Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YIL021W (RPB3)7.194ON31831817170.0
Skud_9.1487.194ON31831816810.0
Smik_9.1697.194ON31831816740.0
Suva_9.1787.194ON31931916560.0
NCAS0E018307.194ON31832214470.0
KAFR0A026507.194ON31231914320.0
CAGL0J02420g7.194ON31231814090.0
NDAI0G020007.194ON31131914080.0
TDEL0H025307.194ON31131913890.0
ZYRO0D15796g7.194ON30831813730.0
TPHA0C045107.194ON31031813720.0
Kpol_1063.117.194ON31631813630.0
KNAG0H027007.194ON32632613370.0
TBLA0J015207.194ON33533713350.0
SAKL0F07458g7.194ON31532113080.0
ADL120C7.194ON31132212661e-176
Kwal_55.203807.194ON32327512631e-176
KLLA0D16170g7.194ON30731912611e-176
KLTH0E04598g7.194ON32827312631e-176
Ecym_43827.194ON31132212281e-171
Kpol_1018.1393.428ON3352912342e-21
CAGL0B04125g3.428ON3342902297e-21
KAFR0A055203.428ON3342962262e-20
ZYRO0C12364g3.428ON3352912228e-20
Kpol_473.33.428ON3202992155e-19
NDAI0A047703.428ON3352952157e-19
Suva_16.4383.428ON3352902122e-18
TPHA0D039203.428ON3352962122e-18
YPR110C (RPC40)3.428ON3352922122e-18
KNAG0A076003.428ON3341952112e-18
TBLA0F017003.428ON3332922113e-18
KLTH0F12056g3.428ON3502772103e-18
Smik_16.3533.428ON3352922085e-18
ADR031C3.428ON3642912087e-18
KLLA0D14861g3.428ON3342862078e-18
Kwal_23.39983.428ON3342902061e-17
NCAS0A115203.428ON3351972061e-17
Ecym_44503.428ON3341952061e-17
TDEL0F031003.428ON3351962042e-17
SAKL0F06028g3.428ON3341972042e-17
Skud_16.3973.428ON3352882016e-17
CAGL0L04928g2.610ON102441694.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL021W
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   665   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   652   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   649   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   642   0.0  
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   561   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   556   0.0  
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   547   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   546   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   539   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   533   0.0  
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   533   0.0  
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   529   0.0  
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   519   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   518   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   508   0.0  
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   492   e-176
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   491   e-176
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   490   e-176
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   491   e-176
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   477   e-171
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    95   2e-21
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    93   7e-21
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    92   2e-20
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    90   8e-20
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    87   5e-19
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    87   7e-19
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    86   2e-18
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    86   2e-18
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    86   2e-18
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    86   2e-18
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    86   3e-18
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    86   3e-18
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    85   5e-18
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    85   7e-18
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    84   8e-18
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    84   1e-17
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    84   1e-17
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    84   1e-17
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    83   2e-17
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    83   2e-17
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    82   6e-17
CAGL0L04928g Chr12 complement(560846..563920) [3075 bp, 1024 aa]...    31   4.1  

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300

Query: 301 SNASQMGNTGSGGYDNAW 318
           SNASQMGNTGSGGYDNAW
Sbjct: 301 SNASQMGNTGSGGYDNAW 318

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/318 (97%), Positives = 314/318 (98%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKD VDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKA+ADTFYMNVESVGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNN A NMLG+NEDV+MTGAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQDPY 300

Query: 301 SNASQMGNTGSGGYDNAW 318
           SNASQMGNTGS GYDNAW
Sbjct: 301 SNASQMGNTGSSGYDNAW 318

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/318 (97%), Positives = 315/318 (99%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYED PNEGDPFDYKA+ADTFYMNVESVGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNN +SN+LG+NEDVMM GAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQDPY 300

Query: 301 SNASQMGNTGSGGYDNAW 318
           SNASQMGN+GSGGYD+AW
Sbjct: 301 SNASQMGNSGSGGYDSAW 318

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/319 (95%), Positives = 315/319 (98%), Gaps = 1/319 (0%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKDNVDFIL++VDLAMANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGD FDYKA+ADTFYMNVESVGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNN ASNMLG+NEDVMMTGAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 301 SNASQMGNTG-SGGYDNAW 318
           +NASQMGNTG SGGYDNAW
Sbjct: 301 ANASQMGNTGSSGGYDNAW 319

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/322 (83%), Positives = 292/322 (90%), Gaps = 8/322 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFILSNVDLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQD+ KEWP SKNCEYEDPPNEG+ FDYKA+A+TFYMNVE+VGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASN---MLGSNEDVMMTGA-E 296
           DQVVVRG+DTLQKKVASILLALTQMDQ+KVNFA+  N  +     M G + DV M G  E
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 297 QDPYSNASQMGNTGSGGYDNAW 318
           Q+ Y+N +  G    G YDNAW
Sbjct: 301 QNSYANVANPG----GAYDNAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/319 (85%), Positives = 288/319 (90%), Gaps = 8/319 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHT+YWYEQD  KEWP SKNCEYEDPPNE DPFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVVVRG+DTLQKKVASILLAL QMDQ+KVN+ASG   TA    G   D+ M GAEQD +
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG--ATADMNQG---DIAMGGAEQDAF 295

Query: 301 SNASQMGNTGSGG-YDNAW 318
              S M N+ + G YDNAW
Sbjct: 296 Y--SNMPNSNANGIYDNAW 312

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/318 (82%), Positives = 285/318 (89%), Gaps = 6/318 (1%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA++DNVDFILSNVDLA+ANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL+I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKL+HTDYWYE+D  KEWPQSKNCEYEDPPN+ +PFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVV+RGIDTLQKKVASI+LAL QMDQ+KVNFA+GD     N +  + D MM      PY
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD--AKGNGIEEDGDAMMMNGHDGPY 298

Query: 301 SNASQMGNTGSGGYDNAW 318
            +  +  +T    Y +AW
Sbjct: 299 GDNGRSSDT----YGSAW 312

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/319 (82%), Positives = 289/319 (90%), Gaps = 9/319 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSN+DLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQD  KEWP SKNCEYEDPPNEG+PFDYKA+A+TFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFAS-GDNNTASNMLGSNEDVMMTGAEQDP 299
           DQVVVRGI+TLQ+KVASILLALTQMDQ+K+ +A+  +    +NM+  N+DV M G   D 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMM--NQDVDMDG---DA 295

Query: 300 YSNASQMGNTGSGGYDNAW 318
           Y+N +   N   G Y++AW
Sbjct: 296 YANGA---NNQPGAYNDAW 311

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/319 (81%), Positives = 280/319 (87%), Gaps = 9/319 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFILS VDLAMANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ D FDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAE-QDP 299
           DQVV+RGIDTLQKKVASILLAL QMDQ++VNF +  NNT +     N DV M G + Q+P
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTA-NNTGAIQDAGNVDVAMDGVQDQNP 299

Query: 300 YSNASQMGNTGSGGYDNAW 318
           YSN       G G YD AW
Sbjct: 300 YSN-------GGGAYDEAW 311

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/318 (82%), Positives = 281/318 (88%), Gaps = 10/318 (3%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+++NVDFILS+V+LAMANSLRRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRN+GHPIIQDKEGNGVLICKLRKGQEL L CVAKKGIAKEHAKWGP+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHT+YW+EQD AKEWP SKN EYEDPPNEG+PFDY+A A+TFYMNVESVGS+  
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVV+RGIDTLQKKVASILLALTQMDQDKVNFASG    A      + D MM G +  PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAV----GDGDTMMNGDDY-PY 295

Query: 301 SNASQMGNTGSGGYDNAW 318
                    GSG YD++W
Sbjct: 296 G-----ATGGSGVYDDSW 308

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/318 (81%), Positives = 284/318 (89%), Gaps = 8/318 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MS+EGPQVKIREA+KDNVDFI+SNVDLAMAN+ RRVMIAEIPTLAIDSVEV +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGL+PLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYSKDLVI
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L+GRNIGHPIIQDKEGNGVLICKLRKGQELK TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHT+YWYEQD+AKEWPQSKNCEYEDPPNEG  FDYKA+ADTFYMNVE++G++  
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQV+VRGID LQKKVASILLAL ++DQDKVN+A  +N     M G  ED+ M G E DPY
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVNYAGNNNVNNGEMDG--EDITMNGTENDPY 298

Query: 301 SNASQMGNTGSGGYDNAW 318
           ++    GN  S  YD AW
Sbjct: 299 AS----GNNNS--YDGAW 310

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/318 (82%), Positives = 280/318 (88%), Gaps = 2/318 (0%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILS+VD+A+ANSLRRVMIAEIPTLAIDSVEV TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGL+PLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYSKDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTD+W+EQD AKEWPQSKNCEYEDPP+EG+ FDYKAQAD F    E+VG+I  
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVV+RGIDTLQKKVASILLALTQMDQDKV +A   N  A  M G N D+ M G   DPY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEG-NGDINMGGTGNDPY 299

Query: 301 SNASQMGNTGSGGYDNAW 318
           SN       G+G YD+AW
Sbjct: 300 SNNGGE-MGGNGVYDDAW 316

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/326 (79%), Positives = 286/326 (87%), Gaps = 8/326 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA++DNVDFILSNV+LAMANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQSMDIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHT YWYE D+A+EWP S+NCEYEDPP EG+PFDYK++A+TFYMNVE++GSI V
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD-NNTASNML--GSNEDVMMTGAEQ 297
           DQVVVRGIDTLQKKVASILL+LTQM+Q+K NFA G+      NM+  G  +     G +Q
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300

Query: 298 DPY-SNASQMGNTGSGG----YDNAW 318
           D Y  NA   GN GSG     YD+AW
Sbjct: 301 DMYVPNAGTGGNIGSGSGSGVYDDAW 326

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/337 (74%), Positives = 279/337 (82%), Gaps = 21/337 (6%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQ+KIREA+KDNVDFILSN+D+A+ANSLRRVMIAEIPTLAIDSVEVE NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFI+HRLGLIPLQS DI+QLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELK+TCVAKKGIAKEHAKWG  AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYE D  KEWP SKNC+YEDPP EG+ FDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASG--DNN-----------------TAS 281
           DQV++RGIDTLQKK A ILLAL+QM+Q+KVNF +G  DNN                 +  
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQDNNDLHQQDDHMGMSNGNDASYG 300

Query: 282 NMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW 318
           N +GSN D MM G   +         N G  GY ++W
Sbjct: 301 NYMGSNNDGMMNGGGNN--IQGGYQNNMGPNGYSDSW 335

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/321 (76%), Positives = 270/321 (84%), Gaps = 9/321 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KD+VDFILSNVD+A+ANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQD A EWPQSKNCEYEDPPNE D FDY A+ +TFYM+VE+VGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQ--D 298
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF     N        N DV M G  +  D
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGN------ADNVDVAMDGENEMSD 294

Query: 299 PY-SNASQMGNTGSGGYDNAW 318
           PY SN  Q     S G+D+AW
Sbjct: 295 PYTSNQDQYNGGPSAGFDDAW 315

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  492 bits (1266), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/322 (72%), Positives = 263/322 (81%), Gaps = 15/322 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVY+KDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKL+HTDYW+EQD   EWP SKNCE+EDPPNE D FDY A+ +TFYMNVESVGSIP 
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   D      +QDPY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTGDAAPMEVDQDPY 289

Query: 301 SNAS----QMGNTGSGGYDNAW 318
           S  S    +  +     YD+AW
Sbjct: 290 SATSGRFNEYNDNAHAAYDDAW 311

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  491 bits (1263), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 229/275 (83%), Positives = 251/275 (91%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KDNVDFILSNVD+AMANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE D FDY+A+  TFYMNVESVGS+ V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASG 275
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF   
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGA 275

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  490 bits (1261), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/319 (73%), Positives = 268/319 (84%), Gaps = 13/319 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDLA+ANSLRRVMI+EIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFIAHRLGLIPLQS DI+Q+ Y RDC+CEDHCD+CSV L L A GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
            S+L GRNIGHPIIQD+E NGVLICKLRKGQE+++ C+AKKGI+KEHAKW P+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYWYEQD+  EWPQSKNCE+EDPPNE + FDY+A+ +TFY+NVESVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNT-ASNMLGSNEDVMMTGAEQDP 299
           +QVVVRGI TLQ KVA IL +L +MDQ+KVNFA+G  +T  S  +   ED+       DP
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAVSTHVSQQVPMEEDM-------DP 293

Query: 300 YSNASQMGNTGSGGYDNAW 318
           Y      G  G  GYD+AW
Sbjct: 294 YG-----GPVGGSGYDDAW 307

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  491 bits (1263), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 230/273 (84%), Positives = 250/273 (91%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KDNVDFILSNVD+ MANSLRRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFI+HRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDK+GNGVLICKLRKGQELKL CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE + FDY A+  TFYMNVE+VGS+ V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFA 273
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF 
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG 273

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  477 bits (1228), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/322 (70%), Positives = 262/322 (81%), Gaps = 15/322 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240
           DPWNKLKHTDYW+EQD+  EWP SKNCE+EDP N+ D FDY A+ + FY+NVESVGSI  
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   +      + DPY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTSENAPMEVDHDPY 289

Query: 301 SNA----SQMGNTGSGGYDNAW 318
           S      ++  +  +  YD+AW
Sbjct: 290 SGTNGQYNEYNDNTNTAYDDAW 311

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 134/291 (46%), Gaps = 51/291 (17%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           ++ I   +    +F L N+D ++AN+ RR+MI+E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------ST 110
           +GL+PL+ +D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYSKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
           +NVY++DL       G+ +     +P++       +L+CKLR GQE+ L      GI  +
Sbjct: 160 SNVYARDLKFEP--QGKQVESFANYPVVP--ANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL----------KHTDYW-------------YEQDSAKEWPQ 203
           HAK+ P A   +   P   +          K   Y+             Y +D+ K+   
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVS 275

Query: 204 SKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
            +   +  P  EG         + F +NVES G++  +++  + +  L+ K
Sbjct: 276 RE--VFRHPEFEGK-VKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 92.8 bits (229), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 143/290 (49%), Gaps = 51/290 (17%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           QV   E  + N D I   +D ++AN+ RR+MIAE+P +A + V ++ NT+V+ DE +AHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQ--SMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESE--------------ST 110
           +GL+PL+     +E+L+ S     E H DK ++V+TL                     + 
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYSKDLVI--VSNLMGRNIGHPIIQ-DKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
            +VY++DL     S+ +      P++  D +   +L+ KLR GQE+ L+     G  K+H
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILGEGKDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKE----WPQ-----SKNCE--YEDPPNEG 216
           AK+ P A   +   P  ++         DSAK     +P+     ++N E    DP  + 
Sbjct: 217 AKFSPVATASYRLLPHIEILEP---ITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDT 273

Query: 217 --------DPFDYKAQ----ADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
                   + F+ K +     D F  NVES G++  + +V++ ID L+KK
Sbjct: 274 VSREVLRHEEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 133/296 (44%), Gaps = 53/296 (17%)

Query: 3   EEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   VKI   ++   +F L ++D ++AN+ RR+MI+E+P +A++ V    NT+V+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQ--------AFGESESTTN 112
           +AHR+GL+PL+ +D + L +      +D    D+ ++VLTL         A  +      
Sbjct: 97  LAHRIGLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNI 155

Query: 113 VYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLIC-------KLRKGQELKLTCVAKKGIAK 165
           +Y    V  S+L     G   ++    N V+ C       KLR GQE+ L      GI  
Sbjct: 156 LYRNSNVYASDLKFEPQGKQ-VETFANNAVVPCDPKILLAKLRPGQEISLRAHCILGIGS 214

Query: 166 EHAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQDSAKEWP 202
           +HAK+ P A   +   P               + K        +K     Y QDS K+  
Sbjct: 215 DHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQDSRKDTV 274

Query: 203 QSKNCEYEDPPNEGDPFDYKAQ----ADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
             +   +E+       F+ K +     D F  NVES G++  +++  + +  L+ K
Sbjct: 275 SREVYRHEE-------FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 90.1 bits (222), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 131/291 (45%), Gaps = 52/291 (17%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   ++   +F L +VD ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYSKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++Y++DL       G  +      P+I       +L+ KLR GQE+ L      G+  +H
Sbjct: 161 HIYARDLKF--EPQGSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKH------------------------TDYWYEQDSAKEWPQ 203
           AK+ P A   +   P   ++                         TD  Y QD+ K+   
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
            +   +E+  N+          D F  NVES G++  +++  + +  L+ K
Sbjct: 277 REVLRHEEFSNK---VKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 135/299 (45%), Gaps = 59/299 (19%)

Query: 3   EEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E  ++ I +  +   +  L NVD ++AN+LRR+MI+E+P++A + + +  NT+V+ DE 
Sbjct: 23  RENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEV 82

Query: 63  IAHRLGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE------------ 108
           IA R+GLIPL+ +D ++L +  +   ED    D+ ++VL+L                   
Sbjct: 83  IAQRIGLIPLK-VDPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSI 141

Query: 109 --STTNVYSKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKG 162
                ++Y++DL       G+        P++       +LI KLR GQE+ L      G
Sbjct: 142 LYHNAHIYARDLKFEPQ--GKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILG 197

Query: 163 IAKEHAKWGPAAAIEFEYDP----WNKLK-------------------HTDYWYEQDSAK 199
           I  +HAK+ P     +   P      K+K                     D  Y +D+ K
Sbjct: 198 IGADHAKFSPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARK 257

Query: 200 EWPQSKNCEYEDPPNEGDPFDYKAQADT----FYMNVESVGSIPVDQVVVRGIDTLQKK 254
           +    +   +E+       F  K + D     F  N+E+VG++  +++ ++ +  L+ K
Sbjct: 258 DTMTREVLRHEE-------FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 87.4 bits (215), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 134/295 (45%), Gaps = 52/295 (17%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   S+   +F L N+D +MAN+ RR+MI+E+P++A + V   TNT+V+ DE +AHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTL-----QAFGESESTTN-------- 112
           G+IPL+ +D + L +      E+    D  +VV++L     +     +  T+        
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 113 -VYSKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
            VY+KDL       G+ +      P++       +L+ KLR  QE+ L      G+  +H
Sbjct: 161 SVYAKDLKF--EPQGKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDPW-NKLK-----------------------HTDYWYEQDSAKEWPQ 203
           AK+ P +   +   P  N LK                        T   Y +D+ K+   
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 204 SKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASI 258
            +   +E+     D        D F  NVES G++  +++  + +  L+ K + +
Sbjct: 277 REVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKASYL 328

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 128/290 (44%), Gaps = 48/290 (16%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I      + +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQ--------AFGESESTTNVYSK 116
           +GL+PL+ +D + L +      +D    D+ +VVL+L         A  +S     +Y+ 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 117 DLVIVSNLMGRNIGH--------PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHA 168
             V   +L     G         P++       +L+ KLR GQE+ L      G+  +HA
Sbjct: 160 AHVYARDLKFEPQGRQSTTFANCPVLP--ADPDILLAKLRPGQEISLKAHCILGVGGDHA 217

Query: 169 KWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWPQS 204
           K+ P +   +   P   +                        + +D  Y +D+ K+    
Sbjct: 218 KFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTVSR 277

Query: 205 KNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
           +   YE+     D        + F  NVES G++  +++  + +  L+ K
Sbjct: 278 EVLRYEE---FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 133/296 (44%), Gaps = 53/296 (17%)

Query: 3   EEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   + I   ++   +F L ++D ++AN+ RR+MIAE+P++A + V    NT+V+ DE 
Sbjct: 37  RESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSMDIEQLEYSRDCFC--EDHCDKCSVVLTLQAF------GESEST---- 110
           +AHR+GLIPL+ +D ++L +        E   D+ ++V+TL A          ++T    
Sbjct: 97  LAHRIGLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKV 155

Query: 111 ----TNVYSKDLVI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKK 161
                +VY++DL        + L        I  D     +LI KLR GQE+ L      
Sbjct: 156 LYRNAHVYARDLKFEPQGKQAELFADQPVEAIDPD-----ILIAKLRPGQEISLRAHCIL 210

Query: 162 GIAKEHAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQDSA 198
           GI  +HAK+ P A   +   P               + K        +   D  + +D+ 
Sbjct: 211 GIGGDHAKFSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDAR 270

Query: 199 KEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
           K+    +   +E+  N+          D F  NVES G++  +++  + +  L+ K
Sbjct: 271 KDTVSREVLRHEEFQNK---VKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 129/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF--------------GESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYSKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
            +VY++DL       GR        P++       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFADCPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D+ K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
             +   YE+     D        + F  NVES G++  +++  + +  L+ K
Sbjct: 276 SREVLRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 99/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI   S+   +F L ++D ++AN+ RR+MI+E+P++A + V V  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           G+IPL+ +D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYSKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           +VY++DL       G+ +      P++       +L+ KLR  QE+ L      GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDPD--ILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P A   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 85.9 bits (211), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 129/292 (44%), Gaps = 56/292 (19%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI    + +  F L N+D ++AN+ RR+M+AE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYSKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           +VY++DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDP--PNEGDPFDYKAQA 225
           AK+ P A   +   P   +       E    K+  + + C         +G+ +   A+ 
Sbjct: 217 AKFSPVATASYRLLPHINIT------EPIRGKDAEKFQKCFTPGVIGIKDGEAYVKDARM 270

Query: 226 DT-----------------------FYMNVESVGSIPVDQVVVRGIDTLQKK 254
           DT                       F  NVES G++P +++  + +  L+ K
Sbjct: 271 DTVSREVFRHQEFADKVKLGRVRDHFVFNVESTGAMPPEEIFFKSVRILKNK 322

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 122/277 (44%), Gaps = 47/277 (16%)

Query: 19  DFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIE 78
           +F L NVD ++AN+ RR+MIAE+P++A + V    NT+V+ DE +AHR+GL PL+ +D +
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLK-VDPD 127

Query: 79  QLEYSRDCF--CEDHCDKCSVVLTLQAFGESE--------------STTNVYSKDLVIVS 122
            L +        E   D+ ++VLTL                        ++Y++DL    
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 123 NLMGRNI--GHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
               R     +P++       +L+ KLR GQE+ L      GI  +HAK+ P +   +  
Sbjct: 188 QGKQRETFAKNPVVPADP--DILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADT------------- 227
            P   +         +SA+ + +  +       + G+ F   A+ DT             
Sbjct: 246 MPHINITQP---ITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRHEEFEG 302

Query: 228 ----------FYMNVESVGSIPVDQVVVRGIDTLQKK 254
                     F  NVES G++  +++  + +  L+ K
Sbjct: 303 KVKLGRVKNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 129/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF--------------GESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYSKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
            +VY++DL       G+        P++       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKF--EPQGKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D+ K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
             +   Y++     D        + F  NVES G++  +++  + +  L+ K
Sbjct: 276 SREVLRYDE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 84.7 bits (208), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 130/291 (44%), Gaps = 53/291 (18%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I+   +   +F L  VD ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSMDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------FGESESTT 111
           GL+PL+ +D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYSKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++Y++DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 191 HIYARDLKF--EPQGKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWGPAAAIEFEYDPW-NKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQAD 226
           AK+ P A   +   P+ N ++       +   K +P       E    +G+ F   A+ D
Sbjct: 247 AKFSPVATASYRLMPYINIVEPITGPDAEKFVKCFPPGVAAINE----KGEAFVQDARKD 302

Query: 227 T-----------------------FYMNVESVGSIPVDQVVVRGIDTLQKK 254
           T                       F  NVES G++  +++  + +  L+ K
Sbjct: 303 TVSREVLRHPELEQKVKLGRVRDHFIFNVESAGAMTPEEIFFKSVRILKNK 353

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 84.3 bits (207), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 131/286 (45%), Gaps = 43/286 (15%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +  V+F L +VD ++AN+ RR+MI+E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCF--CEDHCDKCSVVLTLQ--------AFGESESTTNVYSKD 117
           GL+PL+ +D + L +        E   D+ ++V++L         A  + E    +Y   
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 118 LVIVSNLMGRNIGHPIIQDKE------GNGVLICKLRKGQELKLTCVAKKGIAKEHAKWG 171
            +   +L     G  + Q  +         +L+ KLR GQE+ L      GI  +HAK+ 
Sbjct: 161 HIYARDLKFEPQGKQVEQFAKCPVVAADPDILLAKLRPGQEISLRAHCILGIGADHAKFS 220

Query: 172 PAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQ----------SKNCEY-EDPPNEG---- 216
           P +   +   P  ++         D AK++ +           K   Y +DP  +     
Sbjct: 221 PVSTASYRLLPHIQITQP---ITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDTVSRE 277

Query: 217 ----DPFDYKAQ----ADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
               D F  K +     D F  NVES G++  +++  + +  L+ K
Sbjct: 278 VLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 129/290 (44%), Gaps = 51/290 (17%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +   +F L NVD ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCF--CEDHCDKCSVVLTLQAFGESE--------------STT 111
           GL PL+ +D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYSKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++Y++DL       G+ +     +P++       VL+ KLR GQE+ L      GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADT 227
           AK+ P     +   P   +         +SA+++ +  +       +EG+ +   A+ DT
Sbjct: 217 AKFSPVCTASYRLMPHINITSP---ITGESAQKFAKCFSPGVIGINDEGEAYVKDARHDT 273

Query: 228 -----------------------FYMNVESVGSIPVDQVVVRGIDTLQKK 254
                                  F  NVES G++  +++  + +  L+ K
Sbjct: 274 VSREVLRHEEFEGKVKLGRIRDHFIFNVESAGAMTPEEIFFKSVRILKNK 323

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 27/197 (13%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V+I   ++   +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIEQLEYSRDCFC--EDHCDKCSVVLTLQ--------AFGESESTTNVYSK 116
           +GLIPL+ +D + L +  +     E   D  ++VLTL         A  ++     +Y  
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 117 DLVIVSNL----MGRNI----GHPII---QDKEGNGVLICKLRKGQELKLTCVAKKGIAK 165
             V  S+L     G+ I    G P++   QD     +L+ KLR GQE+ L      G   
Sbjct: 160 SSVYASDLKFEPQGKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGTGG 214

Query: 166 EHAKWGPAAAIEFEYDP 182
           +HAK+ P +   +   P
Sbjct: 215 DHAKFSPVSTASYRLLP 231

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 25/195 (12%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I        +F L ++D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCF--CEDHCDKCSVVLTLQAF--------------GESESTT 111
           GL+PL+ +D + L +        E   D+ +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYSKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++YS+DL       G+ +     HP++       +L+ KLR GQE+ L      G+  +H
Sbjct: 161 HIYSRDLKF--EPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 97/196 (49%), Gaps = 27/196 (13%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   ++   +F L ++D ++AN+ RR+MI+E+P+LA + V    NT+V+ DE +AHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYSKDLVI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
           +VY+ DL        + L  +    P   D     +L+ KLR GQE+ L      G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDP 182
           HAK+ P A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 98/197 (49%), Gaps = 29/197 (14%)

Query: 8   VKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           VKI    +   +F L ++D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESESTTN-------VYSKDL 118
           GL+PL+ +D + L +  +   E+    D+ ++VLTL      + T N          K L
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNV----KCTRNPDAPKDCTDPKVL 156

Query: 119 VIVSNLMGRNIGH-------------PIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAK 165
              SN+  R++               P++       +L+ KLR GQE+ L      GI  
Sbjct: 157 YRNSNIYARHLKFEPQGKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGS 214

Query: 166 EHAKWGPAAAIEFEYDP 182
           +HAK+ P     +   P
Sbjct: 215 DHAKFSPVCTASYRLMP 231

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 82.0 bits (201), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 124/288 (43%), Gaps = 44/288 (15%)

Query: 7   QVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I    +   +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF--------------GESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKW 170
            +VY++DL                       +L+ KLR GQE+ L      GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPAAAIEFEYDPW-NKLKH-----------------------TDYWYEQDSAKEWPQSKN 206
            P +   +   P  N L+                        +   Y +D+ K+    + 
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 207 CEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKK 254
             YE+     D        + F  NVES G++  +++  + +  L+ K
Sbjct: 280 LRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>CAGL0L04928g Chr12 complement(560846..563920) [3075 bp, 1024 aa]
           {ON} similar to uniprot|Q02630 Saccharomyces cerevisiae
           YMR047c NUP116 or uniprot|Q02629 Saccharomyces
           cerevisiae YKL068w
          Length = 1024

 Score = 31.2 bits (69), Expect = 4.1,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 273 ASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGG 313
           A G NNT    + SN+   + GA+  P+ N+  +G+TG  G
Sbjct: 73  AGGSNNTPGFGINSNQPQNVFGAQSSPFGNSKPVGSTGLFG 113

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,513,310
Number of extensions: 1506343
Number of successful extensions: 3272
Number of sequences better than 10.0: 50
Number of HSP's gapped: 3345
Number of HSP's successfully gapped: 57
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)