298 GEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKP 357

Query: 370 KSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDD 429
           KSF+H F+GNTNDFFV+G+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+ILENTD+KKRQDD
Sbjct: 358 KSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDD 417

Query: 430 FLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQ 489
           FLSSIELM+IDQL+SIE+QN+SH+FTIF H+NKIP +QH+ DF R+RMWYINEQAKL RQ
Sbjct: 418 FLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQ 477

Query: 490 TMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNS 549
           T++FT+Y++P AN L+NG+CRN+ GRWKNH  I  E SS+ + G ++RQIFQR D+ G S
Sbjct: 478 TLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGAS 537

Query: 550 IIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINE 609
           +++EPDYRF+FFTSVI+P I KSTGYEDGIL+YIPDY DFIR+RNY+K+KTTILFGDINE
Sbjct: 538 VVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINE 597

Query: 610 YSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRF 669
           YS  RQL + RSLFQQGR+KV+LYTERLHH+RRYEIKGVKSV+FY+PP+NPEFYNEVVR+
Sbjct: 598 YSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRY 657

Query: 670 IGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           IGK+AFLG+TDLNISTVRC+YSKLDGL+LERIV +KRAAVL+H Q EIYEFK
Sbjct: 658 IGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/570 (68%), Positives = 474/570 (83%), Gaps = 7/570 (1%)

Query: 159 QDPFESHFN-QVPEKFVDKLSNAFKTKSVKYKSVK---GSLSDS---ESYIYAKPVVIGE 211
           +DPF++HFN +   K  + L NA K   ++YKS+K   GS  +    E  I++ P + GE
Sbjct: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190

Query: 212 EALVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXX 271
              +E P    S+ SYFLK+RL++QN LLD +++ LT LQ+K+VDPM QYKDIL      
Sbjct: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250

Query: 272 XXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREV 331
                    LY LHVLNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTR+ 
Sbjct: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310

Query: 332 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFT 391
           AY++V K+I KSG+DQVDKKGKF DQF D S PP SKPKSFQHIF+GNTND+FV+G+KFT
Sbjct: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFT 370

Query: 392 RKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 451
           RKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430

Query: 452 HIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRN 511
           H+FTIFDHLNKIP +QH+ADFSRIRMWYIN+QAK FRQTM+FTKYISP ANSL+N +CRN
Sbjct: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490

Query: 512 MAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVK 571
           + GRWKNHK++ SE+SS+G  GLK+RQIFQRF+++GNS+ +EPDYRFKFFTSV+I  I K
Sbjct: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550

Query: 572 STGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVM 631
           STGY+DG LIYIP+Y+D++R+RNYMKEKT+ILFGDINEYS QR L +NR+LF QGRLKV+
Sbjct: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610

Query: 632 LYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYS 691
           LYTERLHH+RRYE+KGVK+VVFYKPP++PEFY EVVR+IGK  FLG+ DLNISTVRC YS
Sbjct: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670

Query: 692 KLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           KLDGL+LE+IVGTKR  VL+H Q E YEFK
Sbjct: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/727 (58%), Positives = 524/727 (72%), Gaps = 39/727 (5%)

Query: 16  YRKRGRQELRKIKRSS----ARTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXXXXXX 71
           + K GR++LR I+++S     + E    ET E+   +++                     
Sbjct: 19  FTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVE----------DVHEERTEVSR 68

Query: 72  XXXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQ---- 127
                   Y ALLT+LK+EH   K++ +        P   G  E + +E  P  +Q    
Sbjct: 69  KQESNGEAYAALLTLLKAEHGTGKKKVK------AGPQGEGSGESQISEISPEAEQDEEE 122

Query: 128 -------LEIENGLLGNHXXXXXXXXXXXXXXXXXXXXQD-----PFESHFNQVPEKFVD 175
                    IENGL  +                     QD     P E+HFN VPEK  D
Sbjct: 123 EEEEEEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENASDPLEAHFNSVPEKDTD 182

Query: 176 KLSNAFKTKSVKYKSVKGSLSDSESYIYAKP-VVIGEEALVESPYRSSSIYSYFLKQRLK 234
            L  AFKTK V+Y+S K  +S +E +IY++P + +     ++ P  + S+  YF+KQRLK
Sbjct: 183 ALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQSLSPYFIKQRLK 242

Query: 235 VQNGLLDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTR 294
           +QN LLD K + LT LQKK+VDP+FQY+D+L               LYALH L+HIYKTR
Sbjct: 243 IQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQETEYRD-LYALHALDHIYKTR 300

Query: 295 DRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKF 354
           DRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTR+VAY V+ KII KSG+DQVDKK KF
Sbjct: 301 DRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKF 360

Query: 355 YDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGI 414
            DQF  DSLPPK KPKSFQ +F+GNTNDFFV+G KFTRK IKLYSNFYQSDIIVCSPLGI
Sbjct: 361 RDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGI 420

Query: 415 QMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSR 474
           Q+ILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+ +IF+H+NKIP QQH+ADFSR
Sbjct: 421 QLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSR 480

Query: 475 IRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGL 534
           I+MWYIN+QAKLFRQT++FT++ +P ANSLING+CRN AGRWKNH ++G+E SS+ Q G+
Sbjct: 481 IKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGM 540

Query: 535 KIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRN 594
           + R +FQRFD+ G +  +EPD+RFK F SVI+P IV+STGYEDGIL+YIPDYTDFIR+RN
Sbjct: 541 RTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRN 600

Query: 595 YMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFY 654
           Y++EKTTILFGDI+EYS QRQL ANR+LFQQGR+KV+LYTERLHH+RRYEIKGVK+V+FY
Sbjct: 601 YLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFY 660

Query: 655 KPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQ 714
           KPP NPEF+ E VR++ K+AFLG  DLNIS VRC+YSKLDGL+LERIVGT+RAA+L+H  
Sbjct: 661 KPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGP 720

Query: 715 KEIYEFK 721
            E YEFK
Sbjct: 721 NETYEFK 727

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/715 (57%), Positives = 519/715 (72%), Gaps = 21/715 (2%)

Query: 18  KRGRQELRKI-----KRSSARTEGGSTETLEDVAEDIDHRXXXXXXXXXXXXXXXXXXXX 72
           KRGR++LRKI      RS  +  G + E   +   D                        
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGD------EYAEIAMGEHEKAADDDQ 57

Query: 73  XXXXXXXYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIEN 132
                  Y ALL+IL S HPE +R+R + +++  A  E  ++   N E    D+   I  
Sbjct: 58  EERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYE---TDEVATISA 114

Query: 133 GLLGNHXXXXXXXXXXXXXX--XXXXXXQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKS 190
            L  +                       +DPFE HFNQ+ E   +KL  AFK K+V+Y+S
Sbjct: 115 SLDDSVDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYES 174

Query: 191 VK-GSLSDSESYIYAKPVV---IGEEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDP 246
            K   + D+E +I++KPV+    G +A+ ++P    +I+SYF+K++LKV NGLLD K  P
Sbjct: 175 TKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKP 234

Query: 247 LTALQKKLVDPMFQYKDILXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQD 306
           LT L K LVDP+FQY+D+L               LY LH+LNHIYKTRDRILKNN +LQ+
Sbjct: 235 LTPLSKTLVDPIFQYRDLLFEYEDFSQETEYRD-LYTLHILNHIYKTRDRILKNNHKLQE 293

Query: 307 NPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPK 366
           N D E LDQGFTRPKVL+V PTR  AY +++KII KSG+DQVDKK KF DQF +DSLPP 
Sbjct: 294 NDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPT 353

Query: 367 SKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKR 426
           SKPKSFQH+F+GNTNDFFV+G+KFTRK +KLYSNFYQSD+IVCSPLGIQ+ILENTDKKKR
Sbjct: 354 SKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKR 413

Query: 427 QDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKL 486
           QDDFLSSIE++V+DQLHS+E+QN +H+ +IF H+NKIP +QH++DFSRIRMWYIN+QA+L
Sbjct: 414 QDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARL 473

Query: 487 FRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDII 546
           FRQT++FTKY+SP ANSLING+C N +GR+KN + I  E S+I Q GLK+RQ+F RFD+ 
Sbjct: 474 FRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLF 533

Query: 547 GNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGD 606
             S ++EPDYRFKFFTSV +P I KSTGYEDGIL+YIPDYTDF+R+RNY K++T ILFG+
Sbjct: 534 TGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGE 593

Query: 607 INEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEV 666
           I EYS QRQ+ +NR+LFQQG++KV+LYTERLHH+RRY+IKGVKSV+FYKPP+NPEFY E+
Sbjct: 594 ITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQEL 653

Query: 667 VRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721
           +R IGKNAFLGN DLNISTVRC Y KLD LSLERIVG+KRAAVL+ +Q EIYEFK
Sbjct: 654 IRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/566 (66%), Positives = 460/566 (81%), Gaps = 7/566 (1%)

Query: 159 QDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVI--GEEALVE 216
           QD F+ HFN+V    V +L  AFK    +Y+ V+      E  +Y+KPV    G E  V 
Sbjct: 143 QDHFDVHFNRVSAADVAQLDAAFKNGRAQYR-VQKEARGEEEILYSKPVASSEGTEGPVR 201

Query: 217 SPYRSSSIYSYFLKQRLKVQNGL-LDKKTDPLTALQKKLVDPMFQYKDILXXXXXXXXXX 275
            P RS  +  Y +KQRL++ NGL  D    PLT  QK L+DPMFQY+DIL          
Sbjct: 202 VPARS--LRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDRER 259

Query: 276 XXXXXLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRV 335
                LY LH+LNH+YKTRDRILKNNQ+LQDNPD E LDQGFTRPK L+VVPTR  AY V
Sbjct: 260 EYRE-LYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDV 318

Query: 336 VDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAI 395
           VD ++ +SGI+QVDKK KF DQF D SLPP SKPKSFQH+F+GNTNDFFV+G+KFTRKAI
Sbjct: 319 VDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAI 378

Query: 396 KLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFT 455
           +LYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQDDFLSSIE+MV+DQLHSIE+QNI+H+  
Sbjct: 379 RLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSN 438

Query: 456 IFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGR 515
           IF H+NKIP QQ +ADFSRIRMWYI +QAKLFRQTMVFT+YISP AN+L+N +C N AGR
Sbjct: 439 IFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGR 498

Query: 516 WKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGY 575
            K+H+V+ +E S IGQ GLK+RQIFQRF+++G S ++EPD+RFKFFTSV++PGI K+TGY
Sbjct: 499 VKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGY 558

Query: 576 EDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTE 635
           + GIL+YIP+YTDFIR+RNY+K+KT ILFGDINEYS QRQL +NR+LFQ GR+KV+LYTE
Sbjct: 559 DSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTE 618

Query: 636 RLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDG 695
           RLHH+RR+E+KGVKSV+ YKPP+NPEFY E++R+IGK+AFLG  DLNI+TVRC+YSK+D 
Sbjct: 619 RLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDS 678

Query: 696 LSLERIVGTKRAAVLSHAQKEIYEFK 721
           L+LERIVGTKRAAVL+H Q E+YEFK
Sbjct: 679 LALERIVGTKRAAVLTHGQNEVYEFK 704

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 102/251 (40%), Gaps = 37/251 (14%)

Query: 391 TRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQL--HSIEYQ 448
           T K  K++S     D  V S +G     E +       D L +    +ID L  H +  +
Sbjct: 273 TEKVTKIWSRENNYDCRVISIVGGHSFEEISFSLSEGCDILVATPGRLIDSLDNHLLVMK 332

Query: 449 NISHIFTIFDHLNKIPDQQHEADFSRIRMWY-INEQAKLFRQTMVFTKYISPAANSLING 507
            +  +  + D  +K+ D   E   + I     +N  +   RQT++FT  ++P    +  G
Sbjct: 333 QVETL--VLDEADKMIDLGFEDQVTNILTKVDVNVDSATNRQTLMFTATMTPVIEKIAAG 390

Query: 508 RCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIP 567
             R        +  IG +    G   L IRQ+ +  D          + +FK   SV+I 
Sbjct: 391 YMRKPV-----YATIGLDT---GSEPL-IRQVVEYAD--------NEEEKFKKLKSVVIK 433

Query: 568 GIVKSTGYEDGILIYI--PDYTDFI--RIRNYMKEKTTILFGDINEYSSQRQLNANRSLF 623
                  YE  I+I+I      D++  R +     K TIL G      SQ Q   +  LF
Sbjct: 434 -------YESPIIIFINYKQTADWLAERFQTETNMKVTILHGS----KSQEQREHSLQLF 482

Query: 624 QQGRLKVMLYT 634
           + G++++M+ T
Sbjct: 483 RTGKVQIMIAT 493

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 79/374 (21%), Positives = 150/374 (40%), Gaps = 104/374 (27%)

Query: 320 PKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGN 379
           P+ LI+ PTRE+A ++           + + K KF   ++        +P     I  G+
Sbjct: 240 PQALILAPTRELAQQI-----------EAEAK-KFCAHWK--------RPCLVTSIVGGH 279

Query: 380 TNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVI 439
           T +  +  L+               +I+V +P  +   LEN               ++V+
Sbjct: 280 TLEEIIFNLQ------------DGCNILVATPGRLIDCLEN--------------HVLVL 313

Query: 440 DQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISP 499
            Q++++          + D  +++ D   E   + I          L +QT++FT  +S 
Sbjct: 314 KQVYTL----------VLDEADRMVDFGFEDQLTTI---LARTDDILEKQTLMFTATMSS 360

Query: 500 AANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFK 559
           +   + NG  RN          IG   S+      +I+QI +         +   + RFK
Sbjct: 361 SIERIANGYLRN-----PGFVTIGGSGSAP-----QIQQIIE--------YVATDEQRFK 402

Query: 560 FFTSVIIPGIVKSTGYEDGILIYIPDY---TDFIRIRNYMKE---KTTILFGDINEYSSQ 613
             T  I+P       Y   ++I+I +Y    D++ +R + +E   + TIL G  ++   +
Sbjct: 403 MLTQDILP------NYRPPVIIFI-NYKVTADWL-LRKFQEESKFRVTILHGSKSQTQRE 454

Query: 614 RQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKN 673
             L A    F++G++ +M+ T+     R  +I  V  VV ++ P+  + Y   +   G+ 
Sbjct: 455 HSLKA----FREGKVDIMVATDVAG--RGIDIPNVSLVVNFQMPSKLDDYIHRIGRTGRA 508

Query: 674 -------AFLGNTD 680
                   FLG+ D
Sbjct: 509 NQKGTTLTFLGDKD 522

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 102/249 (40%), Gaps = 37/249 (14%)

Query: 393 KAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQL--HSIEYQNI 450
           K  K++S     D  V S +G   + E +       D L +    +ID L  H +  + +
Sbjct: 292 KVTKIWSRESNYDCRVVSIVGGHSLEEISYSLSEGCDILVATPGRLIDSLENHLLVMKQV 351

Query: 451 SHIFTIFDHLNKIPDQQHEADFSRIRMWY-INEQAKLFRQTMVFTKYISPAANSLINGRC 509
             +  + D  +K+ D   E   + I     ++  +   RQT++FT  ++P    +  G  
Sbjct: 352 ETL--VLDEADKMIDLGFEDQVTTILTKVDVSADSATNRQTLMFTATMTPVIEKIAAGYM 409

Query: 510 RNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGI 569
           R        +  IG +    G   L I+QI +  D          + +FK   S++    
Sbjct: 410 RKPV-----YATIGVDT---GSEPL-IQQIVEYAD--------NEEQKFKKLKSIV---- 448

Query: 570 VKSTGYEDGILIYI--PDYTDFI--RIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQ 625
              T YE  I+I+I      D++  R +     + TIL G      SQ Q   +  LF+ 
Sbjct: 449 ---TKYEPPIIIFINYKQTADWLAERFQKETNMRVTILHGS----KSQEQREHSLQLFRS 501

Query: 626 GRLKVMLYT 634
           GR++VM+ T
Sbjct: 502 GRVQVMIAT 510

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 6/115 (5%)

Query: 570 VKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLK 629
           V S   E  IL++         I  Y++E        I+    QR+ +   + F++GR  
Sbjct: 354 VASQDKESKILVFASTKRTCDEITKYLREDGWPALA-IHGDKDQRERDWVLAEFREGRSP 412

Query: 630 VMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNIS 684
           +M+ T+     R  ++KG+  V+ Y  P N E Y   V  IG+    G T   IS
Sbjct: 413 IMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 462

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 44/199 (22%)

Query: 488 RQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIG 547
           RQTM+FT   SP    + NG  +       ++  +G E     +S  KI+QI +      
Sbjct: 324 RQTMMFTATFSPTIEKVANGYLKK-----PSYVTVGGE-----ESKPKIKQIVR------ 367

Query: 548 NSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEK-------T 600
              + + + + K      +P       Y+  I+I+I    ++ R  +++ +K        
Sbjct: 368 --YVPDEEEKLKILVKDFLP------NYKAPIIIFI----NYKRTADWLFDKLREARFRA 415

Query: 601 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNP 660
           T L G      SQ Q   + SL + G++ +++ T+     R  +I  V  VV  + P + 
Sbjct: 416 TTLHGS----KSQEQREHSLSLLRNGKVDILIATDVAG--RGIDIPNVSLVVNLQFPKS- 468

Query: 661 EFYNEVVRFIGKNAFLGNT 679
             ++  V  +G+    G T
Sbjct: 469 --FDSFVHRVGRTGRAGKT 485

>YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}
           PRP28RNA helicase in the DEAD-box family, involved in
           RNA isomerization at the 5' splice site
          Length = 588

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 105/257 (40%), Gaps = 45/257 (17%)

Query: 389 KFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQL--HSIE 446
           K T+K  K++S     D  V S +G   + E +       D L +    +ID L  H + 
Sbjct: 272 KETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLV 331

Query: 447 YQNISHIFTIFDHLNKIPDQQHEADFSRIRMWY-INEQAKLFRQTMVFTKYISPAANSLI 505
            + +  +  + D  +K+ D   E   + I     IN  + + RQT++FT  ++P    + 
Sbjct: 332 MKQVETL--VLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIA 389

Query: 506 NGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVI 565
            G  +        +  IG E    G   L I+Q+ +  D          + +FK    ++
Sbjct: 390 AGYMQKPV-----YATIGVET---GSEPL-IQQVVEYAD--------NDEDKFKKLKPIV 432

Query: 566 IPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKE--------KTTILFGDINEYSSQRQLN 617
                    Y+  I+I+I    ++ +  +++ E        K TIL G      SQ Q  
Sbjct: 433 -------AKYDPPIIIFI----NYKQTADWLAEKFQKETNMKVTILHGS----KSQEQRE 477

Query: 618 ANRSLFQQGRLKVMLYT 634
            +  LF+  ++++M+ T
Sbjct: 478 HSLQLFRTNKVQIMIAT 494

>TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.469
           YDR243C
          Length = 607

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 115/278 (41%), Gaps = 33/278 (11%)

Query: 409 CSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHS--IEYQNISHIFTIFDHLNKIPDQ 466
            S +G   I E T K  +  D L +    +ID L S  I   +I  +  + D  +K+ D 
Sbjct: 295 VSIVGGYSIEELTFKISKGMDILVATPGRLIDCLESKLIVLNDIETL--VLDEADKMIDL 352

Query: 467 QHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSEN 526
             E   S I  +  + ++K   QT++F+  +SP    L              HK I ++ 
Sbjct: 353 GFEEQLSTILSYVASYKSKDTVQTIMFSATMSPDIEKLTTSYL---------HKPIFAKV 403

Query: 527 SSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDY 586
            S   +  +I QI +  +   ++  +  +  + F + +II    K T   D +   I + 
Sbjct: 404 GSPKSAIERIEQIVRYSETEESTFDKIKELLYGFDSPIIIFINYKRTA--DWLYKKIQEE 461

Query: 587 TDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIK 646
           T F           TIL G      SQ Q   +  L + G+++VM+ T      R  +I 
Sbjct: 462 TSF---------HATILHGS----KSQDQREHSVKLLKSGKVQVMIATNVAA--RGIDIP 506

Query: 647 GVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNIS 684
            V  V+ ++ P++ E Y   +  IG+    GN+   +S
Sbjct: 507 NVSLVINFQIPSSFEDY---IHRIGRTGRAGNSGTAVS 541

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 6/109 (5%)

Query: 576 EDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTE 635
           E  ILI+         +  Y++E        I+    QR+ +     F+ GR  +M+ T+
Sbjct: 362 ESKILIFASTKRTCDEVTKYLREDGWPALA-IHGDKDQRERDWVLEEFRSGRSPIMVATD 420

Query: 636 RLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNIS 684
                R  ++KG+  V+ Y  P N E Y   V  IG+    G T   IS
Sbjct: 421 VAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 464

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,311,247
Number of extensions: 3281699
Number of successful extensions: 10814
Number of sequences better than 10.0: 36
Number of HSP's gapped: 11030
Number of HSP's successfully gapped: 37
Length of query: 721
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 604
Effective length of database: 40,065,477
Effective search space: 24199548108
Effective search space used: 24199548108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)