Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL022W (TIM44)7.196ON43143122220.0
Smik_9.1687.196ON43143121640.0
Skud_9.1477.196ON43143120790.0
Suva_9.1777.196ON43543520550.0
TDEL0H025107.196ON41841617490.0
NDAI0B017807.196ON43443217290.0
NCAS0A125207.196ON43240417240.0
Kpol_1063.97.196ON41739817140.0
CAGL0J02442g7.196ON41240617090.0
SAKL0F07502g7.196ON41240416880.0
TPHA0C045307.196ON41640816870.0
KLLA0D16214g7.196ON41838616700.0
Kwal_55.203687.196ON41240516560.0
KLTH0E04554g7.196ON47939316520.0
ZYRO0D15840g7.196ON40740916420.0
KNAG0H026907.196ON41940416260.0
Ecym_43807.196ON41841015890.0
ADL118C7.196ON41843115580.0
KAFR0A026407.196ON42140015550.0
TBLA0J015007.196ON42142313530.0
NCAS0F025005.296ON831144723.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL022W
         (431 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   860   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   838   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   805   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   796   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   678   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   670   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   668   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   664   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   662   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   654   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   654   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   647   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   642   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   640   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   637   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   630   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   616   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   604   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   603   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   525   0.0  
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    32   3.0  

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/431 (97%), Positives = 422/431 (97%)

Query: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60
           MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK
Sbjct: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120

Query: 121 TKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
           TKAWESELGKNTR         LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR
Sbjct: 121 TKAWESELGKNTRKAAAATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN
Sbjct: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300
           KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE
Sbjct: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360
           ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ
Sbjct: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 421 EFVRGGSRQFT 431
           EFVRGGSRQFT
Sbjct: 421 EFVRGGSRQFT 431

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/431 (94%), Positives = 417/431 (96%)

Query: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60
           M+RSTFIR+SGTSSRT+ ARYRS  TGL++ARVLFSTS TR QGGNPRSPLQIFRDTFKK
Sbjct: 1   MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKK 60

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120

Query: 121 TKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
           TKAWESELGKNTR         LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR
Sbjct: 121 TKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           RLKRE+DLASGKRHRAVKSN++AGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN
Sbjct: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300
           KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFK+MDPTFSNESFTRHLREYIVPE
Sbjct: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPE 300

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360
           ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVE+VSAKLLAPQ
Sbjct: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQ 360

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 421 EFVRGGSRQFT 431
           EFVRGGSRQFT
Sbjct: 421 EFVRGGSRQFT 431

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/431 (90%), Positives = 410/431 (95%)

Query: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60
           M+RST I+TS   +RT  A YRSQ  GLLVARVLFSTS TRAQGGNPRSPLQIFRDTFKK
Sbjct: 1   MYRSTLIKTSAAGTRTAAAGYRSQDAGLLVARVLFSTSATRAQGGNPRSPLQIFRDTFKK 60

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYL+AQRGSTIVGKTLKKTGETMEHIA
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETMEHIA 120

Query: 121 TKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
           TKAWESELGKNTR         LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR
Sbjct: 121 TKAWESELGKNTRKAASATAKRLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           RLKRE+DLASGKRHRAVKSN++AGTAVVATNIESKESFGKKVEDF+EKT +GRSIQSLKN
Sbjct: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFREKTAMGRSIQSLKN 240

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300
           +LWDESENPLIV+MRK+TNKVGGFFAETESSRV+SQFKLMDPTFSNESFTRHLR+YIVPE
Sbjct: 241 RLWDESENPLIVIMRKVTNKVGGFFAETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPE 300

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360
           ILEAYVK DVKVLKKWFSEAP+NVYAAQQKIF+EQDVYADGRILDIRGVEIVSAKLLAPQ
Sbjct: 301 ILEAYVKADVKVLKKWFSEAPYNVYAAQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQ 360

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           DIPVLVVGCRAQEINLYRK+KTGEIAAG+EANILMSSYAMVFTRDPEQIDDDETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKRKTGEIAAGNEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 421 EFVRGGSRQFT 431
           EFVRGGSRQFT
Sbjct: 421 EFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/435 (89%), Positives = 407/435 (93%), Gaps = 4/435 (0%)

Query: 1   MHRSTFIRTSGT----SSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRD 56
           M+RST   T+       SRTL A  R Q  GLL+AR LFSTS TRAQGGNPRSPLQIFRD
Sbjct: 1   MYRSTLTTTTAAAAAAGSRTLAAGCRPQDAGLLIARALFSTSATRAQGGNPRSPLQIFRD 60

Query: 57  TFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETM 116
           TFKKEW+KSQELQENIKTLQDASGKLGESEAYKKAREAYL+AQRGSTIVGKTLKKTGET+
Sbjct: 61  TFKKEWDKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETV 120

Query: 117 EHIATKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFIT 176
           EHIAT+AW+SELGKNTR         LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFIT
Sbjct: 121 EHIATRAWDSELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFIT 180

Query: 177 KEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQ 236
           KEQRRLKRE+DLASGKRHRAVKSN++AGTAVVATNIESKESFGKKVEDFKEKT VGRSIQ
Sbjct: 181 KEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTAVGRSIQ 240

Query: 237 SLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREY 296
           SLKN+LWDESENPLIV+MRK+TNKVGGFFAETESSRVYSQFK+MDPTFSNE+FTRHLREY
Sbjct: 241 SLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSRVYSQFKMMDPTFSNENFTRHLREY 300

Query: 297 IVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKL 356
           IVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDV+ADGRILDIRGVEIVSAKL
Sbjct: 301 IVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVFADGRILDIRGVEIVSAKL 360

Query: 357 LAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEG 416
           LAPQDIPVLVVGCRAQEINLYRK+KTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEG
Sbjct: 361 LAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEG 420

Query: 417 WKILEFVRGGSRQFT 431
           WKILEFVRGGSRQFT
Sbjct: 421 WKILEFVRGGSRQFT 435

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/416 (77%), Positives = 371/416 (89%), Gaps = 2/416 (0%)

Query: 16  TLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTL 75
           T+ +R      G L  R LFSTS+   Q  NPRSP+QIFRDTFKKEW+KSQELQ+NIKTL
Sbjct: 5   TVVSRSSVIAEGRLAGRALFSTSSGSLQ--NPRSPVQIFRDTFKKEWKKSQELQDNIKTL 62

Query: 76  QDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXX 135
           QDASG+LGESEAYK+AREAY++AQ+GSTIVGKTLKKTGET+E+IA+KAW+SE+ +NTR  
Sbjct: 63  QDASGRLGESEAYKRAREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREA 122

Query: 136 XXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHR 195
                  +DE FEPVRQTKIYK+VSEV+DDG SSRYGGFITKEQRRLKRE+D+ SGKR +
Sbjct: 123 ASKTAKKIDEGFEPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAK 182

Query: 196 AVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMR 255
           AVK NEDAGTA+VAT+IE+K+SFGKKVEDFKEKTV+GR++  LKN LWDES NPLIV +R
Sbjct: 183 AVKGNEDAGTALVATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLR 242

Query: 256 KITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKK 315
           KIT K+GGFFAETE++RV  QFK+MDPTF+NESFTRHLREY++PEILEAYVKGD KVLKK
Sbjct: 243 KITRKIGGFFAETEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKK 302

Query: 316 WFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIN 375
           WFSEAP+NVYAAQQK F+EQ ++ADG+ILDIRGVEIVSAK+L PQDIPVLVVGCRAQEI+
Sbjct: 303 WFSEAPYNVYAAQQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIH 362

Query: 376 LYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           LYRK KTGE+AAG E+NI+MSSYAMVFTRDPEQIDD+ETEGW+ILEFVRGGSRQFT
Sbjct: 363 LYRKAKTGEVAAGHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/432 (74%), Positives = 376/432 (87%), Gaps = 2/432 (0%)

Query: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTS--TTRAQGGNPRSPLQIFRDTF 58
           +H  + I++S         R  S  +   V +VLFST+  T    GG  R+P+QIFRDTF
Sbjct: 2   LHNRSIIQSSSYVRLLNVQRSSSVPSSYTVGKVLFSTTRTTLNNNGGGGRTPIQIFRDTF 61

Query: 59  KKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEH 118
           KKEWEKSQELQ+NIK L DASGKL ESE +K A++AYLKA +GSTIV KTLKKTGET+E 
Sbjct: 62  KKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKAHKGSTIVSKTLKKTGETVET 121

Query: 119 IATKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKE 178
           +A+KAW+SE+GKNTR         +D+SFEPVR+T+IYK+VSEVIDDG+SSRYGGFITKE
Sbjct: 122 MASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYKDVSEVIDDGDSSRYGGFITKE 181

Query: 179 QRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSL 238
           +R+LKRERDLASGKR RAVKSN++AGTA+VATNIE+KESFGKKVEDFKEKTVVG++++++
Sbjct: 182 ERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAKESFGKKVEDFKEKTVVGKTMKTV 241

Query: 239 KNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIV 298
           K KLWDESENPLIV +RKI+NK+ GFF ETES++VY+QFKLMD TF+N+ FTRHLR+YIV
Sbjct: 242 KMKLWDESENPLIVTLRKISNKISGFFDETESAKVYTQFKLMDTTFTNDGFTRHLRDYIV 301

Query: 299 PEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLA 358
           PEILEAY+KGD KVLKKWFSEAPFNVYAAQQK+F+EQ +++DGRILDIRGVEIVSAKLLA
Sbjct: 302 PEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVFREQGLFSDGRILDIRGVEIVSAKLLA 361

Query: 359 PQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWK 418
           PQDIPVLVVGCRAQEINLY+K K+GEIAAGDE+NI+MSSYAMVFTRDPEQIDDDETEGWK
Sbjct: 362 PQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESNIVMSSYAMVFTRDPEQIDDDETEGWK 421

Query: 419 ILEFVRGGSRQF 430
           ILEFVRGGSR F
Sbjct: 422 ILEFVRGGSRPF 433

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/404 (77%), Positives = 369/404 (91%), Gaps = 1/404 (0%)

Query: 29  LVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAY 88
           +V + LFST+T R+ GG  R+P+QIFRDTFKKEW+KSQELQENIK L DASGKL ESE +
Sbjct: 29  VVNKGLFSTTTARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETF 88

Query: 89  KKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESF 147
           K A++AYLKA +GS TI+ KT++KTGET+E++A+KAW+SE+ K+TR         LD+SF
Sbjct: 89  KMAKDAYLKAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSF 148

Query: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAV 207
           EPVR+T++YK++SEVIDDG+SSRYGGFITKE+RRLKRE DLASGKR RA+KSNE+AGTA+
Sbjct: 149 EPVRKTQVYKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTAL 208

Query: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267
           VAT+IE+K+SFGKKVEDFKEKTVVG+++ S+K KLWDESENPLIV +RKITNK+GGFF E
Sbjct: 209 VATDIEAKQSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDE 268

Query: 268 TESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327
           TES+RVY+QFK+MD TF+NE FTRHLREYIVPE+LEAY+KGD KVLKKWFSEAPFNVY+A
Sbjct: 269 TESARVYTQFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSA 328

Query: 328 QQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387
           QQK+F+EQ +++DGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRK KTGEIAA
Sbjct: 329 QQKVFREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAA 388

Query: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           GD++NILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT
Sbjct: 389 GDQSNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/398 (79%), Positives = 362/398 (90%), Gaps = 2/398 (0%)

Query: 34  LFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93
           LFSTS+   QG  PR+P+QIFRDTFKKEWEKS++LQ+NIK LQDASG+LGESEAYKKARE
Sbjct: 22  LFSTSSRVLQG--PRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKKARE 79

Query: 94  AYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESFEPVRQT 153
           AYLKAQ+GSTIVGKTL+KTGET+E IA+KAW+SE+GK+TR         +DESFEPVR+T
Sbjct: 80  AYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPVRKT 139

Query: 154 KIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIE 213
           ++YK+VS+VIDDG+SSRYGGFI KEQRRLKRE DL SGKR RAVKSN++AGT++VATNIE
Sbjct: 140 QVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVATNIE 199

Query: 214 SKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRV 273
           +KES GKK+EDFKE T  GR+I  +K KLWDE+ENPLIV +RK++ K+GGFFAETESSRV
Sbjct: 200 AKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETESSRV 259

Query: 274 YSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFK 333
            SQFKLMDPTFSN+SFT+HLREYI+PE+LEAYVKGD  VLKKWFSEAP+NVYAAQQK F+
Sbjct: 260 LSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQKEFR 319

Query: 334 EQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANI 393
           +Q ++ DGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAAGDE+NI
Sbjct: 320 KQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDESNI 379

Query: 394 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT
Sbjct: 380 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/406 (78%), Positives = 365/406 (89%), Gaps = 3/406 (0%)

Query: 26  TGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGES 85
           +G+LVAR  F T +      NPRSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASG+LGES
Sbjct: 8   SGVLVARRCFGTRSVLL--SNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGES 65

Query: 86  EAYKKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLD 144
           EAYKKAREAYLKA +GS TIVGKTL+KTGET+E +ATKAW+S++ K TR         LD
Sbjct: 66  EAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLD 125

Query: 145 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAG 204
           ESFEPVRQTKIYK+VSEVIDDG+SS YGGFITKEQRRLKRE+DLASGKR RAVKSN++AG
Sbjct: 126 ESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAG 185

Query: 205 TAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGF 264
           +A+VAT+IE+KES GKK+EDFKEKT VGR+++S+K  LWDESENPLIV +RKIT K+GGF
Sbjct: 186 SALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGF 245

Query: 265 FAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNV 324
           FAETES+RVY QFK++DPTF+N  FT+HLR+YIVPE+LEAYVKGD KVLKKWFSEAPFNV
Sbjct: 246 FAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNV 305

Query: 325 YAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGE 384
           Y AQQKIFK+Q++++DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGE
Sbjct: 306 YNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGE 365

Query: 385 IAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430
           IAAGDE+NILMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F
Sbjct: 366 IAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/404 (77%), Positives = 359/404 (88%), Gaps = 2/404 (0%)

Query: 28  LLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87
           +L +R   S++    QG   RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASGKLGES+A
Sbjct: 11  VLASRRTISSTVRLPQG--QRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDA 68

Query: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESF 147
           YKKAREAYL+AQ+GSTIVGKTLKKTGET+E IA KAWESELGK TR         +DESF
Sbjct: 69  YKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESF 128

Query: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAV 207
           EPVRQTK+YK+VSEVIDDGESSRYGGFITKEQRRLK+E+DLASGKR +AVKSN++AGTA+
Sbjct: 129 EPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTAL 188

Query: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267
           VATNIE+KESF KK+EDFKEKT  GR I  +K +LWDESENPLIV++R I NKVGG FAE
Sbjct: 189 VATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAE 248

Query: 268 TESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327
           TES+RV  QFK++DP F+ ESFT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAA
Sbjct: 249 TESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAA 308

Query: 328 QQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387
           QQK F++Q+++ADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAA
Sbjct: 309 QQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368

Query: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           G E+NIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 369 GTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/408 (76%), Positives = 363/408 (88%), Gaps = 3/408 (0%)

Query: 26  TGLLVAR--VLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLG 83
           T LL+      FSTST    GG  ++P+QIFR+TFKKEWEKSQELQ+NIKTLQDASG+LG
Sbjct: 10  TNLLLGHNVAYFSTSTVLRNGGG-KTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLG 68

Query: 84  ESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXL 143
           +SEAYKKA+EAY+KAQ+ STIV KTLKKTGET+E +A K W+SE+GK+TR         +
Sbjct: 69  QSEAYKKAKEAYVKAQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKI 128

Query: 144 DESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDA 203
           DESFEPVRQT++YKEVSEVIDDGESSRYGGFI+KEQRR KRE DLASGKR RA KSNE+A
Sbjct: 129 DESFEPVRQTQVYKEVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEA 188

Query: 204 GTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGG 263
           GTA+VATN+ESKESFGKK++DFKEKTVVG++++S K ++WDE+ENPLIVV+R I+NK+ G
Sbjct: 189 GTAIVATNVESKESFGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISG 248

Query: 264 FFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFN 323
           FFAETESSRVYSQFKLMDPTFSN +FT+HLR+YI+PE+LEAYVKGD  VLKKWFSEAPFN
Sbjct: 249 FFAETESSRVYSQFKLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFN 308

Query: 324 VYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTG 383
           VYAAQQK  ++Q ++ DGRILDIRGV+IVSAKLLAPQDIPVLVVGCRAQE++LYRK KTG
Sbjct: 309 VYAAQQKELRKQQLFTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTG 368

Query: 384 EIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           E+ AGDE+NI+MSSYAMVFTRDP+ IDDDETEGWKILEFVRGGSRQFT
Sbjct: 369 ELGAGDESNIMMSSYAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/386 (79%), Positives = 349/386 (90%)

Query: 46  NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIV 105
           NPRSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASGKLGESEAYKKAREAY+KAQ+GSTIV
Sbjct: 33  NPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIV 92

Query: 106 GKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDD 165
           GKTLKKTGET+E IA+KAW+SE+ K+TR         LDESFEPVR+TK+YK+VSEVIDD
Sbjct: 93  GKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDD 152

Query: 166 GESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDF 225
           G+SSRYGGFITKEQRRL +E  +ASGKR RAVKSN+ AGTA+VATNIESKESFGKK+EDF
Sbjct: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212

Query: 226 KEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFS 285
           KEKT VGR +   K KLWDESENPL+V++R ++ K+GG FAETES+RVY QFK+MDPTF+
Sbjct: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272

Query: 286 NESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILD 345
            E FT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAAQQK F+EQ+++ADG+ILD
Sbjct: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332

Query: 346 IRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRD 405
           IRGVEIVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG E++ILMSSYAMVFTRD
Sbjct: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392

Query: 406 PEQIDDDETEGWKILEFVRGGSRQFT 431
           PE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 393 PETVDDKETEGWKILEFVRGGSRQFT 418

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/405 (75%), Positives = 357/405 (88%), Gaps = 3/405 (0%)

Query: 30  VARVLFS---TSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESE 86
           V  V+FS   + T RA  GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGKLGES+
Sbjct: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67

Query: 87  AYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDES 146
           AYKKAREAYLKAQ+GSTIVGKT+KKTG+++E IA KAWESE+ K+TR         LDES
Sbjct: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127

Query: 147 FEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTA 206
           FEPVR T++YK+VSEV++ G SSRYGGFITKEQRRLK E+D+ASGKR +AV+SN++AGTA
Sbjct: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187

Query: 207 VVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFA 266
           +VATNIE+KESFGKKV+DFKEKTVVGR +   K KLWDESENPLIV++R I NK+GG FA
Sbjct: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247

Query: 267 ETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYA 326
           ETES+RV  QFK+MD  F++ESF  HLREYI+PE+LEAYVKGD KVLK+WFSEAP+NVYA
Sbjct: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307

Query: 327 AQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIA 386
           AQQK+F+EQ ++ADGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEI+LYR  KTGE+A
Sbjct: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367

Query: 387 AGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           AG ++NILMSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/393 (77%), Positives = 350/393 (89%)

Query: 39  TTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKA 98
           T +A  GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGK+GESEAYKKAREAYL A
Sbjct: 87  TFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSA 146

Query: 99  QRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKE 158
           Q+GSTIVGKTLKKTG+++E IA KAWESE+GK+TR         LDESFEPVR T++YK+
Sbjct: 147 QKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKD 206

Query: 159 VSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESF 218
           VSEV+D   SSRYGGFI+KEQRRLK E+D+ASGKR +AVKSNE+AGTA+VAT IE+KESF
Sbjct: 207 VSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESF 266

Query: 219 GKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFK 278
           GKKV+DFKEKTVVGR +Q +K KLWDESENPLIV+MR I NKVGG FAETES+RV  QFK
Sbjct: 267 GKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFK 326

Query: 279 LMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVY 338
           +MD  F++ESF  HLREYI+PE+LEAYVKG+ +VLK+WFSEAP+NVYAAQQK+F+EQ ++
Sbjct: 327 MMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLF 386

Query: 339 ADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSY 398
           ADGRILDIRGV+IVSAKLL PQD+PVLVVGCRAQEI+LYR  KTGE+AAG ++NILMSSY
Sbjct: 387 ADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSY 446

Query: 399 AMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           AMVFTRDPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 447 AMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/409 (73%), Positives = 361/409 (88%), Gaps = 5/409 (1%)

Query: 25  YTGLLVAR--VLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKL 82
           Y G++  R   LFSTS+   QG   RSPLQIFRDTFKKEWEKSQELQENIKTLQDASG+L
Sbjct: 2   YKGIVTQRSVALFSTSSRSLQG---RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRL 58

Query: 83  GESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXX 142
           G+SE  K+AREAYL+AQ+GSTIVGKTL+KTGET+E IA+KAWESE+ K+TR         
Sbjct: 59  GDSEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKK 118

Query: 143 LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNED 202
           LD+SFEPVR TKIYK+VSEV++D ++SRYGGF+TKEQR++KRER++ASGKR RA++SNE+
Sbjct: 119 LDKSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEE 178

Query: 203 AGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVG 262
           AGTA+VATNIE+KES GKKVEDF+EKT +GR+IQ LK +LW+E+ENPLIV++RKITNKVG
Sbjct: 179 AGTALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVG 238

Query: 263 GFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPF 322
           GFFAETE+++V  QFKL+DP+F++E FTR LR+Y++PE+LEAY KGD K LKKWFSEAPF
Sbjct: 239 GFFAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPF 298

Query: 323 NVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKT 382
           NVYAAQQK F++Q ++AD RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR  K+
Sbjct: 299 NVYAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKS 358

Query: 383 GEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           GE+AAG E+NILMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 359 GEVAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/404 (75%), Positives = 358/404 (88%), Gaps = 1/404 (0%)

Query: 29  LVARVLFSTSTTRAQGG-NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87
           +VAR    T+     GG +PRSPL IFRDTFKKEWEKSQELQENI+TLQDASGK+GE+EA
Sbjct: 16  VVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEA 75

Query: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESF 147
           Y+KAREA+L+AQ+GSTIVGKTLKKTGET+E IA+KAW+SE+ K +R         LDE F
Sbjct: 76  YRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGF 135

Query: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAV 207
           EPVRQT++YK+VSEVIDDG+S+ YGGF T+E+R+ +RE+ LASG+R RAVKSN++AGTA+
Sbjct: 136 EPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGERVRAVKSNDEAGTAL 195

Query: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267
           VAT +ESKES GKK+EDFKEKT VGRS+  LK++LWDESENPLIV MRK++ KVG FFAE
Sbjct: 196 VATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAE 255

Query: 268 TESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327
           TES RVY+QFKLMDP F++ +FT+HLREY+VPEILEAYV+GD KVLKKWFSEAP+NVYAA
Sbjct: 256 TESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAA 315

Query: 328 QQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387
           QQK+FKE+ ++ADGRILDIRGVEIVSAKLL PQD+PVLVVGCRAQEINLY+K KTGEIAA
Sbjct: 316 QQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKVKTGEIAA 375

Query: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           G E+NILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 376 GSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/410 (70%), Positives = 348/410 (84%)

Query: 22  RSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGK 81
           +S+ +G+  A      STT       +SPLQIFR+TFK EW+KSQELQ+NIK LQDASG+
Sbjct: 9   QSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGR 68

Query: 82  LGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXX 141
           LGES+AYKKAREAYLKAQRGST+VGKTLKKTGET+E++  KAW+S++GKNTR        
Sbjct: 69  LGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQ 128

Query: 142 XLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNE 201
            LDESFEPVR T++YK++SE+IDDGESSRYGGFI KE RR KRE DLASG+R  AV+SN+
Sbjct: 129 KLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSND 188

Query: 202 DAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKV 261
           +AGTA+VATN E KESFGKK++DFKEKT +GR +   K KLWDE+ENPLI ++R I+NK+
Sbjct: 189 EAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKI 248

Query: 262 GGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAP 321
           GG FAETES+RV++QFKL+DPTF++E FT+HLREYI+PE+LEAYVKGD  VLK+W SEAP
Sbjct: 249 GGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAP 308

Query: 322 FNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKK 381
           +NVYAAQQK F+EQ+++ DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEI+LYRK K
Sbjct: 309 YNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAK 368

Query: 382 TGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           TGEIAAG E+NI+MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 369 TGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/431 (67%), Positives = 361/431 (83%), Gaps = 13/431 (3%)

Query: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60
           MHR + ++ +           +SQ   +L AR     S TR  G  P+SPLQ+FR+TFK+
Sbjct: 1   MHRYSAVKQA----------QKSQPQRVLAARGF---SATRWAGNGPKSPLQVFRETFKE 47

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EW+KSQELQ+NIK LQDA G+LGES+AYKKAREAYLKAQ+GSTIVGKTLK+TGET+EHI 
Sbjct: 48  EWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHIT 107

Query: 121 TKAWESELGKNTRXXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
            +AWESE+GK TR         LDESFEPVRQTK+YK++SE+IDDGESSRYGGF+ KE+R
Sbjct: 108 VQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMEKERR 167

Query: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           R KRERDLA+GKR   V+SNE+AG+A+VAT+ E+ ES GKK++DFKEKTVVGR +  +K 
Sbjct: 168 REKRERDLATGKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKV 227

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300
           +LWDE+ENPLI ++R I+NKVGG FAETES+RV++QFKL+DPTF+ E FT+HLREYI+PE
Sbjct: 228 RLWDENENPLIGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPE 287

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360
           +LEAYVKGD +VLK+WFSEAP+NVY+AQQK  ++Q+++ADGRILDIRGVEI+SAKLL PQ
Sbjct: 288 VLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQ 347

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           D+P +VVGCRAQEI+L+RK  TGEIAAG E+NI++SSYAMV TRDPE++DD ETEGWKIL
Sbjct: 348 DVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKIL 407

Query: 421 EFVRGGSRQFT 431
           EFVRGGSR FT
Sbjct: 408 EFVRGGSRSFT 418

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/400 (73%), Positives = 342/400 (85%), Gaps = 2/400 (0%)

Query: 34  LFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93
           L S  T+R  G   R+PLQIFR+TFKKEWEKS ELQ +IK LQDASGK+ ESEAYKKAR+
Sbjct: 22  LVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARD 81

Query: 94  AYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRXXXXXXXXXLDESFEPVRQ 152
           AYLKA RGS TI+ KTLKKTG+T+E IATKAWESE+ KNTR         LDESFEPVR 
Sbjct: 82  AYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRN 141

Query: 153 TKIYKEVSEVI-DDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATN 211
           TKIYK+VSEV+ DDG+S RYGGFI K++RRLKRE  L SGKR RAVKSN++AGTA+VATN
Sbjct: 142 TKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATN 201

Query: 212 IESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESS 271
           ++S ES G+K E+FKE+T+VG+ + + K   WDESENPLIV++RKIT K+ GFF ETESS
Sbjct: 202 VQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESS 261

Query: 272 RVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKI 331
           RVYSQFKL+D TF+ ESFTRHLREYIVPEILEAY+KGD KVLK WFSEAPFNVY+AQQK+
Sbjct: 262 RVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKV 321

Query: 332 FKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEA 391
           F++Q+++ DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEIN+YRK KTGE+AAG+ +
Sbjct: 322 FRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNAS 381

Query: 392 NILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           +ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQFT
Sbjct: 382 DILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 333/423 (78%), Gaps = 10/423 (2%)

Query: 14  SRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIK 73
           SR+L  R     + LL++         ++   N ++P+QIFR+TFK+EWEKS  LQ+ IK
Sbjct: 4   SRSLIQRNALHPSKLLISSFHSYPVVLQSNDSN-KTPIQIFRETFKQEWEKSATLQDQIK 62

Query: 74  TLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTR 133
           TL DAS ++ +S+A+KKA++AY      +TI+ KT+ KTG  +   A KAW+S+L + T+
Sbjct: 63  TLTDASDRINQSDAFKKAKDAYKNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQKTK 122

Query: 134 XXXXXXXXXLDESFEPVRQTKIYKEVSEVIDDGESS-RYGGFITKEQRRLKRERDLASGK 192
                    LD+SFEPVR TKIYK+VSEVIDD ++S +YGGFI+KE+RR KR  DL +GK
Sbjct: 123 LAAKK----LDDSFEPVRNTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQTGK 178

Query: 193 RHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIV 252
           R + +KSN++AGTA++AT+++SKES  +K+ DFKEKTVVG+++ S+K K+WDE++NPLIV
Sbjct: 179 RMKPIKSNDEAGTALIATDLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPLIV 238

Query: 253 VMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKV 312
            MRK+T     FFAETESSRV +QFKL+DP F+NESF R LREYI+PE+LEAY+KGD K+
Sbjct: 239 GMRKVTGVFNRFFAETESSRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDEKI 298

Query: 313 LKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQ 372
           LK WFSEAP+NVY+AQQK  ++Q +++DGR+LDIRGV+IV+AK+L PQDIPV+VV CRAQ
Sbjct: 299 LKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQ 358

Query: 373 EINLYRK----KKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSR 428
           EIN+Y+K    K+T +I AG ++NILMS+YAMVFTRDPEQ+D+DETEGWKILEFVRGGSR
Sbjct: 359 EINIYKKFNVEKQTNDIVAGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGGSR 418

Query: 429 QFT 431
           +FT
Sbjct: 419 KFT 421

>NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496
           bp, 831 aa] {ON} Anc_5.296 YDR285W
          Length = 831

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 60/144 (41%), Gaps = 15/144 (10%)

Query: 177 KEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQ 236
           KE   LKRE D  SG+       N         T    KE+F  + ED KEKT    S++
Sbjct: 289 KEIEYLKREVDDTSGQLSEEKIKNCSLLQEFTKTRETLKENFESQKEDLKEKTT---SME 345

Query: 237 SLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREY 296
           +    L+ +     +  + KI+N+    + E  S  + ++FK M  T   E F++  + +
Sbjct: 346 NCLRTLFKDEMTKQLTEIEKISNQNFEAYLEENSKSLTTEFKNMFETHEGEEFSKMAKHH 405

Query: 297 I------------VPEILEAYVKG 308
                        V +IL A+ K 
Sbjct: 406 EEELEQFLEQKINVSQILNAFEKN 429

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,407,782
Number of extensions: 1779997
Number of successful extensions: 5167
Number of sequences better than 10.0: 53
Number of HSP's gapped: 5363
Number of HSP's successfully gapped: 53
Length of query: 431
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 319
Effective length of database: 40,638,807
Effective search space: 12963779433
Effective search space used: 12963779433
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)