Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YHR117W (TOM71)2.152ON63963931230.0
Smik_8.1952.152ON63563926430.0
Skud_8.1782.152ON63864025930.0
Suva_15.3142.152ON64464424840.0
ZYRO0G06512g2.152ON60453815740.0
Kpol_1048.212.152ON59753815610.0
TDEL0B051402.152ON59953815560.0
NCAS0B070102.152ON62554015520.0
CAGL0L12936g2.152ON60053815410.0
SAKL0E10956g2.152ON60053815250.0
Kwal_33.147672.152ON59454215100.0
KLTH0B05170g2.152ON59354115070.0
Skud_14.2112.152ON61755814980.0
KNAG0H035302.152ON61454514970.0
YNL121C (TOM70)2.152ON61755514740.0
Suva_14.2192.152ON61755514710.0
Smik_14.2072.152ON61755514710.0
KAFR0F007202.152ON60853814510.0
Ecym_82042.152ON59753814490.0
TPHA0I015102.152ON60353814490.0
TBLA0C055302.152ON61053914360.0
ABR131W2.152ON59453814120.0
KLLA0F24046g2.152ON60453713850.0
NCAS0G024802.152ON59653413700.0
CAGL0L04048g2.152ON58753113021e-173
NDAI0F028102.152ON60953112891e-170
NDAI0B043402.152ON66454712931e-170
Ecym_30256.21ON3181291588e-11
Kpol_505.413.481ON513971563e-10
NDAI0B057903.481ON523951511e-09
SAKL0F03102g3.481ON5131521474e-09
NCAS0G008105.617ON584901457e-09
ACR005W6.21ON3271221438e-09
KLTH0F14542g3.481ON513951441e-08
SAKL0G07084g5.617ON585901432e-08
TBLA0E033005.617ON582901422e-08
NDAI0F009105.617ON583891412e-08
Ecym_44133.481ON510951403e-08
KLLA0D01155g6.21ON335681383e-08
AEL224W5.617ON580901394e-08
SAKL0E01210g6.21ON3231041364e-08
Kwal_55.199355.617ON593901385e-08
Suva_8.805.617ON586901386e-08
Kpol_1032.86.21ON3431061357e-08
KAFR0L004106.21ON3311011357e-08
KAFR0B066103.481ON5111551378e-08
CAGL0D05060g3.481ON510951368e-08
Suva_7.4083.481ON513981341e-07
KLLA0A07062g5.617ON581901332e-07
TDEL0D055003.481ON5121011323e-07
AAR083C3.481ON5381661323e-07
YGR123C (PPT1)3.481ON513981314e-07
TDEL0G044806.21ON3431071294e-07
NCAS0F034903.481ON512951314e-07
YOR027W (STI1)5.617ON589901314e-07
TBLA0C039503.481ON512971295e-07
Smik_15.2055.617ON589901296e-07
Smik_6.2153.481ON513971296e-07
Kwal_55.211753.481ON511951296e-07
TPHA0D032203.481ON5131041288e-07
CAGL0H08195g5.617ON583901289e-07
Suva_16.5217.546ON14244131281e-06
TPHA0D028805.617ON585901262e-06
TPHA0J003406.21ON3381061242e-06
NCAS0H008306.21ON3381041242e-06
Skud_15.1925.617ON589931252e-06
TBLA0G010506.21ON350761223e-06
KNAG0B032005.617ON579901234e-06
KLLA0B10912g3.481ON5121081224e-06
KNAG0A079003.481ON5121041224e-06
Kwal_56.224336.21ON322951204e-06
NDAI0D008106.21ON3491411205e-06
Ecym_55825.617ON584901191e-05
KAFR0C058905.617ON575901181e-05
Skud_7.4323.481ON513951181e-05
ZYRO0A05676g5.617ON572901181e-05
Kpol_1018.695.617ON590901181e-05
TPHA0E007407.412ON7461621172e-05
TBLA0A072706.21ON373861153e-05
YPR189W (SKI3)7.546ON14323681163e-05
Kpol_1037.266.21ON3421501134e-05
ZYRO0F08624g8.506ON3791401134e-05
ZYRO0B04224g3.481ON513971144e-05
CAGL0E02739g6.21ON343801125e-05
KLTH0A00638g7.546ON14112161145e-05
TDEL0A048405.617ON576901135e-05
KNAG0M011706.21ON3391071108e-05
Smik_4.4918.470ON612891091e-04
SAKL0A01672g6.328ON128681012e-04
YDR244W (PEX5)8.470ON612881092e-04
TPHA0D038606.328ON120731002e-04
CAGL0G10087g7.546ON14114261092e-04
SAKL0F16236g7.546ON14083631092e-04
KLTH0E02178g5.617ON593901073e-04
KLLA0B09966g8.506ON370941044e-04
KNAG0I025206.328ON11789975e-04
Kwal_27.107407.412ON6282531046e-04
TBLA0I023106.328ON11662966e-04
Suva_2.4108.470ON611891046e-04
KAFR0B002507.546ON1420641056e-04
Skud_4.5068.470ON611891047e-04
NDAI0I004406.328ON12867960.001
NCAS0A153007.546ON1398721030.001
Suva_15.1826.21ON3461071010.001
TDEL0C050903.367ON7591351020.001
KLTH0C06204g7.412ON6272531010.001
Kpol_1018.1067.412ON7532341010.002
ZYRO0C07788g6.21ON334104990.002
NDAI0I022406.21ON35089990.002
Ecym_20906.328ON17262950.002
KLTH0C11220g6.21ON327129970.003
TDEL0H002507.546ON1397104990.003
TBLA0H033808.506ON375149980.003
KAFR0J025706.328ON12138910.003
Smik_2.2958.506ON38593970.004
Smik_16.4537.546ON1417102980.004
ZYRO0C16522g3.367ON974135970.005
NCAS0B024008.506ON38092960.005
KLLA0C15455g8.470ON56692970.005
YKL022C (CDC16)2.665ON84091970.005
NCAS0A112003.367ON907133970.005
YBL084C (CDC27)7.412ON758220970.005
TPHA0M002706.21ON37789960.005
KNAG0H006103.367ON973135970.005
Kpol_1050.1127.546ON136072970.006
CAGL0K11209g8.470ON59096960.006
Kpol_513.28.506ON37492950.006
NDAI0C052908.506ON37993950.007
KLLA0C08910g6.328ON11560880.007
KNAG0A041208.470ON60282950.008
YOR007C (SGT2)6.21ON346107940.008
Kwal_27.118908.506ON334129940.009
NDAI0J001307.546ON140381950.009
Skud_16.4937.546ON142572950.010
Skud_15.1686.21ON348104930.010
TBLA0B049907.546ON141082950.010
Smik_2.367.412ON751220940.011
Smik_11.2322.665ON79391940.011
SAKL0F12936g7.412ON632134940.011
YBR155W (CNS1)8.506ON385114930.012
Suva_3.956.328ON11170860.012
NDAI0E040407.412ON783170940.012
NCAS0B025608.470ON57882930.012
Kpol_1028.516.328ON11773860.013
NDAI0J007107.458ON33558920.013
Kwal_23.54087.546ON141099940.014
TBLA0A016908.470ON662128930.015
AAR054C6.328ON13362860.017
YCR060W (TAH1)6.328ON11158850.017
Skud_2.2828.506ON38590910.018
Skud_11.2062.665ON80285920.018
KNAG0A039508.506ON38693910.019
KAFR0L018707.412ON712208920.020
Skud_3.1356.328ON11869850.022
Smik_15.1766.21ON345107900.023
TPHA0M016303.367ON1043135910.026
Ecym_71427.412ON675330900.028
CAGL0C01903g7.412ON769269900.030
TPHA0A052905.72ON66686900.030
Kpol_1006.43.367ON732163900.033
Kpol_1031.648.470ON60788900.035
TDEL0B016608.470ON54996890.036
NDAI0G037103.5ON1121103900.038
CAGL0D01364g3.367ON1148133900.040
Suva_2.347.412ON763220890.041
NDAI0A051003.367ON1007133890.046
Kpol_1050.825.72ON63987890.047
TDEL0B013108.506ON380203880.047
TDEL0A074306.328ON12444830.047
Ecym_28207.546ON1398111890.049
ABR206W5.72ON61481880.049
ZYRO0D00836g7.546ON1401127890.052
NCAS0A00490singletonON62071880.059
KAFR0H008703.367ON887135870.073
KLTH0E10934g8.470ON56889870.079
NCAS0E024907.412ON809162870.081
Skud_2.247.412ON769220860.088
NDAI0C051308.470ON59077860.089
Ecym_50925.72ON62665860.090
AGL294W7.412ON656115860.095
KAFR0E029808.506ON38092850.096
Kwal_33.134281.88ON105282860.10
Suva_4.4058.506ON38579850.11
AEL281C7.546ON139082850.13
KLLA0A05258g5.72ON63265850.13
Smik_2.2543.367ON1020125850.13
Suva_11.2042.665ON79391850.13
NDAI0C033505.72ON64967850.13
CAGL0H07425g8.506ON38094840.14
Suva_4.3613.367ON963125850.14
Kwal_56.247505.72ON61989840.16
TPHA0E011105.352ON69372840.16
YBR112C (CYC8)3.367ON966125840.17
TDEL0C027207.412ON700165830.20
AGL268C8.506ON37992820.23
Kwal_27.117378.470ON57589820.24
NCAS0F028705.352ON70071830.25
Skud_2.2403.367ON984125820.28
KLLA0B03520g7.546ON140169820.28
TBLA0H015203.367ON689328820.29
SAKL0H10934g8.506ON380121810.33
Ecym_13968.470ON57378810.33
TBLA0F012303.367ON1189114820.36
TPHA0P015903.5ON1077241800.47
TDEL0G009605.72ON62289800.47
ZYRO0B03828g7.412ON727133800.48
KNAG0H001602.665ON78091800.48
SAKL0H02244g5.72ON62889800.49
TPHA0G002407.546ON143094800.51
TDEL0E027505.352ON564125800.53
KNAG0F040107.546ON141872800.54
TBLA0B079705.72ON68765800.55
Smik_3.1596.328ON11567740.60
Kpol_172.23.367ON41878790.62
TPHA0L012108.470ON58878790.62
KLLA0E20857g7.412ON710248790.67
Suva_8.1295.689ON74182790.70
KAFR0D023405.689ON69768790.74
TDEL0A002403.5ON1059230790.75
KLTH0E11748g8.506ON37893780.75
ZYRO0C03564g3.5ON109675790.77
NCAS0C043503.5ON1087222780.82
CAGL0K09240g6.328ON14244740.82
CAGL0J02134g7.142ON951168780.83
NCAS0D045006.328ON12171730.86
Ecym_25598.506ON370126770.91
Ecym_34593.367ON1115114780.92
CAGL0B01375g3.5ON111091780.92
KAFR0C038202.665ON70472771.0
TPHA0L014208.506ON374147771.0
Kwal_23.36703.367ON802135771.1
NCAS0D013905.72ON63193771.1
NDAI0F004005.689ON76498771.1
Kpol_1057.142.665ON724102771.1
KLLA0B09262g3.367ON941125771.2
Kpol_1028.1017.469ON38766761.2
Skud_8.2305.72ON62667771.3
ACR168W2.665ON707142771.3
Smik_8.2505.72ON62667761.3
KAFR0C018505.352ON646104761.3
AFR663W1.88ON103893771.3
KLTH0H00704g5.72ON62167761.4
Suva_15.3665.72ON62667761.4
YHR166C (CDC23)5.72ON62667761.6
TPHA0N018702.665ON85490761.7
KNAG0B022407.412ON73983751.7
AEL112C1.185ON53561751.8
KNAG0K026303.5ON107694752.4
ZYRO0D00572g2.665ON785104742.4
ADL344W3.367ON91082742.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR117W
         (639 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...  1207   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...  1022   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...  1003   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   961   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   610   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   605   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   603   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   602   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   598   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   592   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   586   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   585   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   581   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   581   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   572   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   571   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   571   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   563   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   562   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   562   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   557   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   548   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   538   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   532   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   506   e-173
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   501   e-170
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   502   e-170
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    65   8e-11
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    65   3e-10
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    63   1e-09
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    61   4e-09
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    60   7e-09
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    60   8e-09
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    60   1e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    60   2e-08
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    59   2e-08
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     59   2e-08
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    59   3e-08
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    58   3e-08
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    58   4e-08
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    57   4e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    58   5e-08
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    58   6e-08
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    57   7e-08
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    57   7e-08
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    57   8e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    57   8e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    56   1e-07
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    56   2e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    55   3e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    55   3e-07
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    55   4e-07
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    54   4e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    55   4e-07
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    55   4e-07
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    54   5e-07
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    54   6e-07
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    54   6e-07
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    54   6e-07
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    54   8e-07
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    54   9e-07
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    54   1e-06
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    53   2e-06
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    52   2e-06
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    52   2e-06
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    53   2e-06
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    52   3e-06
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    52   4e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    52   4e-06
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    52   4e-06
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    51   4e-06
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    51   5e-06
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    50   1e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    50   1e-05
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    50   1e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    50   1e-05
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    50   1e-05
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    50   2e-05
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    49   3e-05
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    49   3e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    48   4e-05
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    48   4e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    49   4e-05
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    48   5e-05
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    49   5e-05
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    48   5e-05
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    47   8e-05
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    47   1e-04
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    44   2e-04
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    47   2e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    43   2e-04
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    47   2e-04
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    47   2e-04
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    46   3e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    45   4e-04
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    42   5e-04
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    45   6e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    42   6e-04
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    45   6e-04
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    45   6e-04
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    45   7e-04
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    42   0.001
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            44   0.001
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    44   0.001
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    44   0.001
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    44   0.001
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    44   0.002
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    43   0.002
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    43   0.002
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    41   0.002
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    42   0.003
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    43   0.003
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.003
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    40   0.003
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.004
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    42   0.004
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    42   0.005
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    42   0.005
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    42   0.005
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    42   0.005
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    42   0.005
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    42   0.005
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    42   0.005
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    42   0.005
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    42   0.006
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    42   0.006
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    41   0.006
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    41   0.007
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    39   0.007
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    41   0.008
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    41   0.008
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    41   0.009
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    41   0.009
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    41   0.010
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    40   0.010
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    41   0.010
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    41   0.011
Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {...    41   0.011
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    41   0.011
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    40   0.012
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    38   0.012
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    41   0.012
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    40   0.012
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    38   0.013
NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7....    40   0.013
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    41   0.014
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    40   0.015
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    38   0.017
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    37   0.017
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.018
Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {...    40   0.018
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    40   0.019
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    40   0.020
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    37   0.022
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    39   0.023
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    40   0.026
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    39   0.028
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    39   0.030
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    39   0.030
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    39   0.033
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    39   0.035
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    39   0.036
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    39   0.038
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    39   0.040
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    39   0.041
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    39   0.046
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    39   0.047
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    39   0.047
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    37   0.047
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    39   0.049
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    39   0.049
ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {O...    39   0.052
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       39   0.059
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    38   0.073
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    38   0.079
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    38   0.081
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    38   0.088
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    38   0.089
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    38   0.090
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    38   0.095
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    37   0.096
Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa] ...    38   0.10 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    37   0.11 
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    37   0.13 
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    37   0.13 
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    37   0.13 
Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {...    37   0.13 
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    37   0.13 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    37   0.14 
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    37   0.14 
Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]...    37   0.16 
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    37   0.16 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    37   0.17 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    37   0.20 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    36   0.23 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    36   0.24 
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    37   0.25 
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    36   0.28 
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    36   0.28 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    36   0.29 
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    36   0.33 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    36   0.33 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    36   0.36 
TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3...    35   0.47 
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    35   0.47 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.48 
KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}...    35   0.48 
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    35   0.49 
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    35   0.51 
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    35   0.53 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    35   0.54 
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    35   0.55 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.60 
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    35   0.62 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    35   0.62 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    35   0.67 
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    35   0.70 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    35   0.74 
TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON...    35   0.75 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    35   0.75 
ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} simil...    35   0.77 
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    35   0.82 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    33   0.82 
CAGL0J02134g Chr10 complement(212192..215047) [2856 bp, 951 aa] ...    35   0.83 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.86 
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    34   0.91 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    35   0.92 
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    35   0.92 
KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {O...    34   1.0  
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    34   1.0  
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    34   1.1  
NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72      34   1.1  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    34   1.1  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    34   1.1  
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    34   1.2  
Kpol_1028.101 s1028 complement(221597..222760) [1164 bp, 387 aa]...    34   1.2  
Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON...    34   1.3  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    34   1.3  
Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON...    34   1.3  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    34   1.3  
AFR663W Chr6 (1648116..1651232) [3117 bp, 1038 aa] {ON} Syntenic...    34   1.3  
KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar ...    34   1.4  
Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {...    34   1.4  
YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}  ...    34   1.6  
TPHA0N01870 Chr14 (397082..399646) [2565 bp, 854 aa] {ON} Anc_2....    34   1.7  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    33   1.7  
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    33   1.8  
KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3...    33   2.4  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    33   2.4  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    33   2.6  
YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}  ...    33   2.6  
NDAI0C00160 Chr3 complement(21850..24186) [2337 bp, 778 aa] {ON}...    33   2.6  
ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {...    33   2.6  
Ecym_4229 Chr4 complement(477067..478215) [1149 bp, 382 aa] {ON}...    33   2.7  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...    33   2.7  
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    33   2.8  
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    33   2.9  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    33   3.1  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    33   3.2  
Kwal_55.22152 s55 (1134267..1137572) [3306 bp, 1101 aa] {ON} YOL...    33   3.3  
Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON} (58546...    33   3.5  
KNAG0C00550 Chr3 (92890..96084) [3195 bp, 1064 aa] {ON} Anc_1.88...    33   3.5  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    33   3.6  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    33   3.7  
Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON} ...    32   3.9  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    32   4.0  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    32   4.1  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    32   4.4  
KLTH0F19734g Chr6 (1599275..1602520) [3246 bp, 1081 aa] {ON} sim...    32   4.5  
Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032...    32   4.7  
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    32   4.8  
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    32   4.8  
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    32   5.1  
CAGL0M01914g Chr13 (232780..234810) [2031 bp, 676 aa] {ON} some ...    32   6.7  
Suva_8.135 Chr8 (238005..238235,238328..238489,238523..239122) [...    32   6.8  
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    32   7.2  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    32   7.7  
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    32   8.3  
ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON...    31   9.2  
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    31   9.6  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    31   9.6  

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 1207 bits (3123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/639 (93%), Positives = 598/639 (93%)

Query: 1   MAENSLLRFITKNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXLKGTKDNRRQSEAFAG 60
           MAENSLLRFITKNKVAIL                          LKGTKDNRRQSEAFAG
Sbjct: 1   MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG 60

Query: 61  QNEDEADLKDDGSVVSGSXXXXXXXXXXXXXXXAKSGEGFDYPSLPNGEPDIAQLKGLSP 120
           QNEDEADLKDDGSVVSGS               AKSGEGFDYPSLPNGEPDIAQLKGLSP
Sbjct: 61  QNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP 120

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV
Sbjct: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 240
           IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
Sbjct: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 240

Query: 241 NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD 300
           NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD
Sbjct: 241 NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD 300

Query: 301 ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN 360
           ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN
Sbjct: 301 ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN 360

Query: 361 LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ 420
           LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ
Sbjct: 361 LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ 420

Query: 421 MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP 480
           MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP
Sbjct: 421 MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP 480

Query: 481 EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ 540
           EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
Sbjct: 481 EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ 540

Query: 541 LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK 600
           LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK
Sbjct: 541 LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK 600

Query: 601 LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML
Sbjct: 601 LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/639 (79%), Positives = 545/639 (85%), Gaps = 4/639 (0%)

Query: 1   MAENSLLRFITKNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXLKGTKDNRRQSEAFAG 60
           MAENSL RFI +NKVAIL                          LKG+KD+RRQSEA   
Sbjct: 1   MAENSLFRFIARNKVAILATVSAGTAAVGAYVYYQQLKQQQQQHLKGSKDHRRQSEASTN 60

Query: 61  QNEDEADLKDDGSVVSGSXXXXXXXXXXXXXXXAKSGEGFDYPSLPNGEPDIAQLKGLSP 120
             EDE  LK+  S+ +                 AKS E F    LPNGEPDI+QLKGL+ 
Sbjct: 61  LKEDEVGLKNKSSIAN---ENKKKKNKRKRKNRAKSAEDFQCTFLPNGEPDISQLKGLTL 117

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           SQ+Q YAVQLKN+GNHFFT KNF EAIKYYQ AIELDPN+PVFYSNISACYISTGDL KV
Sbjct: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 240
           +E+TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
Sbjct: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 237

Query: 241 NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD 300
           NKQAMKVLNENLSK +GRGSQ+LPSNTSL SFFGIFD  LE+S VN SS++DTAYALLSD
Sbjct: 238 NKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSD 297

Query: 301 ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN 360
           ALQ+LYSAT+EGYL A+ L T +TD YHSLL A+ VD PL+ENAALA CYTGIFHFLKNN
Sbjct: 298 ALQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALAFCYTGIFHFLKNN 356

Query: 361 LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ 420
           LL AQ LLQESINLHPTPNSYIFLALTLADKENSQEFFK+FQKA+DL+ EYPPTYYHRGQ
Sbjct: 357 LLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQ 416

Query: 421 MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP 480
           MYFILQDY NAK DFQKAQ+L PEN+YPYIQLACLLYKQGKFTESEA FNETKLKFPTLP
Sbjct: 417 MYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLP 476

Query: 481 EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ 540
           EVP FFAEILTD+GDF TAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
Sbjct: 477 EVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ 536

Query: 541 LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK 600
           LDEEKFN AI LLTKACELDPRSEQAKIGLAQLKLQMEKID+AIELF+DSAILARTMDEK
Sbjct: 537 LDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEK 596

Query: 601 LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           LQATTFAEAAKIQKRLRADPIISAKME+TLA YRAKGM+
Sbjct: 597 LQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/640 (77%), Positives = 543/640 (84%), Gaps = 3/640 (0%)

Query: 1   MAENSLLRFITKNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXLKGTKDNRRQSEAFAG 60
           MAENSLL+FI KNKVAIL                          LKGTK+ RR  E F  
Sbjct: 1   MAENSLLKFIAKNKVAILATVSAGTAAVGAYAYYKQLKQREQQQLKGTKNRRRPGETFTS 60

Query: 61  QNEDEADLKDDGSVVSGSXXXXXXXXXXXXXXXAKSGEGFDYPSLPNGEPDIAQLKGLSP 120
           QNEDE  LKDDGS+ SGS                K  E F+YP L +GEPD+AQL+GL  
Sbjct: 61  QNEDEVSLKDDGSITSGSRKRKKNKRKRKNK--PKLAESFEYPLLSDGEPDMAQLRGLPL 118

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           SQRQ YAVQLK++GNHFFT+KNF++AIKYYQ+AIELDPN+PVFYSN+SACYISTGDL KV
Sbjct: 119 SQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKV 178

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 240
           +E+TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
Sbjct: 179 VEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 238

Query: 241 NKQAMKVLNENLSKDEG-RGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLS 299
           NKQAMKVLN NLSK+ G RGS++LPSNTSLASFFGIFD  LE+S V++ S  DTA+ +L 
Sbjct: 239 NKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLL 298

Query: 300 DALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKN 359
           +ALQRLYSAT EGYL+AN L TK+TD YHSLLSA+ VD  +R NAALA CY GIF FLKN
Sbjct: 299 EALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKN 358

Query: 360 NLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRG 419
           +LLDAQ LLQESINLHPTPNSYIF+ALTLADKENSQEFF FFQKA+DL+PEY PTYYHRG
Sbjct: 359 DLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRG 418

Query: 420 QMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTL 479
           QMYFILQDY NAK DFQKAQSLNP N+YPYIQLACLLYKQGKF+ESE  FNETKLKFPTL
Sbjct: 419 QMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTL 478

Query: 480 PEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPT 539
           PEVPTFFAEILTD+GD++TAIKQYDIAKRL+EVQ KIHVGIGPLIGKATILARQS+QDPT
Sbjct: 479 PEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPT 538

Query: 540 QLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDE 599
           QLDEEKFN AI+LLT+AC+LDPRSEQAKIGLAQLKLQMEKID+AIELF+DSA LARTMDE
Sbjct: 539 QLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDE 598

Query: 600 KLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           KLQATTFAEAAKIQKRLRADPIISAKME TLA YRA GM+
Sbjct: 599 KLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/644 (74%), Positives = 536/644 (83%), Gaps = 5/644 (0%)

Query: 1   MAENSLLRFITKNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXLK---GTKDNRRQSEA 57
           MAENS  +F  +NK+AI+                           +   GTKD +RQ EA
Sbjct: 1   MAENSFSKFFARNKLAIVATVSAGAAAVGAYVYYHQLKQQQQHHQQQLKGTKDRQRQGEA 60

Query: 58  FAGQN-EDEADLKDDGSVVSGSXXXXXXXXXXXXXXXAKSGEGFDYPSLPNGEPDIAQLK 116
             GQ+ E+E  LK+DGS  + S                KS E  +YP LP+GEPD+ +L+
Sbjct: 61  LPGQDGEEELGLKEDGSAAADSNKKKKKKNRRKKKSKPKSAEDVEYPLLPHGEPDMDRLR 120

Query: 117 GLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGD 176
           GLS  QRQA+AVQLK++GNHFFTAK+F +AIKYYQYAIELDPN+PVFYSNISACYISTGD
Sbjct: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180

Query: 177 LEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 236
           L+KV+E+TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDG SIEPML
Sbjct: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240

Query: 237 ERNLNKQAMKVLNENLSKD-EGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAY 295
           ERNLNKQAMKVLNE+L K+ + + SQ+LPSNTSLASFFGIFD  LE S VNT S  D+A 
Sbjct: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300

Query: 296 ALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFH 355
           A LS+ALQ LYSAT EGYL+A+DLLTK+TD YHSLL AN  D  +RENAALA CY GIF 
Sbjct: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360

Query: 356 FLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTY 415
           FLKN+LLDAQ LLQESINLHPTPNSY+F+ALT+ADKENSQEFFKFFQ A+DL+PEYPPTY
Sbjct: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420

Query: 416 YHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLK 475
           YHRGQMYFILQDY NAK DFQKAQSLNP NVYPYIQLACLLYKQ KF+E+E+ FNE KLK
Sbjct: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480

Query: 476 FPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSS 535
           FP LPEVPTF+AEILTD+GDF+ AIKQYDIAKRLEEVQ+KIHVGIGPLIGKATILARQSS
Sbjct: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540

Query: 536 QDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILAR 595
           QDPTQLDEEKFN AI+LLTKACELDPRSEQAKIGLAQL+LQMEKID AI+LF++SA LAR
Sbjct: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600

Query: 596 TMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           TMDEKLQATTFAEAAKIQKRLRADPIISAKME TLA YRA+GM+
Sbjct: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/538 (56%), Positives = 397/538 (73%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP    GEP +  +  +S  Q+++++  LK++GN FF  K+++ A+KYY YA+ L   +P
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDP 139

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSNISACY+S   L+KV+E +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVL
Sbjct: 140 VFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLNGDF G+SIEPMLERNLNKQAM VL + L +   + +Q+LPS+T+LASFFGIF    E
Sbjct: 200 SLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQ---QKNQLLPSDTALASFFGIFTPETE 256

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
            ++ + +S  D     L   L+ LY  + EGY  A++  +++ D Y  L   N+ D  L+
Sbjct: 257 FANYDETSEADQK---LKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALK 313

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           E  A+AL + GIF FLKN+ L A   +Q++I+LHP  NSYI++AL +ADK  ++E+++FF
Sbjct: 314 EKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFF 373

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            KA+ L+P+    YYHRGQMYFI   Y+ A +DF KA+ LN EN++PYIQLACL Y++ K
Sbjct: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENK 433

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E K KF T PEVP FFAEIL D+GD + A+KQYDIAKRLEE  + IHVGI 
Sbjct: 434 FDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGIS 493

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKAT+LARQ S        E F  A KLL +AC  DPRSEQ K+GLAQLKLQ E ID
Sbjct: 494 PLVGKATLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDID 546

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           +AI+LFE++A LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E TLA Y+A+G++
Sbjct: 547 DAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/538 (56%), Positives = 393/538 (73%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD+      +  Q++ Y+V LK++GN FF  + + +A+KYY YA++L   +P
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDP 132

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSNISACY+S G+LEKV+E +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVL
Sbjct: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLNGDF+ ASIEPMLERNLNKQAM+VL + +S D     Q LPSNT LASFFGIF     
Sbjct: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSD---AKQQLPSNTFLASFFGIFTPETT 249

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
           + + + S+  D     L +AL  LY    E YL+A++  +K+ + Y   L AN  D+ L+
Sbjct: 250 LKNFDESNEADVE---LLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLK 306

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           E  A AL Y GIF FLKN+ L +   +Q SI LHP  N+YI+ AL +ADK  S+ +F FF
Sbjct: 307 EKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFF 366

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            KA+D++P   P YYHRGQM+F+ Q Y+ A  DF+KA+  +  N++PYIQLACL Y +GK
Sbjct: 367 DKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGK 426

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E K KFPT PEVP F+AE+LTD+GDFD A KQYDIAKRLEE  + IHVG+ 
Sbjct: 427 FDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVS 486

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKAT+LARQ    PT    E    +  LL +AC++D RSEQAKIGLAQLKLQ E+ID
Sbjct: 487 PLVGKATLLARQ----PTV---ENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEID 539

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAI LFE+++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA YR +G++
Sbjct: 540 EAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/538 (56%), Positives = 394/538 (73%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEP +  ++ LS   R+ YA  LK+RGN FF  K+++ A+KYY YA+ +   +P
Sbjct: 76  YPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVK-KDP 134

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSNISACY+S G L+KV+E +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVL
Sbjct: 135 VFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVL 194

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLNGDF+G+SIEPMLERNLNKQAM VL + L  +    SQ LPSNT+LASFFGIF     
Sbjct: 195 SLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNN---VSQQLPSNTALASFFGIFPPETT 251

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
            ++ N +   D     L + L+ LY  + EGY +A++   KS   + + LS    D  L+
Sbjct: 252 FANYNENDEADVG---LKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLK 308

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           E  A+AL + GIF FLKN+ L+A   ++++I LHP  NSYI++AL +ADK  ++E++++F
Sbjct: 309 EKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYF 368

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            KA+ L+P Y P YYHRGQMY+I   Y+ A +DF KA+  +  N++PYIQLACL Y++ K
Sbjct: 369 DKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDK 428

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E K KFPT PEVP F+AEIL D+GD + A+KQY+IAKRLEE  + IHVG+ 
Sbjct: 429 FDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGVA 488

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKAT+LARQ S        E F  A  LL +AC  DP SEQAK+GLAQLKLQ E++D
Sbjct: 489 PLVGKATLLARQPSV-------ENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVD 541

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAI LFE++A LART+DEKLQATTFAEAAK+QKR++ADP++SAK+E TLA YRA+GM+
Sbjct: 542 EAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/540 (56%), Positives = 400/540 (74%), Gaps = 13/540 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP+  + +PD+ Q+  L   +++  ++QLK++GN +F AK++  AIKYY  A++L+  +P
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDP 155

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           +FYSNISACY+S G L+KVIE +TKALE+ P++SKALLRRASANESL N++DA+FDLSVL
Sbjct: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEG--RGSQVLPSNTSLASFFGIFDSH 279
           SLNGD+ GASIEP+LERNLNKQA+KVLNE ++K  G  +  Q+LPS TSL SFFGIFD  
Sbjct: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275

Query: 280 LEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDP 339
           L   + N +   D A   L   L  L+  TD+GYL A+    K++ ++   L+ N  D  
Sbjct: 276 LTFQNYNEN---DQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKH 332

Query: 340 LRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFK 399
           L E  A+AL Y GIF FLKN+LL AQ  ++++I   P  NSY++LAL  ADK  SQE+ K
Sbjct: 333 LLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392

Query: 400 FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQ 459
           +F KA++LNP+    YYHRGQ+YFI QDY  AK +F+KA+ L+  N++PYIQLACL Y++
Sbjct: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452

Query: 460 GKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVG 519
             F   +  F+ET+ KFPT PEVPTF+AEIL D+GDF  AIKQYDIA RLE+ Q+ IHVG
Sbjct: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVG 512

Query: 520 IGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEK 579
           I PL+GKAT+LARQ    P  L+      A +L+ KACE+DPRSEQA +GLAQLKLQ E+
Sbjct: 513 IAPLVGKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565

Query: 580 IDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           +D AIELFE +A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK++  LA YR++G++
Sbjct: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/538 (55%), Positives = 396/538 (73%), Gaps = 19/538 (3%)

Query: 109 EPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNIS 168
           +PD+A +   S  Q++ YA  LK++GN  F  K F +AI++Y +AI+L   +PVF+SNIS
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133

Query: 169 ACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 228
           ACY+S GDL+KV+E +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193

Query: 229 GASIEPMLERNLNKQAMKVLNENLSKD-------EGRGSQVLPSNTSLASFFGIFDSHLE 281
           G+SIEPMLERNLNKQA++VL E++  D       + R  Q LPSNTSL+SFFGIF    E
Sbjct: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
           + + + S+  D     L   L+ LY AT +GY +A++   K+  +Y   L AN  D   +
Sbjct: 254 IPAYDESNEADVT---LVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFK 309

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           E AA AL Y GIF FLKN+L +++  L+E++ LHP  N+YI+LALT+AD+  S+++F +F
Sbjct: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
           +KA+ L+P     YYHRGQMYFI Q+Y+ A EDF+K++  +P+N++PYIQLACL Y++ K
Sbjct: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
             E E  F E +  FPT PEVP F+AEIL D+GD D A+KQY+IA RLE +Q++IHVGI 
Sbjct: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKATILARQ    PT    E F    +LL  AC+ DPRSEQAK+GLAQL+LQ EK+D
Sbjct: 490 PLVGKATILARQ----PTP---ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVD 542

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAIELFE++A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E TLA Y+A+ M 
Sbjct: 543 EAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/538 (56%), Positives = 387/538 (71%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEP +  +  L+  Q++ YA+ LK++GN FF  K F++AIKYY  A+EL   +P
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALEL-KKDP 135

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN SACY+S G LEKV+E TT AL++K D+SK LLRRASANESLGN+ DAMFDLS L
Sbjct: 136 VFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSAL 195

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SL GDF+GASIEPMLERN+NKQAM VL E L   E +    LPSNTSLASFFGIF+    
Sbjct: 196 SLYGDFNGASIEPMLERNMNKQAMLVLKEKL---EEKKDHRLPSNTSLASFFGIFEPETS 252

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
             + + S   D    LL   L  LY  T EGY  A++  TK+   Y +LL  +  ++ L+
Sbjct: 253 FENYDESVEADR---LLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILK 309

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           + AA+AL + GIF FLKN+ L A   L++++  HP  NSYI+LAL +ADK  + E+F+ F
Sbjct: 310 QKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENF 369

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            KA++L+P     YYHRGQMYFI Q Y+NA +DF KA+  N  N++PYIQLACL Y++ K
Sbjct: 370 DKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENK 429

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E + KFPT PEVP F+AEIL+D+GD   A KQY+IA++LE+  + IHVGI 
Sbjct: 430 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIA 489

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKAT+LAR+    PT    E F  A +   +ACE DPRSEQAKIGLAQLKLQ E++D
Sbjct: 490 PLVGKATLLARE----PTV---ENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVD 542

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAI LFE++A LAR+ DEKLQATTFAEA KIQK++RADPIISAK+E TLA YRA+GM+
Sbjct: 543 EAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/542 (55%), Positives = 388/542 (71%), Gaps = 14/542 (2%)

Query: 98  EGFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELD 157
           +G  +P    GEPD+ ++  LS  ++  +A+ LK++GN FF  K F +A+KYY  AIE+ 
Sbjct: 67  QGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV- 125

Query: 158 PNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFD 217
             +PVFYSN SACY+S G  EKV+E TT AL++KPD+SK LLRRASANESLG F DAMFD
Sbjct: 126 KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFD 185

Query: 218 LSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFD 277
           LS +SL GDF+G+SIEP+LERN+NKQAM VL E L K +      LPSNTSLASFFGIF 
Sbjct: 186 LSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQ---EYKLPSNTSLASFFGIFQ 242

Query: 278 SHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVD 337
              E S  N   N +   ALL D L  LY  T  GY  A+   +K+ D Y +LL  N+ D
Sbjct: 243 P--ETSFENYDENSEADKALL-DGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSED 299

Query: 338 DPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEF 397
             L++ AA+AL + GIF FLKN+ + A   L++++   P PN+YI++AL +ADK  + E+
Sbjct: 300 ASLKQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEY 359

Query: 398 FKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLY 457
           F  F+KA++L+P     YYHRGQM+FI Q ++ A +DF+KA+ LN  N++PYIQLACL Y
Sbjct: 360 FDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTY 419

Query: 458 KQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIH 517
           ++GKF++SE  F+E + KFPT PEVP F+AE L+D+GD   A K+YDIA +LE   + IH
Sbjct: 420 REGKFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIH 479

Query: 518 VGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQM 577
           VG+ PLIGKAT+L+R+ S        E F  A +L  +ACE DPRSEQAKIGLAQLKLQ 
Sbjct: 480 VGVSPLIGKATLLSREPSV-------ENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQ 532

Query: 578 EKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKG 637
           E IDEAI LFE++A LAR+ DEKLQATTFAEA KIQK++RADPI+SAK+E TLA YRA+G
Sbjct: 533 EDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQG 592

Query: 638 ML 639
           M+
Sbjct: 593 MI 594

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/541 (55%), Positives = 383/541 (70%), Gaps = 14/541 (2%)

Query: 99  GFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP 158
           G  YP    GEPD++ L  LS  Q+  YA+ LK++GN FF  K ++EAI+YY +AIE+  
Sbjct: 67  GPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVK- 125

Query: 159 NEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
            +PVFYSN SACY+S G  EKV+E TT AL++KPD+SK LLRRASANESLGNF DAMFDL
Sbjct: 126 EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDL 185

Query: 219 SVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDS 278
           S +SL GDF GASIEP+LERN+NKQ+M VL E L K +      LPSNTSLASFFGIF  
Sbjct: 186 SAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQ---EYKLPSNTSLASFFGIFQP 242

Query: 279 HLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDD 338
                + + +S  D     L + L  LY  T +GY  A+    K+ D +  LL  N  D 
Sbjct: 243 ETTFENYDDNSEADK---YLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDA 299

Query: 339 PLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFF 398
            L+  AA+AL + GIF FLKN+ + A   L++++   P PN+YI++AL +ADK  + E+F
Sbjct: 300 DLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYF 359

Query: 399 KFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYK 458
             F+KA+ L+P     YYHRGQMYFI Q ++ A +DF+KA+ L+  N++PYIQLACL Y+
Sbjct: 360 DNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYR 419

Query: 459 QGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHV 518
           +GKF +SE  F+E + KFPT PEVP F+AE L+D+GD   A KQYDIA +LE+  + IHV
Sbjct: 420 EGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHV 479

Query: 519 GIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQME 578
           G+ PLIGKAT+L+R+ S        E F  A +L  KAC+ DPRSEQAKIGLAQLKLQ E
Sbjct: 480 GVSPLIGKATLLSREPSV-------ENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQE 532

Query: 579 KIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGM 638
            IDEAI LFE++A LAR+ DEKLQATTFAEA KIQK++RADP++SAK+E TLA YRA+GM
Sbjct: 533 DIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGM 592

Query: 639 L 639
           +
Sbjct: 593 I 593

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/558 (53%), Positives = 389/558 (69%), Gaps = 34/558 (6%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD ++    +  ++  YA+ LK++GN +F  K +++AIKYY +A+EL   +P
Sbjct: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN+SACY+S GDL+KV+E +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLS-----------------KDEGRGSQVLP 264
           SLNGDF+ ASIEPMLERNLNKQAM  L E                    K+     + LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLP 252

Query: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYD---TAYALLSDALQRLYSATDEGYLVANDLLT 321
           S TS+ASFFGIF   L      T +NYD    A   L D L  LY  + E Y  A++  T
Sbjct: 253 SITSMASFFGIFKPEL------TFANYDEFNKADKELMDGLANLYKRSPESYDRADESFT 306

Query: 322 KSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSY 381
           K+  ++   L  +  D+ L+E  A++L +TGIF FLKN+ L A   ++++I L P  NSY
Sbjct: 307 KAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSY 366

Query: 382 IFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSL 441
           I++AL +AD+ +S E++ +F KA+ LNP     YYHRGQM FILQ+Y  A +DF KA+ L
Sbjct: 367 IYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKEL 426

Query: 442 NPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIK 501
           +PEN++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DFD A+K
Sbjct: 427 DPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALK 486

Query: 502 QYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDP 561
           QYD+A  LE   ++I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDP
Sbjct: 487 QYDLAIELENKLDRIYVGIAPLVGKATLLTR----NPTV---ENFVEATNLLEKASKLDP 539

Query: 562 RSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPI 621
           RSEQAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+Q+++R+DPI
Sbjct: 540 RSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPI 599

Query: 622 ISAKMELTLARYRAKGML 639
           ++AK++ TLA+ R +G++
Sbjct: 600 LAAKIQETLAKLREQGLM 617

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/545 (54%), Positives = 378/545 (69%), Gaps = 18/545 (3%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   +GEPD++QL   +P QR+ YA+ LK++GN  F  K   EAIKYYQ+A+E    +P
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDP 139

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFY+NISACY+S  D EKV+E   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVL
Sbjct: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLN DF GASIEPMLERNLNKQAMK+L E L   + +  Q LPS+TS+ASFFGIF    E
Sbjct: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETE 259

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
               + +   D     L   L  L++AT  G++ A+    ++ + Y  L S  + ++ L 
Sbjct: 260 FKGYDETCEADRT---LQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLA 316

Query: 342 ENA----ALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEF 397
           +N     A+AL Y+GIF FLKN+++ AQ  + E+I L P  NSYI+LALT AD   S E+
Sbjct: 317 QNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEY 376

Query: 398 FKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLY 457
              F KA++LNP    TYYHRGQ+YFI QDY+ AK DF KA+ L+ +N++ YIQLACL Y
Sbjct: 377 VTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCY 436

Query: 458 KQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEE---VQE 514
           ++G   E +  F+E + KFP  PEVPTF+AEIL D+GDF  A KQYD+AKRLEE    + 
Sbjct: 437 REGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKT 496

Query: 515 KIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLK 574
            I VG+ PL+GKAT+LARQ S        E F  A  L  +AC+ DPRSEQAK+GLAQL 
Sbjct: 497 GIRVGVAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQLL 549

Query: 575 LQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYR 634
           LQ E +D AI++FE++A LART DEKLQA TFAEAAK+QK++RADPII AK+E  LA YR
Sbjct: 550 LQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYR 609

Query: 635 AKGML 639
           A+GM+
Sbjct: 610 AQGMI 614

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/555 (52%), Positives = 385/555 (69%), Gaps = 28/555 (5%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD +     +  ++  YA+ LK++GN FF  K +++AIKYY +A+EL   +P
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN+SACY+S GDL+KV+E +TKALE+KPD+SK LLRRASANE LG F DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVL 192

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENL-----------------SKDEGRGSQVLP 264
           SLNGDF+ ASIEPMLERNLNKQAM  L E                   +K+     + LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLP 252

Query: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKST 324
           S TS+ASFFGIF   L  ++ + S+  D     L + L  LY  + E Y  A++  TK+ 
Sbjct: 253 SVTSMASFFGIFKPELTFANYDESNEADKE---LMNGLSNLYKRSPESYDKADESFTKAA 309

Query: 325 DMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFL 384
            ++   L  N  D+ L+E  A++L +TGIF FLKN+ L A   ++++I L P  NSYI++
Sbjct: 310 RLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYM 369

Query: 385 ALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPE 444
           AL +AD+ +S E++ +F KA+ L+      YYHRGQM FILQ+Y  A +DF KA+ L+PE
Sbjct: 370 ALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429

Query: 445 NVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYD 504
           N++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DFD A+KQYD
Sbjct: 430 NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYD 489

Query: 505 IAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSE 564
           +A  LE   + I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSE
Sbjct: 490 LAIELENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRSE 542

Query: 565 QAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISA 624
           QAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++ 
Sbjct: 543 QAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAK 602

Query: 625 KMELTLARYRAKGML 639
           K++ TLA+ R +G++
Sbjct: 603 KIQETLAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/555 (52%), Positives = 386/555 (69%), Gaps = 28/555 (5%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD ++    +  ++  YA+ LK++GN +F  K +++AIKYY +A+EL   +P
Sbjct: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN+SACY+S GDL+KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLS-----------------KDEGRGSQVLP 264
           SLNGDF+ ASIEPMLERNLNKQAM  L E                    K+     + LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLP 252

Query: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKST 324
           S TS+ASFFGIF   L  ++ + S+  D     L + L  LY  + + Y  A++  TK+ 
Sbjct: 253 SVTSMASFFGIFKPELTFANCDESNEADKE---LMNGLANLYKRSPDSYDRADESFTKAV 309

Query: 325 DMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFL 384
            ++   L  +  D+ ++E  A++L +TGIF FLKN+ L A   + ++I+L P  NSYI++
Sbjct: 310 KLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYM 369

Query: 385 ALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPE 444
           AL +AD+ +S E++ +F KA+ L+      YYHRGQM FILQ+Y  A +DF KA+ L+PE
Sbjct: 370 ALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429

Query: 445 NVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYD 504
           N++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DFD A+KQYD
Sbjct: 430 NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYD 489

Query: 505 IAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSE 564
           +A  LE   E I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSE
Sbjct: 490 LAIELENKLEGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRSE 542

Query: 565 QAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISA 624
           QAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++ 
Sbjct: 543 QAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAT 602

Query: 625 KMELTLARYRAKGML 639
           K++ TLA+ R +G++
Sbjct: 603 KIQETLAKLREQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/555 (52%), Positives = 387/555 (69%), Gaps = 28/555 (5%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NG+PD +     +  ++  YA+ LK++GN FF  K +++AIKYY +A+EL  ++P
Sbjct: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDP 132

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN+SACY+S GDL+KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLS-----------------KDEGRGSQVLP 264
           SLNGDF+ ASIEPMLERNLNKQAM  L E                    K+    ++ LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLP 252

Query: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKST 324
           S TS+ASFFGIF   L  ++ + S+  D     L + L  LY  + E Y  A++  TK+ 
Sbjct: 253 SITSMASFFGIFKPELTFANYDESNEADKD---LMNGLTNLYKRSPESYDKADESFTKAV 309

Query: 325 DMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFL 384
            ++   L  N  D+  +E  A++L +TGIF FLKN+ L A   ++++I L P  NSYI++
Sbjct: 310 KLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYM 369

Query: 385 ALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPE 444
           AL +AD+ +S E++ +F KA+ L+      YYHRGQM FILQ+Y  A +DF KA+ L+PE
Sbjct: 370 ALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429

Query: 445 NVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYD 504
           N++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DF+ A+KQYD
Sbjct: 430 NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYD 489

Query: 505 IAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSE 564
           +A  LE   + I+VGI PL+GKAT+L R    +PT    E F  A  LL +A +LDPRSE
Sbjct: 490 LAIELENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEEASKLDPRSE 542

Query: 565 QAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISA 624
           QAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+QKR+R+DPI++A
Sbjct: 543 QAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAA 602

Query: 625 KMELTLARYRAKGML 639
           K++ TLA+ R +G++
Sbjct: 603 KIQETLAKLREQGLM 617

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/538 (53%), Positives = 378/538 (70%), Gaps = 12/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           +P+  NGEPD   +  L+  Q+  +A++LK++GN +F  K++  A+K+Y +A+ L   +P
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDP 141

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN+SACY+S  +L+KVIE +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSVL
Sbjct: 142 VFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLN DF+GA+IEPMLERNLNKQA+KVL++  SK+  +    LPSNTS+ASFF IF   + 
Sbjct: 202 SLNNDFNGATIEPMLERNLNKQAIKVLDQK-SKNPSKNESELPSNTSMASFFSIFTPEIS 260

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
             S +  S+ D     L + L+ LYSA    Y +A     KS ++Y  LL +    + + 
Sbjct: 261 FDSYDEESDADKE---LLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETIS 317

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           +  A+AL Y GIF+FL+N+L+ AQ L  +SI+  P  NSYI+LAL  ADK    E  K+F
Sbjct: 318 KKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYF 377

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            +A+ L+P   P YYHRGQ+ F+ QDY NAK DF KA+ L+  N++PYIQLACL Y++G 
Sbjct: 378 DEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGD 437

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + +  F   + KFP  PE+PTF  EIL D+GD D A KQY+   RLE  Q+ IHVGI 
Sbjct: 438 FEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIA 497

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PLIGKAT LARQ    PT    E F+ A KLL  A E DPRSEQA +GLAQLKLQ E +D
Sbjct: 498 PLIGKATALARQ----PTP---ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVD 550

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
            AIELFE ++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E TLA+Y A+G +
Sbjct: 551 TAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/538 (52%), Positives = 379/538 (70%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD++ +   +  Q++ Y++ +K++GN  F  K + EAIKYY  A+ L   +P
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLK-KDP 131

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN SAC++    LEKV+E TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +
Sbjct: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SL G ++  SIEP+LERN+NKQAM+VL   L+  +G   Q LPSNTSLASFFGIF S   
Sbjct: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLA--DGSKHQ-LPSNTSLASFFGIFPSETS 248

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
            ++ +  S  D     L   L+ L       Y ++++   K+ D+      A++ D  LR
Sbjct: 249 FANYDEQSEADN---FLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALR 305

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
              A+AL + GIF FLKN  L+A  LLQ++++LHP PNSYI++AL +ADK  + E+ ++F
Sbjct: 306 MKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYF 365

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            KA++L P     YYHRGQMYF+ Q ++ + +DF KA+  NP+N++PYIQLACL Y++ K
Sbjct: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E + KFPT PEVP F+AEIL+D+GD ++A+K+Y+ A++LE+ QE IHVG+ 
Sbjct: 426 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVA 485

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKAT+LARQS           F  A  L  +AC+ DPRSEQAKIGLAQLKLQ E++D
Sbjct: 486 PLVGKATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVD 538

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAI+LFE++  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK++ TL  YR +G++
Sbjct: 539 EAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/538 (54%), Positives = 390/538 (72%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD++     S   ++ YA+ LK++GN +F  ++F  A+KYY YA+ L   +P
Sbjct: 80  YPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL-KQDP 138

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSNISACY+S G LEKV+E +T+AL++K D+SKALLRRASA ESL N+ DAM DLSVL
Sbjct: 139 VFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVL 198

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLNGDF+GASIEPMLERNLNKQAM+VL E +++++    Q+LPSNTSLASFFG+F    E
Sbjct: 199 SLNGDFNGASIEPMLERNLNKQAMQVLKEKIAENK---PQLLPSNTSLASFFGVFKP--E 253

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
           VS  N + N ++   LL + L  LYS T++GYLVA++   K+  +       N  ++ ++
Sbjct: 254 VSLNNFNENSESEKELL-NGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIK 312

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           E  A+AL Y GI  FLKN+ LDA   +Q++I + P  NSYI+ +L LADK  ++E  K F
Sbjct: 313 EKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNF 372

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
             A++L+     TYYHRGQ+YF+ Q Y+ A  DF KA+ L+  N+ PYIQLACL YK+ K
Sbjct: 373 DAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENK 432

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E + KFPT PEVP F+A++L +R +FD A+KQYDI+K+LEE  E IHVGI 
Sbjct: 433 FNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIA 492

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           P+IGKAT+LAR    +P     E    + +L  +AC+LDPRSEQAKIGLAQLKLQ E++D
Sbjct: 493 PMIGKATLLAR----NPIV---ENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVD 545

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAI LFE++A LAR MDEKLQATTFAEA+K+QK++R+DP+I+ K++ TLA Y+ +G++
Sbjct: 546 EAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/539 (53%), Positives = 381/539 (70%), Gaps = 19/539 (3%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEP++      +  +++ Y++ LK++GN  F A  F EAIKYY +AIEL  N P
Sbjct: 86  YPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN-P 144

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           +FYSN+SACY+S   LE++I++  KALE+KPD+SK LLRRA+ANE L N+ DAMFDLSVL
Sbjct: 145 IFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVL 204

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENL--SKDEGRGSQVLPSNTSLASFFGIFDSH 279
           SLNGD++GASIEP+LERNLNKQAM VL + L  SKD+      LPS+TSL++FFGIF   
Sbjct: 205 SLNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKDDQ-----LPSDTSLSAFFGIFKPE 259

Query: 280 LEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDP 339
           L   + + +++ D     L + L  L+    E YL+A+     + ++Y   L     D  
Sbjct: 260 LSFENYDETNDADKE---LLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTD 316

Query: 340 LRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFK 399
           L+  A++A  Y GIF+FLKN+L  A   + +SI L+P  NSYI+ AL +ADK  SQ++  
Sbjct: 317 LKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLD 376

Query: 400 FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQ 459
           +F KA+ L+ +    YYHR Q+ F+ QD+  A  DF+KA+  +P N++PYIQLACL Y++
Sbjct: 377 YFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRE 436

Query: 460 GKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEV-QEKIHV 518
            KF + E  F+E K KFPTLPEVP F+AE+LTD+GDFD A+K Y+ A+RLEE  ++ IHV
Sbjct: 437 NKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHV 496

Query: 519 GIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQME 578
           G+ PLIGKAT+LAR+    PT    E   AA KLL +A  +DPRSEQAKIGLAQLKLQ E
Sbjct: 497 GVAPLIGKATLLARE----PTL---ENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKE 549

Query: 579 KIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKG 637
           +IDE+I LFE+SA LARTM+EKLQATTFAEAAK+QK +RADPIIS K+E TLA YRA+ 
Sbjct: 550 EIDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/538 (51%), Positives = 376/538 (69%), Gaps = 14/538 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEPD++ +   +  Q++ YA+ LK++GN  F  + + EAIK+Y  A++L   +P
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDP 128

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN SACY+    LEKV+E TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +
Sbjct: 129 VFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SL G +   +IEP+LERN+NKQAM+VL + LS   G     LPSNTSLASFF IF S   
Sbjct: 189 SLYGGYSSQTIEPVLERNMNKQAMQVLKQKLS---GGEKHELPSNTSLASFFRIFPSETS 245

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
           + + + +S  D    +L   L  L++     Y +A++  T + + + +   AN  +  L+
Sbjct: 246 LENYDETSEADR---ILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALK 302

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           +  A+AL + GI  FLKN  L+A  LLQ++I+L P PNSYI++ L +ADK  + E+ + F
Sbjct: 303 QKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNF 362

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
           +KA++L+P+    YYHR QM F++Q +  A +DF KA+  +P  VYPYIQLACL Y++ K
Sbjct: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKK 422

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E + +FPT PEVP F+AEIL+D+GDF+ A+K+YD A++LE+ QE IHVG+ 
Sbjct: 423 FDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVA 482

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKA +LARQ S          F  A KL   ACE DPRSEQAKIGLAQLKLQ E++D
Sbjct: 483 PLVGKAALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVD 535

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639
           EAI+LFE +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK++ TL  YRA+GM+
Sbjct: 536 EAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/537 (50%), Positives = 377/537 (70%), Gaps = 12/537 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NG+PD+++    +P Q   YA+ LK++GN FF AK+F +AI+YY  AI L   +P
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDP 137

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           VFYSN SA Y+S  + EKV+E TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS +
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SL G++ G S+E +LERN+NKQA KVL E L +++G+ S  LPSNTSLASFFGIF+    
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESP-LPSNTSLASFFGIFNPETS 256

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
               +  +  D     L   L+ LY      Y +A++  TK+ ++Y   L ++  ++ L+
Sbjct: 257 FDDYDGENEADVE---LKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLK 313

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           + AA+A  + GIF F KN+ + A + L+ES++L+P P++YI++AL +ADK  + ++ ++F
Sbjct: 314 KKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYF 373

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            KA++L+P     YYHRGQM+F+++++K A  DF KA+ LNPEN++ YIQ ACL ++  +
Sbjct: 374 DKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDR 433

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E + KFPT PEVP F+AEIL  +   D AIKQYDIA +LE+    IHVGI 
Sbjct: 434 FDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIA 493

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           P+IGKAT L R    +PT    E F  A +L  +AC++DPRSEQAKIGLAQLKLQ E+ID
Sbjct: 494 PMIGKATALIR----NPTV---ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEID 546

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGM 638
           +AI+LFED+A L+R+ DEKLQATTFAEA K+QK++RADP I  K++  +A YRA+G+
Sbjct: 547 DAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/534 (52%), Positives = 366/534 (68%), Gaps = 13/534 (2%)

Query: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           YP   NGEP +  +  L+   ++ +A  LK +GN  F  K+F  AIKYY +A+ L   +P
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSL-KEDP 128

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           V+YSNISACY S  + EKVIE  TKAL ++PD+SK L+RRA+A E LGNF DAMFDLSV 
Sbjct: 129 VYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVC 188

Query: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281
           SLN D   ASIEP+LERNLN+QAM VLN  L   + +    LPSNT+L SFFGIF   L 
Sbjct: 189 SLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQ--LPSNTALTSFFGIFKPELS 246

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
            ++ + +   D     L + L+ LY  T EGY  A+   TK+T+ +   LS    D+ ++
Sbjct: 247 FANYDDTCEGDKE---LLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVK 303

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401
           E  A+AL + GIF FLKNN L+A   +++++ LHP  NSYI++AL LADK ++  +F  +
Sbjct: 304 EKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANY 363

Query: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
           +KA+ L+ +    YYHRGQMYFI Q Y+ A EDF KA+ L+PEN++PYIQLACL Y++ K
Sbjct: 364 EKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENK 423

Query: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F + E  F+E + KFP   EVP F+AEIL D+GDFD A+K+Y+ A  LE+ Q+ +HVGI 
Sbjct: 424 FDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIA 483

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
           PL+GKAT+L R     PT    E F  A  LL +A + DPRSEQAKI L QLKLQ E ID
Sbjct: 484 PLVGKATLLVRT----PTV---ENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDID 536

Query: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRA 635
           EAIELFE +A LART +EKLQATTFAEAAKIQKR+RADP +SAK++ T+A  RA
Sbjct: 537 EAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  506 bits (1302), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 260/531 (48%), Positives = 356/531 (67%), Gaps = 13/531 (2%)

Query: 107 NGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN 166
           N EPDI  +K    +++  YA +LK RGN +F  K++  AI YY++A++L  N+PVFYSN
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSN 124

Query: 167 ISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 226
           ++ACYIS    ++ IE  +KALE+ PD+SK LL+RA+  E++G F DA+ DL+ +SLNGD
Sbjct: 125 MAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGD 184

Query: 227 FDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVN 286
           ++ A+I+P++ER LNKQAM  L ++L   E   ++VLPS TS+A+FFG+FD+  ++   +
Sbjct: 185 YNDATIQPIVERVLNKQAMMALKDHLEASEK--NKVLPSYTSMAAFFGVFDAETDIPGHD 242

Query: 287 TSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAAL 346
            +   D    +LSDAL  LYS T EGY   +   TK+T++Y + L  +  +    E AA+
Sbjct: 243 ATEESDK---ILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAI 299

Query: 347 ALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVD 406
           A  +T I  FLKN+ L A+ L+ E+I LHP P SYI+L L +ADK   +E++  FQKA+D
Sbjct: 300 AFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAID 359

Query: 407 LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESE 466
           L+P     YYHRGQM FI+Q Y+ A EDF KA+  +P N++PYIQLAC+ Y++G F + E
Sbjct: 360 LDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCE 419

Query: 467 AFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 526
             F+E + KFP  PEVP FFAEIL+D+G+ + A  +YD A  LE   E IHVGI PL+GK
Sbjct: 420 TLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGK 479

Query: 527 ATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIEL 586
           AT L +     PT    E F  A  L  +A   DPRSE+AK+GLAQ KLQ E +D+AI L
Sbjct: 480 ATTLLKY----PTV---ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRL 532

Query: 587 FEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKG 637
           FE++AIL RT+DEKLQATTFAEA K+Q R+RAD  + AK    L   R  G
Sbjct: 533 FEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/531 (48%), Positives = 362/531 (68%), Gaps = 15/531 (2%)

Query: 107 NGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN 166
           NGEP+++ +  L+   +  +A+ LK++GN  F    F +AIKYY YA++L  ++P++YSN
Sbjct: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSN 148

Query: 167 ISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 226
           ISACY S    EKVIE+ TKAL+++P  SK L+RRA A E++GNF DAMFD+S  SLNGD
Sbjct: 149 ISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGD 208

Query: 227 FDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVN 286
            + ASIEP+LER LNKQA  VL E +S ++    Q LPS+T LASFF +F      ++  
Sbjct: 209 MNDASIEPILERILNKQAEFVLKEKISANK---EQNLPSSTPLASFFRVFKPETSFANYE 265

Query: 287 TSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAAL 346
            S+  D     L + L  LY  ++EG+ +A+    K+ +++   LS N  ++ ++E  A+
Sbjct: 266 ESNEADRE---LMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322

Query: 347 ALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVD 406
           AL Y+GI +++KN  L A   ++ +I LHP  NSYI+ +L  +D   + E+ + F KA++
Sbjct: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382

Query: 407 LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESE 466
           L P  P  YYHRGQ YFI Q Y+ A +DF K + L+  N++ YIQLACL Y++ KF + E
Sbjct: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442

Query: 467 AFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLE-EVQEKIHVGIGPLIG 525
             F+E + KFPT PEVP FFAE+L DRG+ + A+K++D A  LE +  E+IHVGI PLIG
Sbjct: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502

Query: 526 KATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIE 585
           KAT+L  +    PT    E F   I+LL +AC+ DPRSEQA++GLAQLKLQ E IDEAI+
Sbjct: 503 KATLLISK----PTV---ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQ 555

Query: 586 LFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAK 636
           LFE++A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+  T+ + R++
Sbjct: 556 LFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  502 bits (1293), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 274/547 (50%), Positives = 373/547 (68%), Gaps = 21/547 (3%)

Query: 102 YPSLPNGEPDIAQLKGL---SPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP 158
           YP     +PD  ++  L   + + +  +A +LKN+GN +F +K+   AIKYY+YA+ LD 
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLD- 188

Query: 159 NEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
            +PVFYSNISACY +   L+KVIE + KALE+KPD+SKALLRRA+A E+LGN  +A++D 
Sbjct: 189 QDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF 248

Query: 219 SVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDS 278
           S+LSL G++ G  +EP+L R L+K +  VL   L  ++   + +L S+++L SFFGIF  
Sbjct: 249 SILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLD-NKKTDNFILLSDSALVSFFGIFPP 307

Query: 279 HLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMY-HSLLSA--NT 335
              +++ N     D A   L   L+ L   T EG+L A+    K+ +++   LLS+  N 
Sbjct: 308 ETTITNYNPD---DEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDND 364

Query: 336 VDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQ 395
            +  L E  A+AL Y+G+F FLK +LL ++  LQ++I+L+P PNSYI++A+ +ADK N +
Sbjct: 365 ENSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDK 424

Query: 396 ---EFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
              ++FK+F KA  LNP + PTYYHRGQ+  + Q +  A+  F KA+ L+  NVYPYIQL
Sbjct: 425 NDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQL 484

Query: 453 ACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEV 512
           AC+ Y    F + +  F+E + KFPTLPEVPTF+AEIL D+G+ + A+KQYDIA RLE  
Sbjct: 485 ACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETA 544

Query: 513 QEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQ 572
            + IHVGI PLIGKA  LAR     PTQ   E F+   +LL KACELDPRSEQAKI LAQ
Sbjct: 545 YKYIHVGIAPLIGKAAALARI----PTQ---ENFDTMTELLEKACELDPRSEQAKISLAQ 597

Query: 573 LKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLAR 632
           LKLQ E ID AI LFE++A LART  +KLQATTFAEAAKIQKR++ +PI +AK+E TLA 
Sbjct: 598 LKLQTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLAT 657

Query: 633 YRAKGML 639
           YRA G++
Sbjct: 658 YRADGII 664

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 61/129 (47%), Gaps = 2/129 (1%)

Query: 99  GFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP 158
           G   P+L + EP        +P   +  A  LK  GN  F AK+F  A+K Y  AIEL P
Sbjct: 69  GASEPTLSSSEPTGNNTDAHAPEVAE-RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMP 127

Query: 159 NEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
           N  VFY N +A Y S    E+ +     A+ I P +S+   R   A  +LG   +AM   
Sbjct: 128 NNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAY 187

Query: 219 -SVLSLNGD 226
             VL + GD
Sbjct: 188 KKVLDIEGD 196

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 125 AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A AV+ KN GN F   +N+++AI+ Y  AIELDPN+ +FYSN +   +   + +      
Sbjct: 10  AKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
            +AL +   + KA  RR  AN  L  F  A  DL+V+
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%)

Query: 157 DPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMF 216
           D  + V + N    +I   +  K IE  TKA+E+ P+ S     RA A   L NF  A  
Sbjct: 8   DIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYN 67

Query: 217 DLS 219
           D +
Sbjct: 68  DCN 70

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A+ LKN GN +   K + +A++YY  AIELD  + +F+SN +   +   + +  ++    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           ALE+ P + KA  RR  +   L +F  A  DLS++
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 72/152 (47%), Gaps = 9/152 (5%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A++ KN+GN F   KNF++A + Y  AIELD  + +++SN +  ++   + +  +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMK 246
           A+E+ P + KA  RR  +   L  F  A  DL ++           EP+  R L+     
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-----LRAKPNEPVATRALDVCERV 126

Query: 247 VLNENLSKDEGRGSQVLPSNT----SLASFFG 274
           +  E   K    GS  +  N     +L+SF G
Sbjct: 127 IRKEKFEKAISGGSDAVTVNVCEKLNLSSFEG 158

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAI--ELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A +LK +GN  F +K+F  AI+Y+  AI     PN  V YSN SACY S    ++ +   
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNH-VLYSNRSACYTSLKQFQEALNDA 62

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I PD SK   R  +A+  LG+  DA
Sbjct: 63  QQCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I+  P +   YSN +A         + I+   KA+E  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 194 HSKALLRRASANESLGNFTDAMFDL 218
             +A LR+A+A  ++ +F  A+  L
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETL 481

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 11/122 (9%)

Query: 108 GEPDIA--QLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYS 165
           GEP +A  +LK      ++A A++L+  GN    AK++  AI+ Y  AIE+ P + V+Y+
Sbjct: 77  GEPKVAAEELK------KEAEALKLE--GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYA 128

Query: 166 NISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLN 224
           N +A Y S    EK +E   KA ++   +SK   R   A  +LG   +A+     VL + 
Sbjct: 129 NRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188

Query: 225 GD 226
           GD
Sbjct: 189 GD 190

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A++ KN+GN F   K + EA++YY  AIELD  + +F+SN +   +   +    +E   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           ++E+ P + KA+ RR  +   L  F+ A  DL  +
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK+F +AI+ +  AIE+   PN  V YSN SACY ST    K +E  
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNH-VLYSNRSACYTSTKQFNKALEDA 61

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           K  GN F+ A+ F+EAI++Y  A EL   +  + +N +A     G+ E  I+  T+A+E
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           +G  +FT  ++  A+K Y   I+  P +   YSN +A         + I+    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 193 DHSKALLRRASANESLGNFTDAMFDL 218
           +  +A +R+A+A  ++  F   +  L
Sbjct: 459 NFIRAYIRKATAQIAVREFVSVIETL 484

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%)

Query: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEI 190
           NR   + + K FN+A++  +  + ++P     Y+ + A +   GDL++  +   KALE+
Sbjct: 43  NRSACYTSTKQFNKALEDAKQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALEL 101

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K++GN  F AKN++EAI+ +  AIE+   PN  V YSN SACY S     K +E  
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNH-VLYSNRSACYTSKKQFVKGLEDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I  DP++   YSN +A         + I     A+E  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 194 HSKALLRRASANESLGNFTDAMFDL 218
             +A +R+A+A  ++ +F  A+  L
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETL 480

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           K  GN  + A  F+EAI++Y  A EL  N+  + +N SA     GD +  IE   +A+E
Sbjct: 259 KAEGNKLYKAHKFDEAIEHYNKAWELH-NDITYLNNRSAAEFEKGDYQTAIETLHEAVE 316

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPN-EPVFYSNISACYISTGDLEKVIEFTT 185
           A + K +GN  FT+K+FN+AI+ +  AIE+ P    V YSN SA Y S    ++ +   T
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 186 KALEIKPDHSKALLRRASANESLGNFTDA 214
           + ++I P  SK   R  +A   LGN  +A
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I+  P +   YSN +A         + I+    A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 194 HSKALLRRASANESLGNFTDAM 215
             +A +R+A+A  ++  + +A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVI----E 182
           A + K  GN  + A  F+EAI+ Y  A  L+  +  + +N SA     GD E  I    E
Sbjct: 255 ADEAKVEGNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLNE 313

Query: 183 FTTKALEIKPDH---SKALLRRASANESLGNFTDAM 215
              +  E++ D+   +K+  R  +A    G+   ++
Sbjct: 314 AVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSI 349

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A++ K++GN F  +K++ +AI+ Y  AIELD  + +F+SN +   +     +  +E ++K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           A+E+   + K   RR  A   L +F  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           +GN    AK F+EAI+ Y  AIE+ P+  V+YSN +A Y S    E+ ++   +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 193 DHSKALLR 200
            +SK   R
Sbjct: 161 TYSKGFSR 168

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIEL--DPNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K  GN  F AK+F +AI+ +  AIE+   PN  V YSN SACY S     + +   
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNH-VLYSNRSACYASMRKFREALADA 62

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + + IKPD SK   R  +A+  LG+  +A
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A + K +GN  +  + F+EAI  Y+ A +L   +  + +N +A     GD E  I+   K
Sbjct: 254 AEEAKAKGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESAIKTLEK 312

Query: 187 AL----EIKPDH---SKALLRRASANESLGNFTDAM 215
           A+    E++ D+   +K+  R  +A+  L +   A+
Sbjct: 313 AVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAI 348

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           +G  +FT  ++  A+K Y   I+  P +   YSN +A           I+    A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 193 DHSKALLRRASANESLGNFTDAMFDL 218
           +  +A +R+A+A  ++  +  A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A  LK +GN    +K+F  AIK Y  AIE+ P+  V+Y+N +A Y S    E+ ++ 
Sbjct: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQD 153

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
              A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 154 AESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK+F +A + +  AIE    PN  V YSN SACY S    ++ +E  
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNH-VLYSNRSACYTSLKKFKEALEDA 61

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A   LGN  DA
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           K  GN ++ A+ F+EAI++Y  A +L   +  + +N SA     GD E+ I+  T+A++
Sbjct: 271 KAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVD 328

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 5/106 (4%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           +G  FFT  ++  A+  Y   I+  P +   YSN +A           I+    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 193 DHSKALLRRASANESLGNFTDAMFDLSV-----LSLNGDFDGASIE 233
           +  +A +R+ASA  ++  F  AM  L       L +N   +   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  FTAK++ +AI  +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNH-VLYSNRSACYTSLKKFTDALNDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
           T+ ++I P  SK   R  +A+  LG+  DA
Sbjct: 64  TECVKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 116 KGLSPSQRQAY-----AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISAC 170
           K L  ++ +AY     A + +  G  +FT  ++  A+K Y   I+  P +   YSN +A 
Sbjct: 377 KELKKAEAEAYINPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAA 436

Query: 171 YISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
                   + I    KA+E  P+  +A +R+A+A  ++  F  A+  L
Sbjct: 437 LAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEFAGALETL 484

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 8/88 (9%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL-- 188
           K  GN F+ A+ F EAI++Y  A EL   +  + +N +A     GD E  I   T A+  
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELH-RDITYLNNRAAAEYEKGDYETAIATLTDAVEQ 321

Query: 189 --EIKPDH---SKALLRRASANESLGNF 211
             E++ D+   SK+  R  +A   LG+ 
Sbjct: 322 GREMRADYKVISKSFARIGNAYHKLGDL 349

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 369 QESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDY 428
           Q+S+  H T +  I   L  A+KE      K  +    +NPE        G+ YF   D+
Sbjct: 357 QKSLTEHRTAD--ILTKLRNAEKE-----LKKAEAEAYINPEKAEEARLEGKEYFTKSDW 409

Query: 429 KNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTL 479
            NA + + +    +PE+   Y   A  L K   F E+ A  N+   K P  
Sbjct: 410 PNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNF 460

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 122 QRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVI 181
           +++A A++L+  GN   + KN+  AI  Y  AIE+ P+ P +YSN +A Y    D    +
Sbjct: 95  KKEAEALKLE--GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAV 152

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
                A+++ P +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 153 LDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
           + KA+++ P  P  Y +R   Y +++D+ NA  D   A  L+P     Y +L      +G
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A +LK  GN     K+F+ AI  Y  AI + PN  ++Y+N +A Y S  D EK  E    
Sbjct: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAES 158

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 71/155 (45%), Gaps = 18/155 (11%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A   K+ GN F   ++F  A + Y  AIE DP + +FYSN +   +   +    +   T 
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLS---------VLSLNGDFDGASIEPMLE 237
           A+E+   + KA  RR  AN  L NF  A  D +         +++ NG FD  + E ++ 
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNG-FD--TCEKVIR 125

Query: 238 RNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASF 272
               K+A+         DE  G   +  +TSL+SF
Sbjct: 126 EERFKKAIG------GSDEKTGGATICQSTSLSSF 154

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A++ KN GN     +++ +AI+ Y  AIELD  + V++SN + C++   + +   +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           AL + P + KA  RR  A   L  F  A  DL+V+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQ--LACL 455
           + KA++L+      + +R   +  L +++ A +D  KA +L+P+NV  Y +  LAC+
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACV 88

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 56/98 (57%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A++ KN GN F   K+F +AI+ Y  AI+LD  + +++SN +  +    + +  +  
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
             +AL++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 69  CDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A Q K  GN  F +K++ +AI+ +  AIE+   PN  V +SN SACY S  D  K ++  
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNH-VLFSNRSACYASNKDFVKALDDA 61

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  +K   R  +A+  LG+  +A
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 8/92 (8%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL-- 188
           K  GN  +  + F+EAI+ Y  A E   N+  + +N +A     GD E  IE  TKA+  
Sbjct: 259 KAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQ 317

Query: 189 --EIKPDH---SKALLRRASANESLGNFTDAM 215
             E++ D+   SK+  R  ++   LG+   A+
Sbjct: 318 GRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           +G  +FT  ++ +A++ Y   I+ +PN+   YSN +A           I    KA+E  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 193 DHSKALLRRASANESLGNFTDAMFDL 218
           +  +A +R+A+   ++ ++  A+  L
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETL 480

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 56/101 (55%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           S++ A A++LKN GN F   ++F +AI  Y  AI LD  + +++SN +  ++   + +  
Sbjct: 6   SEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSS 65

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           +    +AL++ P ++KA  RR  +   L  F  A  DL ++
Sbjct: 66  LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 75/166 (45%), Gaps = 17/166 (10%)

Query: 119 SPSQRQ----AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYIST 174
           SP +R     A A+  KN GN +  AK++  A++ Y  AIE D  + +F+SN +   +  
Sbjct: 26  SPPRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKL 85

Query: 175 GDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGA---- 230
              +  +E + +A+E+   + KA  RR  A+  L  +  A  DL V+      D A    
Sbjct: 86  DRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRA 145

Query: 231 --SIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFG 274
               E ML R   ++A++        D     + L    SLASF G
Sbjct: 146 LEVCERMLRRERFERAIRA-------DGDEEQRRLCKTLSLASFAG 184

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 56/98 (57%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A++ KN GN F   K+F +AI+ Y  AI+LD  + +++SN +  +    + +  +  
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
             +A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A  LK  GN     K+F+ AIK Y  AIE+ P   V+Y+N +A + S    E+ 
Sbjct: 91  AETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEA 150

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
           I+    A++  P +SK   R   A  +LG   DA+     VL + GD
Sbjct: 151 IKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           AV  KN GN +   +N+ +AI+ Y  AIELDP + +F+SN +   +   + +  +     
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDV 71

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           AL + P + KA  RR  ++  L     A  DL V+
Sbjct: 72  ALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%)

Query: 160 EPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS 219
           + V + N    YI   +  K IE  ++A+E+ P  S     RA A   L NF   M D  
Sbjct: 11  QAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCD 70

Query: 220 V 220
           V
Sbjct: 71  V 71

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  FTAK++++AI+ +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNH-VLYSNRSACYTSLKKFSDALNDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 116 KGLSPSQRQAY-----AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISAC 170
           K L  ++ +AY     A + +  G  +FT  ++  A+K Y   I+  P +   YSN +A 
Sbjct: 380 KELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAA 439

Query: 171 YISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
                   + I    KA+E  P+  +A +R+A+A  ++  +  A+  L
Sbjct: 440 LAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETL 487

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 8/88 (9%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL-- 188
           K  GN F+ A+ F+EAI++Y  A EL   +  + +N +A     G+ E  I     A+  
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQ 324

Query: 189 --EIKPDH---SKALLRRASANESLGNF 211
             E++ D+   SK+  R  +A   LG+ 
Sbjct: 325 GREMRADYKVISKSFARIGNAYHKLGDL 352

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 52/97 (53%)

Query: 125 AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A A++ KNRGN     +++  AI+ Y  AI+LD    +++SN +  ++   + +  I   
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
            KALEI P + KA  RR  +   L  F +A  DL ++
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  FTAK++++AI+ +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNH-VLYSNRSACYASLKKFSDALNDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 116 KGLSPSQRQAY-----AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISAC 170
           K L  ++ +AY     A + +  G  +FT  ++  A+K Y   I+  P +   YSN +A 
Sbjct: 380 KELKKAEAEAYINPEKAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAA 439

Query: 171 YISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
                   + I    KA+E  P+  +A +R+A+A  ++  +  A+  L
Sbjct: 440 LAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEYAAALETL 487

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A + K  GN F+ A+ F+EAI++Y  A EL   +  + +N +A     G+ +  I  
Sbjct: 259 KAEADKEKAEGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIAT 317

Query: 184 TTKAL----EIKPDH---SKALLRRASANESLGNF 211
              A+    E++ D+   S++  R  +A   LG+ 
Sbjct: 318 LNDAVEQGREMRADYKVISRSFARIGNAYHKLGDL 352

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%)

Query: 125 AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A A++ KN GN F   K+F +AI+ Y  AI+LD  + +++SN +  +    + +  +   
Sbjct: 10  AKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
            +A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A++ KN+GN +   K + EA++YY  AIELD  + +++SN +   +   +     E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           A+ + P + KA+ RR  +   L  F  A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 1/104 (0%)

Query: 119 SPSQRQ-AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDL 177
           SPSQ   A A+  KN+GN +    +++ AI++Y  AI LD  + +++SN +  ++   + 
Sbjct: 3   SPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNF 62

Query: 178 EKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
              +     AL++ P + KA  RR  +   +  F  A  DL+V+
Sbjct: 63  YSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK++ +AI  +  AIE+   PN  VFYSN SACY S     + +   
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNH-VFYSNRSACYASLKKFPEALNDA 62

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I+  P +   YSN +A         + IE   KA+E  P+
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPN 456

Query: 194 HSKALLRRASANESLGNFTDAMFDL 218
             +A +R+A+A  ++  F  A+  L
Sbjct: 457 FIRAYIRKATAQIAVKEFAAAIETL 481

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 49/122 (40%), Gaps = 9/122 (7%)

Query: 345 ALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKE-NSQEFFKFFQK 403
           A +    G  H   NNL  A    Q+S+  H TP   I   L   +KE   QE  ++   
Sbjct: 330 AKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPE--ILTKLRNTEKELKKQEAEEY--- 384

Query: 404 AVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFT 463
              +NPE        G+ YF   D+ NA + + +     PE+   Y   A  L K   F 
Sbjct: 385 ---INPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFP 441

Query: 464 ES 465
           E+
Sbjct: 442 EA 443

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 8/89 (8%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVI----EFTTKALE 189
           GN  + A+ F+EAI +Y  A  L   +  + +N SA     GD E  +    E   K  E
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 190 IKPDH---SKALLRRASANESLGNFTDAM 215
           ++ D+   +K+  R  + +    N   A+
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
            (REAL)
          Length = 1424

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 80/413 (19%), Positives = 176/413 (42%), Gaps = 42/413 (10%)

Query: 144  NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
            +++I+++Q A+ +DPN+   +  +   Y + G +E  I+   KA+E++P H+ A   RA 
Sbjct: 712  SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYARYFRAL 771

Query: 204  ANESLGNFTDAMFDLSV----LSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKD---- 255
            +   +G + +++  L      ++    F    ++ +++ +L+  A   L ++++      
Sbjct: 772  SLCDMGEYLESLETLEKVCQEVATEESFQIGLVDVLVKYSLDLYAQGFLMKSVAVANDTI 831

Query: 256  ----------EGRGSQVLPSNTSLASFFGIFDSHLE------------VSSVNTSSNYDT 293
                      +    Q+    + +   F   +S ++            +S +  +   D+
Sbjct: 832  ERIRIIITELKCTNQQIWICLSQVLRLFIWIESKVDTLPVESLVSIFKISELAETKEVDS 891

Query: 294  AYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGI 353
               +  D L  L S TD+   +A   L  ++    S  S + +   +R +    +  + +
Sbjct: 892  IDNIKIDTL--LDSTTDDNVSIACKFLILASKYSVSNQSMSDIAGTIRASYWYNIGISEL 949

Query: 354  FHFLK---NNLLDAQVL-LQESINLHP-TPNSYIFLALTLADKENSQEFFKFFQKAVDLN 408
              F+    ++  DA V   ++SI L   T  ++I L +   D  N +     F KA  L 
Sbjct: 950  TAFVTLKDSHYRDAAVFAFKKSIQLQSNTSETWIGLGIATMDI-NFRVSQHCFIKATALE 1008

Query: 409  PEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAF 468
            P+    +++   +     D + A++   + QSL P++  P++ +A +L +QG   ES   
Sbjct: 1009 PKATDIWFNLAMLGLKKNDTEFAQQVLNRLQSLAPQDSSPWLGMALILEEQGNIVESSKL 1068

Query: 469  FNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
            F  + +    L    +  A++L  +   +  I   D  + +E V++   V I 
Sbjct: 1069 FAHSYI----LSNGRSKAAQVLYAKSVLENHIDNGDDERDIETVEKLTTVSIA 1117

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 379 NSYIFLALTLA--DKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           N++ F  + +A  +K+   +  ++FQ A+ ++P    ++   GQ Y      + + + F 
Sbjct: 694 NNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFD 753

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTES 465
           KA  L P + Y     A  L   G++ ES
Sbjct: 754 KAIELQPSHTYARYFRALSLCDMGEYLES 782

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP--VFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F+AK + +A+  +  AIE+ P EP  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSP-EPNHVLYSNRSACYTSLKKFTDALNDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            +  +I P  SK   R  +A+  LG+  +A
Sbjct: 64  NECTKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           +G  FF    + +A+K Y   I   P++   YSN +A         + I    KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 193 DHSKALLRRASANESLGNFTDAMFDLSV 220
           +  KA +R+A+A  ++  ++ A+  L +
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDI 485

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 8/91 (8%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL-- 188
           K+ GN  + A  F+EAI++Y  A EL  N+  + +N +A     GD E  I+    A+  
Sbjct: 262 KDEGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEK 320

Query: 189 --EIKPDH---SKALLRRASANESLGNFTDA 214
             E++ D+   +KA  R  +A E L +   A
Sbjct: 321 GRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 122 QRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVI 181
           +++A A  LK  GN     K++  AIK Y  AIE+ P   V+Y+N +A Y S    +  +
Sbjct: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAV 147

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 12/120 (10%)

Query: 398 FKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLY 457
            K + +A+++ P     Y +R   Y  L+ Y +A  D + A  +NP     Y +L    +
Sbjct: 113 IKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKF 172

Query: 458 KQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTD--RGDFDTAIKQYDIAKRLEEVQEK 515
            QGK  ++               +V     +  TD  + D++TA K+ + +  LE+V  K
Sbjct: 173 AQGKVEDA----------LDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPK 222

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 1/104 (0%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A   K  GN    AK++  AI+ Y  AI+  P   ++Y+N +A Y S  + +  I+ 
Sbjct: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGD 226
             KA+EI P +SK   R A A  +L    +A+ +   VL + GD
Sbjct: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%)

Query: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIK 191
           NR   + + K ++ AIK  + AIE+DP     YS ++    +    E+ +E+  K L+++
Sbjct: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197

Query: 192 PDHSKALLRR 201
            D +   ++R
Sbjct: 198 GDKATPAMKR 207

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (53%), Gaps = 3/93 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  FTAKN++ AI+ +  AIE+   P+  V +SN SACY S       +   
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSH-VLFSNRSACYTSLKKFSDALNDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDAMFD 217
            + ++I P  SK   R  +A+  LG+  +A  D
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 9/118 (7%)

Query: 112 IAQLKGLSPSQRQAYAVQLKN---------RGNHFFTAKNFNEAIKYYQYAIELDPNEPV 162
           +A+L+ +   Q++A A    N          G  +FT  ++  A+K Y   I+  P +  
Sbjct: 372 LAKLRNVEKEQKKAEAEAYINPDKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDAR 431

Query: 163 FYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 220
            YSN +A         + I    KA+E  P+  +A +R A+A  ++  F  A+  L V
Sbjct: 432 GYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIAVKEFAAALETLDV 489

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A   K  GN F+ A  F+EAI++Y  A EL   +  + +N +A     GD E VI  
Sbjct: 259 KAEADNEKAEGNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIAT 317

Query: 184 TTKALE----IKPDH---SKALLRRASANESLGNF 211
              A+E    ++ D+   SK+  R  +A   LG+ 
Sbjct: 318 LNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDL 352

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 125 AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A A  LK  GN    AK++N A++ Y  AI+L P + V+Y+N +A Y S    ++ I+  
Sbjct: 101 AKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDA 160

Query: 185 TKALEIKPDHSKALLR 200
             A++++P+ SK   R
Sbjct: 161 ESAIKVEPNWSKGYSR 176

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK ++EA+  +  AIE+   PN  V YSN SA Y S     + ++  
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNH-VLYSNRSASYASEQKFNEALKDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            +  +I P  +K   R  +A+  +GN  DA
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVI----E 182
           A + K  GN  + A+NF+EAI  Y  A ELD N   + +N SA     G+ +  I    E
Sbjct: 251 AEEAKVEGNKAYKARNFDEAIACYNKAWELD-NNITYLNNRSAAEFEKGEYDTAINTLNE 309

Query: 183 FTTKALEIKPDH---SKALLRRASANESLGNFTDAM 215
              K  E++ D+   +K+  R  +A   +GN  +A+
Sbjct: 310 AIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I+  P +   YSN +A           I    KA+E  P+
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 194 HSKALLRRASANESLGNFTDAMFDL 218
             +A +R+A+A  ++ +F+ A+  L
Sbjct: 452 FVRAYIRKATAQIAVKDFSYAIETL 476

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 4/108 (3%)

Query: 114 QLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYIS 173
           ++K  +P +    A++LKN GN F   K + +A +YY  AIE DP   + YSN +   + 
Sbjct: 4   EVKACNPEK----ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLK 59

Query: 174 TGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
             + +  ++   +A+E+  ++ KA  RRA +   L  F  A  DL ++
Sbjct: 60  LDNFQSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 119 SPSQRQA-YAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDL 177
           +PS+  A  A++ K+ GN +  ++++ +AI+ Y  AIELD    +FYSN +  ++   + 
Sbjct: 3   NPSKPDAEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNF 62

Query: 178 EKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           +  +     A+++  ++ KA  RR  A   L  F  A  DL++L
Sbjct: 63  QSALHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A  LK  GN    AK+F +A+  Y  AI++ P   V+Y+N +A + S    E+ 
Sbjct: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215
           ++    A+++ P +SK   R   A  +LG   +A+
Sbjct: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 71/141 (50%), Gaps = 4/141 (2%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A   K  GN     K+F+ A++ Y  AI++ P   ++Y+N +A + S  + E+ I+ 
Sbjct: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNK 242
              A++I P +SK   R A A   LG   +A+     VL + GD   A ++   E    K
Sbjct: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYET-AKK 216

Query: 243 QAMKVLNENLSK--DEGRGSQ 261
           +  + +N   SK  ++G+G Q
Sbjct: 217 RVEESMNVEKSKTPEQGQGQQ 237

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIE--LDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K  GN  F AK+F  A++ +  AI+   +PN  V YSN S  Y S    ++ +   
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNH-VLYSNRSGAYASLKKFDEALSDA 62

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
           T+ ++IK D SK   R  +A+  LGN  +A
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I   P++   YSN +A           I+   KA+EI P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 194 HSKALLRRASANESLGNFTDAMFDLSV 220
             +A +R+A+A  ++  ++ A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 28/180 (15%)

Query: 419 GQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT 478
           G  Y+ L + K A E ++K  SL        +     L ++ K  E+EA+ +  K +   
Sbjct: 339 GNAYYKLDEVKKAVEYYEK--SLTEHRTPDVLNKLRNLEREIKKREAEAYIDPEKAEKAR 396

Query: 479 LPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDP 538
           L +   +F      +GD+ +A+K Y      E +    H   G    +A  L++  S   
Sbjct: 397 L-DGKEYFT-----KGDWPSAVKAYS-----EMIMRAPHDARG-YSNRAAALSKLMS--- 441

Query: 539 TQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMD 598
                  F  AIK   KA E+DP   +A I  A  ++ +++   AIE  +    +ART D
Sbjct: 442 -------FPDAIKDCDKAIEIDPSFVRAYIRKATAQIAVQEYSAAIETLD----VARTKD 490

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K  GN  F AK++ +AI  +  AIE+   PN  V YSN SA Y S+   E+ +   
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNH-VLYSNRSAAYTSSKQYEQALSDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  +K   R+ +A + L  + +A
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 7/119 (5%)

Query: 105 LPNGEPDIAQLKG---LSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161
           L   E D+ Q +    LSP +    A + +  G  +FT  ++  A+K Y   I+  P++ 
Sbjct: 364 LRKAEKDLKQQEAEAYLSPEK----AEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDA 419

Query: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 220
             YSN +A           I    KA+E  P   +A LR+A+   ++  F  A+  L +
Sbjct: 420 RGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDL 478

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A + K  GN  + A+ F+EAI +Y  A E    +  + +N SA     GD E  I+  T+
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 187 ALE 189
           A+E
Sbjct: 310 AVE 312

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A + KN GN     K+F +AI+ Y  AI+LD  + +++SN +  +    + +  +    +
Sbjct: 12  AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDE 71

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK++ +AI  +  AIE+   PN  V YSN SACY S    E+ ++  
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNH-VLYSNRSACYASNKKFEEALKDA 61

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A   L    +A
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 116 KGLSPSQRQAY-----AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISAC 170
           K L  ++ +AY     A + + +G  FFT  ++  A+K Y   ++  P +   +SN +A 
Sbjct: 364 KELKKAESEAYVNPEKAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAA 423

Query: 171 YISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 220
                   + IE   KA+ I P+  +A +R+A+A  ++  F  A+  L++
Sbjct: 424 LAKLMSFPEAIEDCNKAVSIDPNFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 106 PNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYS 165
           P  EP+  ++    P+ R A   + K  GN  + A+ F EAI++Y  A EL   +  + +
Sbjct: 227 PKQEPEAMEVDE-EPNSRVAAEAE-KAEGNKLYKARQFEEAIEHYNKAWELH-KDITYLN 283

Query: 166 NISACYISTGDLEKVIEFTTKALE 189
           N SA     GD +  I+    A+E
Sbjct: 284 NRSAAEFEKGDYDTAIKTLNDAVE 307

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK++++AI  +  AI++   PN  V YSN SACY S       ++  
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNH-VLYSNRSACYTSLKKFVNALKDA 63

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +FT  ++  A+K Y   I+  P +   YSN +A         + I+   KA+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 194 HSKALLRRASANESLGNFTDAM 215
             +A +R+A+A  ++  F+ A+
Sbjct: 464 FVRAYIRKATAQIAVREFSSAL 485

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 14/123 (11%)

Query: 344 AALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQK 403
           A +  CYT +     N+L  A    ++S+  H TP   I   L  A+K+         Q+
Sbjct: 341 ARMGNCYTKL-----NDLKKAIDFYKKSLTEHRTPE--ILSKLRAAEKQVK------IQE 387

Query: 404 AVD-LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKF 462
           A D +NPE        G+ YF   D+ NA + + +     PE+   Y   A +L K   F
Sbjct: 388 AEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSF 447

Query: 463 TES 465
            E+
Sbjct: 448 PEA 450

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           GN  + A+ F+EA+  Y  A E   N+  + +N SA     GD E  I+   +A+E
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVE 324

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEI 190
           NR   + + K F  A+K  +  ++++P+    Y+ + A +   GDL++      KALE+
Sbjct: 45  NRSACYTSLKKFVNALKDAEECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALEL 103

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 64/162 (39%), Gaps = 42/162 (25%)

Query: 399 KFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVY----------- 447
           + ++KA+  +P +   YY  G +   L  Y+ A   F+KA+S+NP NV            
Sbjct: 583 RCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEK 642

Query: 448 --------PYIQLAC---------------LLYKQGKFTESEAFFNETKLKFPTLPEVPT 484
                    Y +LAC               LLY  G++T +  FF E K   P    V  
Sbjct: 643 LSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHF 702

Query: 485 FFAEILTDRGDFDTAIKQYDIAKRLE--------EVQEKIHV 518
              +I +  G    AIK+Y IA  L+        E  EK H 
Sbjct: 703 LLGQIYSILGRKKDAIKEYTIALNLDPKGRQLIMEALEKCHT 744

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 70/172 (40%), Gaps = 16/172 (9%)

Query: 419 GQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT 478
           G++++ L +Y+ + + F   ++L P  V      + LL+     ++     +E     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 479 LPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDP 538
           +PE        L+ + +   AIK ++ A +++           P    A  L     Q  
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQVD-----------PKFAYAYTL-----QGH 570

Query: 539 TQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDS 590
                + F+ A +   KA   DP    A  GL  + +++ + +EA+  FE +
Sbjct: 571 EYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKA 622

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           GN     KN +EAIK ++ A ++DP     Y+     Y S+   +       KA+   P 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 194 HSKALLRRASANESLGNFTDAMF 216
           H  A       +  LG + +A+ 
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALL 617

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%)

Query: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
            K+ GN    ++++ +AI+ Y  AI   P +P++YSN S  Y+   D E  I      + 
Sbjct: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCIS 199

Query: 190 IKPDHSKALLRRASANESLGNFTDAM 215
           I  + SKA +R A+       + DA+
Sbjct: 200 IDANFSKAYIRLANIKVQQHQYIDAL 225

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
            complex component and TPR protein, mediates 3'-5' RNA
            degradation by the cytoplasmic exosome; null mutants have
            superkiller phenotype of increased viral dsRNAs and are
            synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 78/368 (21%), Positives = 152/368 (41%), Gaps = 52/368 (14%)

Query: 144  NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
            +++I+++Q A+ +DPN+   +  +   Y + G +E  I+   KA++++P H+ A   +A 
Sbjct: 719  SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAI 778

Query: 204  ANESLGNFTDAMFDLSVLSLNG----DFDGASIEPMLERNLN--KQAMKVLNENLSKD-- 255
            +   +G + +++  L  +         F    +E ++  +L+   Q   + + +++KD  
Sbjct: 779  SLCDVGEYLESLDILEKVCQEAATEESFQIGLVEVLMRCSLDLYSQGFLLKSVSIAKDTI 838

Query: 256  ----------EGRGSQVLPSNTSLASFFGIFDSHL------------EVSSVNTSSNYDT 293
                      +    QV    + +   F   +S +            E S  + S   D+
Sbjct: 839  ERIKIIISELKCENQQVWIYLSQVLRLFIWIESKVDTLPVESLVSIFENSQFSGSEEIDS 898

Query: 294  AYALLSDALQRLYSATDEGYLVANDLLT----------KSTDMYHSLLSANTVDDPLREN 343
               +  D L  L S TD+   +A   L           K TD+      A TV      N
Sbjct: 899  VDNIKIDTL--LDSTTDDNVSIACKFLILASKYSVSDQKFTDI------AGTVRASYWYN 950

Query: 344  AALALCYTGIFHFLKNNLLDAQVL-LQESINLHP-TPNSYIFLALTLADKENSQEFFKFF 401
              ++   T      +    DA +   ++SI L   T  ++I L +   D  N +     F
Sbjct: 951  IGISEL-TAFITLKEPQYRDAAIFAFKKSIQLQSNTSETWIGLGIATMDI-NFRVSQHCF 1008

Query: 402  QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
             KA  L P+   T+++   +    +D + A++   K QSL P++  P++ +A +L +QG 
Sbjct: 1009 IKATALEPKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQGD 1068

Query: 462  FTESEAFF 469
               S   F
Sbjct: 1069 IIGSSKLF 1076

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 68/150 (45%), Gaps = 8/150 (5%)

Query: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           LK  GN     K++  AIK Y  AI   P   V+++N +A Y S    ++ +E    A++
Sbjct: 103 LKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162

Query: 190 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNKQAMKVL 248
           I P +SK   R   A  + G   DA+     VL + GD        M++R+      KV 
Sbjct: 163 INPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD----KATEMMKRDYETAKKKVE 218

Query: 249 NE-NLSKDEGRGSQVLPSNTSLAS--FFGI 275
              NL K    G+    S+++ A+  F G+
Sbjct: 219 QSLNLEKSTVSGNATAESDSASAADPFAGM 248

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 13/140 (9%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNE----PVFYSNISACYISTGDLEKVIE 182
           A   KN+ N  + AK F EA + Y+  IE+  N+       ++N++AC +   +  + I 
Sbjct: 78  AENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCIN 137

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDLSVLSLNGDFDGASIEPMLER 238
              KAL+  P + K   R A A   L    +A     F L++ S N      ++E +++R
Sbjct: 138 LCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSLQ--TLEGVIDR 195

Query: 239 N---LNKQAMKVLNENLSKD 255
               L++  +K L E   K+
Sbjct: 196 KQQELHEAEVKRLEEKQKKE 215

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 51/97 (52%)

Query: 125 AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           A A++ K++GN F   ++F +A + Y  AIELD  + +F+SN +  ++   + +  +   
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221
            KALE+   + KA  RR  +   L  F  A  DL  +
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A  LK  GN     K+F  AI  Y  AIE+ P   ++Y+N +A + S    ++ 
Sbjct: 87  AETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEA 146

Query: 181 IEFTTKALEIKPDHSKALLR 200
           +    KA+EI P +SK   R
Sbjct: 147 VVDAEKAIEIDPAYSKGYSR 166

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A+   NR     + K ++EA+   + AIE+DP     YS +     +    E+ +E   K
Sbjct: 127 AIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKK 186

Query: 187 ALEIKPDHSKALLRR 201
            ++++ D +  +++R
Sbjct: 187 VMDLEGDKATDIMKR 201

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 83/216 (38%), Gaps = 19/216 (8%)

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
           V +V TS N+   Y+ L D     Y      +        KS +M           DP  
Sbjct: 596 VQAVKTSENFAPGYSTLGDIYSEYYQDPTRAF----KCYFKSFEM-----------DPSD 640

Query: 342 ENAALALC--YTGIFHFLKNNLLDAQVLLQESIN--LHPTPNSYIFLALTLADKENSQEF 397
             AA  +C  Y G   +   +L+  +V+  E     L      Y  L +   +K+   E 
Sbjct: 641 LTAARYMCEKYCGSCDWQSASLIAERVVKAEKSKSILQNVNWPYRVLGIAHLEKQAESES 700

Query: 398 FKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLY 457
            ++FQ A+ + P    ++   GQ Y+     + + + F+KA  ++P N Y +   A  L 
Sbjct: 701 IEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKALSLS 760

Query: 458 KQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDR 493
           K G + ES   F E   + P          E+L + 
Sbjct: 761 KMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVEH 796

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 30/69 (43%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KA  LNP     +Y    +     D   A+    K+QS+ P++  P+  LA    K+G
Sbjct: 987  FIKATALNPRETSVWYDMAILALRYNDVAFARAVLMKSQSIAPQDSTPWFGLALASEKEG 1046

Query: 461  KFTESEAFF 469
               +S   F
Sbjct: 1047 LTQDSARLF 1055

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK++ +A + +  AI++   PN  V YSN SACY S     + ++  
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNH-VLYSNRSACYTSLKKFAEGLKDA 62

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A   L N  DA
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 11/120 (9%)

Query: 103 PSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPV 162
           P   N EP+  ++    P   Q  A + K  GN F+ A+ F+EAI++Y  A EL   +  
Sbjct: 227 PLKENNEPEPMEVDEKGP---QVAAEEEKAEGNKFYKARKFDEAIEHYNKAWELH-KDIT 282

Query: 163 FYSNISACYISTGDLEKVIEFTTKAL----EIKPDH---SKALLRRASANESLGNFTDAM 215
           + +N +A     GD E  I   T A+    E++ D+   +K+  R  +A   LG+   ++
Sbjct: 283 YLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSI 342

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +F+  ++  A+K Y   I+  P +   YSN +A         + I    +A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 194 HSKALLRRASANESLGNFTDAMFDLSVL 221
             +A +R+ASA  ++  F  A+  L  +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTV 476

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A  LK  GN    +K+++ A++ Y  AI++ P   V+++N +A Y ++ + ++ 
Sbjct: 95  AETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEA 154

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
           ++   +A+++ P +SK   R A A     NF +++     VL + GD
Sbjct: 155 VKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+T  +F++ I  ++ A++++PN+ + ++ + A   ++   E+ I+   +AL++KP   +
Sbjct: 468 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 527

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSLN 224
           A    A ++ ++G F +A  + LSVLS++
Sbjct: 528 ARYNLAVSSMNIGCFKEAAGYLLSVLSMH 556

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           LK +GN FF   ++  A+ YYQ AI  DP+ P+ YSN +   I      + ++   K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 190 -IKPDHSK 196
            I P++ K
Sbjct: 67  MICPENDK 74

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+T  +F++ I  ++ A+ ++PN+ + ++ + A   ++   E+ I+   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSL 223
           A    A ++ ++G F +A  + LSVLS+
Sbjct: 527 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 554

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL 188
           Q K  GN  F   ++  A + YQ  ++++P  P+ YSN +   I  G   +V+E   K L
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGL 64

Query: 189 EIKPDHSKALLRR 201
              P+ +  + ++
Sbjct: 65  TFTPNTTDTVYKK 77

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%)

Query: 415 YYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTE 464
           Y   G   F    YK A E +QK   + PEN   Y   A  L K G++TE
Sbjct: 6   YKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTE 55

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar to
            uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
            antiviral protein
          Length = 1411

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 89/426 (20%), Positives = 168/426 (39%), Gaps = 67/426 (15%)

Query: 145  EAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASA 204
            E+I+++Q A+ +DP +   +  +   Y++ G +E  ++   +AL++   HS AL  +A  
Sbjct: 697  ESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVC 756

Query: 205  NESLGNFTDAM---------------FDLSVLSLNGDF--DGASIEPMLERNLNKQAMKV 247
            +  LG + +++               F +S  +L  ++  D  S   +L+     Q   +
Sbjct: 757  HSQLGEYEESLKLMYNLVGENPKTIPFKVSCATLISEYSKDLYSQGYLLKSISESQKAIL 816

Query: 248  LNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSS----------VNTSSNYDTAYAL 297
            L ++++ + G     L S     + F   +++L V S          +N   N +     
Sbjct: 817  LIDDINNNGG-----LQSQEVWIALFTCINNYLLVQSEIDEMPIELLLNIFQNVNIKKVA 871

Query: 298  LSDALQRLY------SATDEGYLVANDLLTKSTDMYHSL----LSANTVDDPLRENAALA 347
              DA+ RL       + +     +A+ LL         L    +S  TV   L  N  LA
Sbjct: 872  SVDAIDRLSLNDIIDNTSSSSIEIASKLLILCAKYALYLTGEDISQATVGSSLWGNLGLA 931

Query: 348  LCYTGIFHFLKNNLLD-------AQVLLQESINLHPT-PNSYIFLALTLADKENSQEFFK 399
                        +L D       A +  ++SI        S+  LA++  D  N +    
Sbjct: 932  -------ELNAYSLFDETEYRESAIMCFKKSIQFQSNYVESWFGLAVSTMDF-NYRVSQH 983

Query: 400  FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQ 459
             F KA+ L+P  P   +    +     D   A +   KAQ+++P    P++ LA L  K+
Sbjct: 984  CFIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINKAQTISPAESSPWLGLALLNEKK 1043

Query: 460  GKFTESEAFFNET-KLKFPTLPEVPTFFAEILTDR--------GDFDTAIKQYDIAKRLE 510
               + S + F+    L     P +   FA+ + +         GD  +  +   +A  LE
Sbjct: 1044 NGSSNSVSLFSHAFVLSNGRSPSIQLLFAKSVLNSQIGSGIMDGDLSSIEQLTSVASALE 1103

Query: 511  EVQEKI 516
            +  +K+
Sbjct: 1104 QYFKKV 1109

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} similar
            to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
            dsRNA virus protection family member contains 8 copies of
            the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 83/363 (22%), Positives = 147/363 (40%), Gaps = 44/363 (12%)

Query: 145  EAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASA 204
            E+I+++Q A+ +D N+   +  +   Y + G LE  I+   KA E+ PDH  A   +A +
Sbjct: 696  ESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAIS 755

Query: 205  NESLGNFTDAM---------------FDLSVLSLNGDFDGASIEPMLERNLNK------Q 243
               +G +   +               F +S++++  D+   S+E   +  L K       
Sbjct: 756  LAGIGEYEQCIEIIAALLEKLPNEESFQVSMVNILIDY---SVELFSQGYLAKAVAQAVD 812

Query: 244  AMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEV----SSVNT-----SSNYDTA 294
            ++K +   +S    +   V  S +     F +  S +++    S VN        N D+ 
Sbjct: 813  SIKRIEYIISNISHKVQNVWISLSKALKLFILVQSKVDMLPIESLVNIFEACELKNTDSV 872

Query: 295  YALLSDALQRLYS-ATDEGYLVANDLLTKSTDMYHSLLSA------NTVDDPLRENAALA 347
              L    L+ L S  T +   +A   L  S     SL S        TV   L  N  +A
Sbjct: 873  DTLDEINLENLLSDETQDNTSIATKFLVLSAKC--SLASCEYENIPRTVRASLWYNLGIA 930

Query: 348  LCYTGIFHFLKNNLLDAQVLLQESINLHP-TPNSYIFLALTLADKENSQEFFKFFQKAVD 406
              +T I    +N    A +  ++SI L   T  ++I L ++  D  N +     F KA+ 
Sbjct: 931  ELFTYITLKAENYRDAAIICYKQSIKLQSNTTEAWIGLGISCMDV-NYRVAQHCFIKAIA 989

Query: 407  LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESE 466
            L P+    +Y    +     D + A++   K+QS+ P++  P+  +A     +    ES 
Sbjct: 990  LAPKEIGIWYDLAILALKNGDIEFARDVLMKSQSIAPQDSSPWFGMALAHEHENNLEESS 1049

Query: 467  AFF 469
              F
Sbjct: 1050 KMF 1052

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELD--PNEPVFYSNISACYISTGDLEKVIEFT 184
           A + K +GN  F AK++ +A + +  AIE    PN  V YSN SAC+ S     + +   
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNH-VLYSNRSACFTSLKKFNEALNDA 61

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
            + ++I P  SK   R  +A   LG   +A
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL-- 188
           K  GN F+ A+ F+EAI++Y  A +L   +  + +N SA     GD E+ I+  T+A+  
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQ 329

Query: 189 --EIKPDH---SKALLRRASANESLGNFTDAM 215
             E++ D+   SK+  R  +A   L +F  A+
Sbjct: 330 GREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%)

Query: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEI 190
           NR   F + K FNEA+      ++++P     Y+ + A Y   G L++  +   KALEI
Sbjct: 43  NRSACFTSLKKFNEALNDANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEI 101

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 54/119 (45%), Gaps = 10/119 (8%)

Query: 110 PDI-AQLKGLSPSQR----QAY-----AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPN 159
           PDI  +L+     Q+    QAY     A + + +G  +FT  ++  A+K Y    +  P 
Sbjct: 374 PDILTKLRNCEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPE 433

Query: 160 EPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218
           +   YSN +A         + I+    A+   P+  +A +R+A+A  ++  F  A+  L
Sbjct: 434 DARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAIETL 492

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIE-----LDPNEPVFYSNISACYISTGDLEKVI 181
           A   KN+GN  +  K F +A   Y  A++     L  NE + Y N++AC +   +    I
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESL-YLNLAACELEIKNYRSCI 128

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215
            +  +AL++   + KA  R   A   LG F D++
Sbjct: 129 NYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL- 188
           +K +GN  F   NF+ A +YY   I L+P  P+ YSN +   I      + I+   + L 
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 189 ------EIKPDHSKALLRRASANESLGNF 211
                 + +P   K L R   A ESL  F
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 98/253 (38%), Gaps = 38/253 (15%)

Query: 321 TKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNS 380
           T  + + H LL  N +       A    C  G    LK +  ++    Q S  L P   S
Sbjct: 393 TGLSHLCHELLEVNRL-------APETWCCIGNLFSLKKDHEESIKAFQRSTQLDP---S 442

Query: 381 YIFLALTLADKENSQE-----FFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDF 435
           + + A TL   E S           ++KA+  N ++   YY  G     L  Y+     F
Sbjct: 443 FTY-AYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHF 501

Query: 436 QKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFF---AEILTD 492
           +KA+S+NP NV   I + C      K +  E       L     P         A++L  
Sbjct: 502 EKARSINPVNV---ILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKRAQLLLA 558

Query: 493 RGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKL 552
            G ++ A++ ++   ++   +  IH  +G L     I+ R+  QD           A+K 
Sbjct: 559 MGKYNYALESFEKLVKIAPDEATIHFLLGQLY---QIVGRK--QD-----------AVKE 602

Query: 553 LTKACELDPRSEQ 565
           LT A  LDP+  Q
Sbjct: 603 LTIAMNLDPKGSQ 615

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL 188
           +LK +GN  F   +++EAI +Y   I +DP+ P+ YSN +   +     ++ I    K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 189 EI 190
           ++
Sbjct: 65  QL 66

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+T  +F++ I  ++ A++++PN+ + ++ + A   ++   E+ I+   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSLN 224
           A    A ++ ++G + +A  + L+VLS++
Sbjct: 527 ARYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  F   +N  ++I+++Q A+ +DPN+   +  +   Y + G +E  I+   KA+E+ PD
Sbjct: 691 GISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPD 750

Query: 194 HSKA 197
           H+ A
Sbjct: 751 HNYA 754

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KA+ L+P+    +++   +     D   A E   +AQS+ P+N  P++ +A L  K+G
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLALQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEKEG 1052

Query: 461  KFTESEAFFNET 472
            K TES   F  +
Sbjct: 1053 KSTESANMFGHS 1064

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 36/67 (53%)

Query: 381 YIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQS 440
           Y  + ++  + +N  +  ++FQ A+ ++P    ++   GQ YF     + + + F+KA  
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 441 LNPENVY 447
           L+P++ Y
Sbjct: 747 LSPDHNY 753

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+T  +F++ I  ++ A++++PN+ + ++ + A   ++   E+ I+   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSLN 224
           A    A ++ ++G   +A  + LSVLS++
Sbjct: 527 ARYNLAVSSMNIGCLKEAAGYLLSVLSMH 555

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%)

Query: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
           LK  GN FF   ++ +A  YY   I+L+P  P+ YSN +   I  G+    +E   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 190 IKPDHSK 196
                +K
Sbjct: 66  YTSSSTK 72

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 42/72 (58%)

Query: 144 NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
           +++I+++Q AI +DPN+   +  +   Y+  G +E  I+   KA+E+   H+ A   ++ 
Sbjct: 682 SDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSI 741

Query: 204 ANESLGNFTDAM 215
           A   +G FT+++
Sbjct: 742 ALSEMGEFTESI 753

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 390 DKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPY 449
           +++   +  ++FQ A+ ++P    ++   GQ Y      + + + F+KA  L+  + Y  
Sbjct: 677 ERQQESDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAK 736

Query: 450 IQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTF 485
              +  L + G+FTES     E      T PE  TF
Sbjct: 737 YFKSIALSEMGEFTESIPLLKEIT---GTHPEEETF 769

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KAV L P+     ++   +     D + A++   ++QS+ P++  P++ LA +L K G
Sbjct: 971  FIKAVALAPKDIEISFNLAMLALKNNDLEFAEQILMRSQSVAPQDSSPWLGLALILEKNG 1030

Query: 461  KFTESEAFF 469
               +S + F
Sbjct: 1031 NTADSCSLF 1039

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A +LK +GN     K +  AIK Y  AI++ P   ++Y+N +A + S  + ++ 
Sbjct: 96  AETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEA 155

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
           I+    A+ + P + +   R   A  + G   +A+     VL + GD
Sbjct: 156 IKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 65/135 (48%), Gaps = 19/135 (14%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           + Q+   F  K++++NP    T+YH G+++ I  DY  A + FQ+A + +  N   +  +
Sbjct: 257 DPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 316

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGD-FDT-------AIKQY 503
             L Y+  ++ ++ +A+    +L          + +E+  D G  ++T       A+  Y
Sbjct: 317 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 368

Query: 504 DIAKRLEEVQEKIHV 518
             A RL+   E +H+
Sbjct: 369 KQAARLDP--ENVHI 381

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 98/253 (38%), Gaps = 38/253 (15%)

Query: 321 TKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNS 380
           T  + + H LL  N +       A    C  G    LK +  ++    Q S  L P   S
Sbjct: 392 TGLSHLCHELLEVNRL-------APETWCCIGNLFSLKKDHEESIKAFQRSTQLDP---S 441

Query: 381 YIFLALTLADKENSQE-----FFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDF 435
           + + A TL   E S           ++KA+  NP++   +Y  G     L  Y+     F
Sbjct: 442 FTY-AYTLQGHEYSSNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHF 500

Query: 436 QKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFF---AEILTD 492
           +KA+S+NP NV   I + C      K +  E       L     P         A++L  
Sbjct: 501 EKARSINPVNV---ILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKRAQLLLA 557

Query: 493 RGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKL 552
            G ++ A++ ++    +   +  IH  +G L     I+ R+  QD           A+K 
Sbjct: 558 MGKYNFALENFEKLVTIAPDEATIHFLLGQLY---QIVGRK--QD-----------AVKE 601

Query: 553 LTKACELDPRSEQ 565
           LT A  LDP+  Q
Sbjct: 602 LTIAMNLDPKGSQ 614

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 34/83 (40%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           GN F   K+  E+IK +Q + +LDP+    Y+     Y S    +  +    KAL   P 
Sbjct: 416 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQ 475

Query: 194 HSKALLRRASANESLGNFTDAMF 216
           H  A          LG + + + 
Sbjct: 476 HYNAHYGLGMCCLKLGQYEECLL 498

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 96/234 (41%), Gaps = 31/234 (13%)

Query: 343 NAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQ-EFF--- 398
           NA    C  G F  L+ +  DA    +++  + P        A TL   E+S  + F   
Sbjct: 533 NAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPN----FAYAYTLQGHEHSSNDSFDTA 588

Query: 399 -KFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC--L 455
              ++KA+  +P++   YY  G     L  Y  A   F+KA+S+NP NV   I + C  +
Sbjct: 589 KNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICCCGV 645

Query: 456 LYKQGKFTESEAFFNETKLKFPTLPEVPTF-FAEILTDRGDFDTAIKQYDIAKRLEEVQE 514
             ++ ++ E    + E   +      +  F  A +L   G +  A++ ++   +L   + 
Sbjct: 646 ALEKLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEA 705

Query: 515 KIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKI 568
            +H  +G L     IL R+               A+K  T A  LDP+  Q  I
Sbjct: 706 TVHFLLGQLY---QILGRKKD-------------AVKEFTIAMNLDPKGNQLII 743

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 65/170 (38%), Gaps = 16/170 (9%)

Query: 419 GQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT 478
           G+++F L +Y  +   F   + L P  V      + LL+      +     NE  +  P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 479 LPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDP 538
            P+        L+ + D + AIK ++ A +++           P    A  L     Q  
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQVD-----------PNFAYAYTL-----QGH 577

Query: 539 TQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFE 588
                + F+ A     KA   DP+   A  GL    +++ + DEA+  FE
Sbjct: 578 EHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFE 627

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 71/193 (36%), Gaps = 30/193 (15%)

Query: 409 PEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAF 468
           P  P T+   G    + +D+++A + F+KA  ++P   Y Y         QG    S   
Sbjct: 532 PNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTL-------QGHEHSSNDS 584

Query: 469 FNETKLKF-PTLPEVPTFF------AEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521
           F+  K  +   L   P  +             G +D A+  ++ A+ +  +   +    G
Sbjct: 585 FDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCG 644

Query: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581
             + K             Q  E+    A+     ACEL P S  A    A L   M +  
Sbjct: 645 VALEK------------LQYQEK----ALSYYELACELQPSSSLANFKRAHLLYSMGRYS 688

Query: 582 EAIELFEDSAILA 594
            A++ FE+   LA
Sbjct: 689 VALQYFEELTKLA 701

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           ++ A  LK  GN     K++  AIK Y  AI + P   V+Y+N +A + S  + ++ I+ 
Sbjct: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
              A+++   +SK   R   A  + G   +A+     VL + GD
Sbjct: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A  LK  GN       + EAIK Y  AI+   N   +YSN S  Y   G  E  +   T 
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDATL 140

Query: 187 ALEIKPDHSKALLRRASANESLGNFTDAM 215
           A+ I P  SKA  R   A        D M
Sbjct: 141 AINIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A  LK +GN FF   ++  AI YY+ A  LD + P+++SN++   I     ++ +    K
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 187 AL 188
            L
Sbjct: 101 GL 102

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 4/129 (3%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A  LK  GN     K+F  AI  Y  AI   P+  V+++N +A Y S     + +E 
Sbjct: 95  KAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVED 154

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQ 243
              A+++ P +SK   R   A  +LG   +A   L       D +G++    ++R+ +  
Sbjct: 155 AEAAIKVNPSYSKGYSRLGFAQYALGRPEEA---LDAYKKVLDIEGSNATDAMKRDYD-T 210

Query: 244 AMKVLNENL 252
           AMK + ++L
Sbjct: 211 AMKKVEQSL 219

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 114 QLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEA--IKYYQYAIELDPNEPVFYSNISACY 171
           +L G   ++R++  V    R    F  +   EA  I+++Q A+ +DP +   +  +   Y
Sbjct: 651 RLLGSEKAKRKSKEVNWAYRVVGIFYLETQEEASSIEWFQSALRIDPKDVESWVGLGQAY 710

Query: 172 ISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215
            + G +E  ++   +ALE+  +H      +A +  +LG F D++
Sbjct: 711 YACGRIEASMKVFERALELDSEHQHCRYLKAQSLAALGQFVDSI 754

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 64/149 (42%), Gaps = 10/149 (6%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIEL----DPNEPVFYSNISACYISTGDLEKVIE 182
           A   KNRGN F+  K + +A + Y   I++    D      Y+N +AC +   +  K IE
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLE----R 238
              KAL     + K   R   A  S+  F ++   +    L  D +  S++ +L+    R
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIE-FGLKIDSENKSLKNLLQAIEKR 192

Query: 239 NLNKQAMKVLNENLSKDEGRGSQVLPSNT 267
            L  Q  K +   + K E  G +V+  N 
Sbjct: 193 QLEIQRRKDMEMKI-KLEKEGKKVILENA 220

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN 166
             K  GN +F   N+  AIK Y+  IE++P  P+ YSN
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSN 42

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVI 181
           A   K +GN  + AK F +A + Y   I ++      NE +F +N +AC +   +  + I
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLF-ANRAACELELKNYRRCI 141

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDA 214
           E  +KAL I P + K   R + A  SL    +A
Sbjct: 142 EDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 56/102 (54%), Gaps = 4/102 (3%)

Query: 144 NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
           +++I+++Q A+ +DPN+   +  +   Y + G +E  I+   KA++++P H+ A   +A 
Sbjct: 704 SDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYAQYFKAV 763

Query: 204 ANESLGNFTDAMFDLSVL----SLNGDFDGASIEPMLERNLN 241
           +   +G + +++  L  +    S    F  A +E +++ +L+
Sbjct: 764 SLCDIGEYLESLEILKKVCQEDSTEESFQSALVEVLMKYSLD 805

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KA  L P+   T+++   +     D + A++   K QSL P++  P++ +A +L KQG
Sbjct: 993  FIKATALEPKATDTWFNLAMLGLKKNDAEFAQQVLNKLQSLAPQDSSPWLGMALILEKQG 1052

Query: 461  KFTESEAFF 469
               ES   F
Sbjct: 1053 NVIESSKLF 1061

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 379 NSYIFLALTLA--DKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           N++ F  + +A  +K+   +  ++FQ A+ ++P    ++   GQ Y      + + + F 
Sbjct: 686 NNWPFRVVGIAHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFD 745

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTES 465
           KA  L P + Y     A  L   G++ ES
Sbjct: 746 KAIQLRPSHTYAQYFKAVSLCDIGEYLES 774

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 65/135 (48%), Gaps = 19/135 (14%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           + Q+   F  K+++++P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +
Sbjct: 285 DPQKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGD-FDT-------AIKQY 503
             L Y+  ++ ++ +A+    +L          + +E+  D G  ++T       A+  Y
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 396

Query: 504 DIAKRLEEVQEKIHV 518
             A RL+   E +H+
Sbjct: 397 KQAARLDP--ENMHI 409

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIEL----DPNEPVFYSNISACYISTGDLEKVIE 182
           A   KN+GN  FT K F EA   Y   IE+    D      ++N +AC +   +    I 
Sbjct: 80  AENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIN 139

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDA 214
               AL + P + K   R   A   L N  +A
Sbjct: 140 DCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  F+  + F + I  ++ A+E++PN+ + ++ + A   ++   E+ I+   KAL +KP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 194 HSKALLRRASANESLGNFTDAMFD-LSVLSLN 224
             +A    A ++ ++G + +A    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 115 LKGLSPSQRQAYAVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYIS 173
           +K L PS R   ++QL N G H +   N NE AIK ++  +E +      + ++   Y+ 
Sbjct: 663 VKDLDPSSRTTISIQL-NLG-HTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK 720

Query: 174 TGDLEKVIEFTTKALEIKPDHSK--ALLRRA 202
           T  L+K I+   K+L +KP++S   ALL+ A
Sbjct: 721 TKKLQKAIDHLHKSLYLKPNNSSATALLKNA 751

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++++P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 289 QKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 348

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G          + A+  Y  
Sbjct: 349 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLNDALDAYKQ 400

Query: 506 AKRLEEVQEKIHV 518
           A RL+   E +H+
Sbjct: 401 AARLDP--ENVHI 411

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 92/220 (41%), Gaps = 19/220 (8%)

Query: 378 PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           P ++  +   L+ +++     K F+KA  L+P +   Y  +G  +       +AK  ++K
Sbjct: 540 PETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRK 599

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFD 497
           A + +P++   Y  L     K G++ E+  +F + +   P    +       L   G  +
Sbjct: 600 ALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKE 659

Query: 498 TAIKQYDIAKRLEEVQEKIHVGIGPLIGKATI--LARQSSQDPTQLDEEKFNA------- 548
            A++ Y++A  L+         +G L+   T   +A Q+ ++  +L  +   A       
Sbjct: 660 KALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQT 719

Query: 549 ---------AIKLLTKACELDPRSEQAKIGLAQLKLQMEK 579
                    AIK LT A  LDP+  Q  I   Q K  M++
Sbjct: 720 YRIVGRKKDAIKELTVAMNLDPKGNQVIIDELQ-KCHMQE 758

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 82/209 (39%), Gaps = 22/209 (10%)

Query: 384 LALTLADKENSQEFFKFFQKAV--DLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSL 441
           L L  + + NS +  + F+  +   +    P      G+++F + +Y  + + F + + L
Sbjct: 442 LILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDL 501

Query: 442 NPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIK 501
            P  V      + LL+      +S    N      P  PE       +L+ + D D AIK
Sbjct: 502 QPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIK 561

Query: 502 QYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNAAIKLLTKACEL 559
            ++ A +L+           P    A  L     SS D +       ++A     KA   
Sbjct: 562 AFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKALAC 603

Query: 560 DPRSEQAKIGLAQLKLQMEKIDEAIELFE 588
           DP+   A  GL    +++ + +EA+  FE
Sbjct: 604 DPQHYNAYYGLGTSAMKLGQYEEALLYFE 632

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186
           A +LK +GN    AK +++AI  Y  AI+L P    +Y+N +  YI   + +  I    K
Sbjct: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193

Query: 187 ALE----IKPDHSKALLRRASANESLGNF 211
           ++E    I P + KA  R   A   +G++
Sbjct: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 65/135 (48%), Gaps = 19/135 (14%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           + Q+   +  K+++++P    T+YH G+++ +  DY  A + FQ+A + +  N   +  +
Sbjct: 296 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSI 355

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGD-FDT-------AIKQY 503
             L Y+  ++ ++ +A+    +L          + +E+  D G  ++T       A+  Y
Sbjct: 356 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 407

Query: 504 DIAKRLEEVQEKIHV 518
             A RL+   E IH+
Sbjct: 408 KQAARLDP--ENIHI 420

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%)

Query: 144 NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
           ++AI+++Q A+ ++PN    +  +   Y+S G +E  I    KA E+ PDH  A    A 
Sbjct: 685 SDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYAKYFTAQ 744

Query: 204 ANESLGNFTDAM 215
           +   +G +  ++
Sbjct: 745 SLSEMGEYVKSI 756

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 380 SYIFLALTLADKENSQE--FFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
            + F  + +A+ E  QE    ++FQ A+ + P    ++   GQ Y      + +   F+K
Sbjct: 668 CWPFRVIGIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEK 727

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEIL 490
           A  L+P+++Y     A  L + G++ +S + F E  ++ P        ++E L
Sbjct: 728 ATELDPDHLYAKYFTAQSLSEMGEYVKSISIFEEIIMETPKEESFQVSYSETL 780

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 53/96 (55%), Gaps = 4/96 (4%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+    F+  I  +Q A++++PN+ + ++ + A   ++   E+ I+   +AL++KP   +
Sbjct: 434 FYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 493

Query: 197 ALLRRASANESLGNFTDA----MFDLSVLSLNGDFD 228
           A    A ++ ++G + +A    +  LS+  + G+F+
Sbjct: 494 ARYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFE 529

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIEL----DPNEPVFYSNISACYISTGDLEKVIE 182
           A   KN+GN  +  K F +A + Y  AI++    D      Y+N +AC +   +  + I 
Sbjct: 74  AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCIN 133

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDA 214
               AL + P + K   R A A  ++  F D 
Sbjct: 134 DCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 5/93 (5%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPV-----FYSNISACYISTGDLEKVI 181
           A   KN+GN  + AK F +A   Y   I+++ N+ V      ++N +AC +   +  + I
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCI 135

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDA 214
                AL++ P + K   R   A  +L    +A
Sbjct: 136 NDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL 188
           + K +GN  +   NF +A+ +Y+ AI  DP  PV YSN +   I   +     +   + L
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 48/82 (58%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+   +FN+ I  ++ A++++PN+ + ++ + A   ++   E+ I+   +AL++KP   +
Sbjct: 456 FYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVR 515

Query: 197 ALLRRASANESLGNFTDAMFDL 218
           A    A ++ ++G + +A+  L
Sbjct: 516 ARYNLAVSSMNIGCYKEAVEHL 537

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A  LK +GN     K++  AI  Y  AI++ P   ++Y+N +A + S  + ++ 
Sbjct: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
           ++    A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 7/129 (5%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVI 181
           A   KN+GN  +  K + +A + Y   IE+       NE +F SN +AC +   +  + +
Sbjct: 78  AENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLF-SNRAACELELKNYRRCV 136

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLN 241
               +AL+  P + K   R A A   L    DA   +    L  D + A+++ +L++ + 
Sbjct: 137 NDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQKVIK 195

Query: 242 KQAMKVLNE 250
           ++  K  +E
Sbjct: 196 REEDKKAHE 204

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 146 AIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASAN 205
           +I+++Q AI +DPN+   +  +   Y++ G +E  ++   KA+E+   H  A   +A A 
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSHLHAQYFKALAL 747

Query: 206 ESLGNFTDAMFDL--SVLSLN 224
             +G F+ A  DL  SV  LN
Sbjct: 748 ADMGEFS-ASIDLLTSVTELN 767

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KAV L+P+    +++   +     D   AKE   ++QS+ P++  P++ +A +   +G
Sbjct: 975  FIKAVALDPKNTEIWFNLAMLGLRHDDITFAKEVLNRSQSVAPQDSVPWLGMALVSELKG 1034

Query: 461  KFTESEAFF 469
               ES   F
Sbjct: 1035 DKQESSRLF 1043

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 42/72 (58%)

Query: 144 NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
           +++I+++Q A+ +DPN+   +  +   Y + G +E  I+   KA+ +KP H+ A   +A 
Sbjct: 712 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLKPSHTYAQYFKAV 771

Query: 204 ANESLGNFTDAM 215
           +   +G + +++
Sbjct: 772 SLCDMGEYLESL 783

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 363  DAQVL-LQESINLHP-TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ 420
            DA +   ++SI L   T  ++I L +   D  N +     F KA  L P+    +++   
Sbjct: 962  DAAIFAFKKSIQLQSNTSEAWIGLGVATMDM-NFRVSQHCFIKATALEPKATDIWFNLAM 1020

Query: 421  MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFF 469
            +     D   A++   K+QSL P++  P++ +A +L KQG   ES   F
Sbjct: 1021 LGLKKNDTDFAQQVLNKSQSLAPQDSSPWLGMALILEKQGNIVESSKLF 1069

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 379 NSYIFLALTLA--DKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           N++ F  + +A  +K+   +  ++FQ A+ ++P    ++   GQ Y      + + + F 
Sbjct: 694 NNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFD 753

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTES 465
           KA  L P + Y     A  L   G++ ES
Sbjct: 754 KAIGLKPSHTYAQYFKAVSLCDMGEYLES 782

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183
           +A A  LK +GN     K++  AI  Y  AI++ P   ++Y+N +A + S    ++ +E 
Sbjct: 99  KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVED 158

Query: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
              A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G  +   +   ++I+++Q AI +D ++   +  +   Y S G +E  I+   K LE+ P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 194 HSKALLRRASANESLGNFTDAM 215
           H  AL  +A     +G F +++
Sbjct: 742 HPHALYFKALGLSDVGQFVESI 763

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 92/220 (41%), Gaps = 19/220 (8%)

Query: 378 PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           P ++  +   L+ +++     K F+KA  L+P +   Y  +G  +       +AK  ++K
Sbjct: 533 PETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRK 592

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFD 497
           A + +P++   Y  L     K G++ E+  +F + +   P    +       L   G  +
Sbjct: 593 ALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKE 652

Query: 498 TAIKQYDIAKRLEEVQEKIHVGIGPLIGKAT--ILARQSSQDPTQLDEEKFNA------- 548
            A++ Y++A  L+         +G L+   T   +A Q+ ++  +L  +   A       
Sbjct: 653 KALQYYELACHLQPTSSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDATAHYLLGQT 712

Query: 549 ---------AIKLLTKACELDPRSEQAKIGLAQLKLQMEK 579
                    AIK LT A  LDP+  Q  I   Q K  M++
Sbjct: 713 YRIVGRKKDAIKELTVAMNLDPKGNQVIIDELQ-KCHMQE 751

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 83/211 (39%), Gaps = 22/211 (10%)

Query: 384 LALTLADKENSQEFFKFFQKAV--DLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSL 441
           L L  + + NS +  + F+  +   +    P      G+++F + +Y  + + F + + L
Sbjct: 435 LILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDL 494

Query: 442 NPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIK 501
            P  V      + LL+      +S    N      P  PE       +L+ + D D AIK
Sbjct: 495 QPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCVGNLLSLQKDHDAAIK 554

Query: 502 QYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNAAIKLLTKACEL 559
            ++ A +L+           P    A  L     SS D +       ++A     KA   
Sbjct: 555 AFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKALAC 596

Query: 560 DPRSEQAKIGLAQLKLQMEKIDEAIELFEDS 590
           DP+   A  GL    +++ + +EA+  FE +
Sbjct: 597 DPQHYNAYYGLGTSSMKLGQYEEALLYFEKA 627

>Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 115 LKGLSPSQRQAYAVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYIS 173
           +K L PS R   ++QL N G H +   N NE AIK ++  +E +      + ++   Y+ 
Sbjct: 616 VKDLDPSSRTTISIQL-NLG-HTYRKLNENEIAIKCFKCVLEKNDKNSEIHCSLGYLYLK 673

Query: 174 TGDLEKVIEFTTKALEIKPDHSKA--LLRRA 202
           T  L+K I+   K+L +KP+++ A  LL+ A
Sbjct: 674 TKKLQKAIDHLHKSLYLKPNNASATTLLKNA 704

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 55/134 (41%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           TP ++  +    +  ++  E  K FQKA  L+P +   Y  +G  Y     +  AK  ++
Sbjct: 413 TPQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYR 472

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDF 496
           KA + N ++      L     K G++ ES   F +     P    +      +    G  
Sbjct: 473 KALATNSQHYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNVILICCCGVVFEKLGHQ 532

Query: 497 DTAIKQYDIAKRLE 510
             A+K Y++A  L+
Sbjct: 533 QDALKYYELACELQ 546

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 4/114 (3%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPV----FYSNISACYISTGDLEKVIE 182
           A   K +GN  + AK F +A + Y   + ++  +       Y+N +AC +   +  + IE
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 236
             +KAL I P + K   R + A   L    +A    +  +   D +  SI  ML
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNML 196

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 415 YYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEA 467
           Y +R      L++Y+   ED  KA ++NP+NV  Y + +   ++  K  E+++
Sbjct: 124 YANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKS 176

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEI 190
           K  GN  +    + +AI  Y   I   P  PV +SN +   I  G+  + IE   + L++
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 191 KPDHSKALLR 200
                 A LR
Sbjct: 68  AASPQHAALR 77

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 75/170 (44%), Gaps = 22/170 (12%)

Query: 400 FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC--LLY 457
           +F+KAV  + ++   YY  G     L ++++A   F+KA+S+NP NV   I + C  + +
Sbjct: 621 YFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNV---ILICCCGVAF 677

Query: 458 KQGKFTESEAFFNETKLKFPTLPEVPTF-FAEILTDRGDFDTAIKQYDIAKRLEEVQEKI 516
           ++  + E    + E   +      +  F  A +L    ++  A++ ++   +L   +  +
Sbjct: 678 EKLSYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATV 737

Query: 517 HVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQA 566
           H  +G L     I+ R+               A+K  T A  LDP+  Q 
Sbjct: 738 HFILGQLYN---IMGRKKD-------------AVKEYTIAMNLDPKGNQV 771

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 47/82 (57%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           RG  ++   +F++ I+ ++ +++++PN+ V ++ + A   ++   E  I+   +AL +KP
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 193 DHSKALLRRASANESLGNFTDA 214
              +A    A A+ ++G + +A
Sbjct: 497 SFVRARYNLAVASMNIGCYKEA 518

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL 188
           + K  GN +F   N+ +A++YY+  IE++P  P+ YSN +   I      + +E     L
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

Query: 189 EIKPDHSKALLRR 201
           +   D    + ++
Sbjct: 65  KYVNDADSQVYKK 77

>NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7.458
           YJR088C
          Length = 335

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 403 KAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
           K VD  P  P T++  G++YF L+DY  AK  F++   + P N   + +L+ +LY Q 
Sbjct: 167 KLVDKFPLDPETWWFMGEVYFQLKDYHKAKYCFEEILIIMPFNYEAFARLSEVLYYQA 224

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 144 NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
           +E+I+++Q A+ +DP++   +  +   Y + G +E  ++   KALE++P  + A   +A 
Sbjct: 697 SESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKAL 756

Query: 204 ANESLGNFTDAMFDLSVLS----LNGDFDGASIEPMLER 238
           +   +G + D++  L  L+    L   +  + +E M+E 
Sbjct: 757 SLSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEH 795

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 75/185 (40%), Gaps = 13/185 (7%)

Query: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341
           V SV TS N+   Y+ L D   + YS             T++   Y      +  D    
Sbjct: 595 VQSVKTSENFAYGYSTLGDIYSQYYSDP-----------TRAFKCYFRAFEIDAGDLTAG 643

Query: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNS-YIFLALTLADKENSQEFFKF 400
                  C +G +    + + D  V  + S N+    N  Y  L +   +K++  E  ++
Sbjct: 644 RYMCENYCSSGDWQS-ASMIADRVVKAERSKNMLQNINWPYRVLGIANLEKQSESESIEW 702

Query: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
           FQ A+ ++P    ++   GQ Y+     + + + F+KA  + P + Y +   A  L + G
Sbjct: 703 FQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKALSLSRMG 762

Query: 461 KFTES 465
            + +S
Sbjct: 763 LYNDS 767

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KA  L+P     +Y    +     D   A+    K+Q++ P++  P++ LA    K+G
Sbjct: 986  FIKATALSPRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEG 1045

Query: 461  KFTESEAFF 469
               ES   F
Sbjct: 1046 LVEESSRLF 1054

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 60/128 (46%), Gaps = 21/128 (16%)

Query: 105 LPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFY 164
           LP  +PDI    GL                  F+T  ++++ I  ++ A+ ++PN+ + +
Sbjct: 488 LPTIDPDIQLCLGL-----------------LFYTTADYDKTIDCFKTALTVNPNDELMW 530

Query: 165 SNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDLSV 220
           + + A   ++   E+ +    +AL +KP   +A    A ++ ++G F +A    +  LS+
Sbjct: 531 NRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNLAVSSINIGCFKEAAEHLLTALSM 590

Query: 221 LSLNGDFD 228
             +NG  D
Sbjct: 591 HEINGILD 598

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL 188
            L+++GN  ++   +  A+ YY+ A   +P+ PV  +N+S   +     E  +    +AL
Sbjct: 10  HLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRAL 69

Query: 189 EI 190
           EI
Sbjct: 70  EI 71

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKAL 188
           K +GN  F    + EA+  Y   I   P  PV YSN +   I  G+  + I+   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVIEFT 184
            K +GN  + AK F +A + Y   + ++      NE +F +N +AC +   +  + IE  
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLF-ANKAACELELKNYRRCIEDC 144

Query: 185 TKALEIKPDHSKALLRRASANESLGNFTDA 214
           +KAL I P ++K   R + A   L    +A
Sbjct: 145 SKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {ON}
           YKL022C (REAL)
          Length = 802

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 115 LKGLSPSQRQAYAVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYIS 173
           +K L P  R   ++QL N G H +   N NE AIK ++  +E        + ++   Y+ 
Sbjct: 621 VKDLDPGSRTTISIQL-NLG-HTYRKLNENEIAIKCFKCVLEKSDKNSEIHCSLGYLYLK 678

Query: 174 TGDLEKVIEFTTKALEIKPDHSKAL 198
           T  L+K I+   K+L IKP+++ A+
Sbjct: 679 TKKLQKAIDHLHKSLYIKPNNASAM 703

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 6/93 (6%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIEL-----DPNEPVFYSNISACYISTGDLEKVI 181
           A   KN+ N  +  K F +A + Y   I++       NE +F +N +AC +   +    +
Sbjct: 85  AENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLF-ANRAACELELKNYRSCV 143

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDA 214
               KA+EI P + K   R   A  +LG F +A
Sbjct: 144 ADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 84/208 (40%), Gaps = 20/208 (9%)

Query: 380 SYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQ 439
           ++  L    + +++  E  K F KA +L+P +   Y  +G  Y   + +  A+  ++KA 
Sbjct: 496 TWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKAL 555

Query: 440 SLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTA 499
           + + ++   Y  L     + G    S  FF + ++  P    +       L    +++ A
Sbjct: 556 ACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELA 615

Query: 500 IKQYDIAKRLEEVQEKIHVGIGPL---IGKATILARQSSQDPTQLDEEKFNA-------- 548
           +K YD A +L+            L   +G+ + LA +  +D  +LD E  N         
Sbjct: 616 LKYYDFASKLQPNSALAKYRKAELLFSLGRYS-LAVELFEDLIKLDSENPNLHYMLGKIY 674

Query: 549 --------AIKLLTKACELDPRSEQAKI 568
                   A+K  T A  LDP+  Q  I
Sbjct: 675 QTMGRKKDAVKEYTVAMNLDPKGNQYII 702

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 36/91 (39%), Gaps = 4/91 (4%)

Query: 120 PSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEK 179
           P   Q + V     GNHF   K+ +EAIK +  A ELDP     Y+     Y S    + 
Sbjct: 491 PEAAQTWCV----LGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDT 546

Query: 180 VIEFTTKALEIKPDHSKALLRRASANESLGN 210
              F  KAL     H  A     + +   GN
Sbjct: 547 ARTFYRKALACDSQHYNAYYGLGTCDSQNGN 577

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 64/175 (36%), Gaps = 16/175 (9%)

Query: 419 GQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT 478
           G++++ +Q+YK A   F++ + + P  +      + LL+      +     NE    FP 
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNLANELIDNFPE 492

Query: 479 LPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDP 538
             +         + + D D AIK ++ A  L+           P    A  L     Q  
Sbjct: 493 AAQTWCVLGNHFSLQKDHDEAIKAFNKATELD-----------PRFAYAYTL-----QGH 536

Query: 539 TQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAIL 593
                E F+ A     KA   D +   A  GL     Q    D ++  FE + ++
Sbjct: 537 EYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMI 591

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 5/69 (7%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE- 189
           K +GN  F    + EA+  Y   I   P  PV YSN +   I  G+  + I+   + L+ 
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQH 71

Query: 190 ----IKPDH 194
                 PDH
Sbjct: 72  ASTTTTPDH 80

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180
           ++ +A A  LK +GN     K++  AI  Y  AI++ P   ++Y+N +A + S  + ++ 
Sbjct: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEA 155

Query: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226
           ++    ++ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 156 VKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           + Q+      K+++++P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +
Sbjct: 286 DPQKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSI 345

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGD-FDTAIKQ-------Y 503
             L Y+  ++ ++ +A+    +L          + +E+  D G  ++T  KQ       Y
Sbjct: 346 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNKQLNDALDAY 397

Query: 504 DIAKRLEEVQEKIHV 518
             A RL+   + +H+
Sbjct: 398 KQAARLDP--DNVHI 410

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 126/330 (38%), Gaps = 83/330 (25%)

Query: 243 QAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDAL 302
           +A+++LNE L        Q +P   SL S       H E+       N+D A +  S  L
Sbjct: 371 RAIRLLNEQLPP---HILQSMPWCLSLLSRL-----HFEIQ------NHDMALSYFSK-L 415

Query: 303 QRLYSATDEGYLVANDLL------TKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHF 356
           +RL     +   V + LL       +  D+ H L+  +       + +A+  C  G    
Sbjct: 416 RRLQPTRLKDMDVYSTLLWHLHDKIRLADLCHELMEQD-------DKSAITWCCLGNLFS 468

Query: 357 LKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKE--NSQEFFK---FFQKAVDLNPEY 411
           L  +  +A   L+++ NL P        A TL   E  N+  F      ++KA+ +NP +
Sbjct: 469 LNRDHDEAIKALKKATNLDPR----FAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNH 524

Query: 412 PPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVY-------------------PYIQL 452
              +Y  G     L  Y  A   F+KA+S+NP NV                     + QL
Sbjct: 525 YNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQL 584

Query: 453 AC---------------LLYKQGKFTESEAFFNETKLKFPTLPEVPTFF--AEILTDRGD 495
           AC               LL+  G++  S A  N  KL+  T  E P  F   ++    G 
Sbjct: 585 ACELQPNSSLALFKKSQLLFNLGQY--SNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGR 642

Query: 496 FDTAIKQYDIAKRLE--------EVQEKIH 517
              AI Q+ IA  L+        E  EK H
Sbjct: 643 KKDAITQFTIAMNLDPKGIQLVKEALEKCH 672

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 99/269 (36%), Gaps = 22/269 (8%)

Query: 325 DMYHSL-LSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHP--TPNSY 381
           D Y ++ L  N + D + +N    L   G  H+   N   A +   +   L P    ++ 
Sbjct: 462 DAYKAIRLFHNCIPDHIVKNMPWCLAQLGKLHYEIVNYEMASIYFMQLFELQPYRISDTE 521

Query: 382 IFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSL 441
           IF  L L   ++ +         +   P  P T+   G    + +D+++A E F+KA  +
Sbjct: 522 IFSTL-LWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKI 580

Query: 442 NPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIK 501
           +P+  Y Y         QG    S   F+  K  F                 G +   + 
Sbjct: 581 DPKFAYAYTL-------QGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLG 633

Query: 502 QYDIAKRLEEVQEKIHVGIGPLIGKATI-LARQSSQDPTQLDEEKFNAAIKLLTKACELD 560
            YD A    E   +I+     LI    + L +   QD           A++    AC L 
Sbjct: 634 HYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQD----------KALEYYELACTLQ 683

Query: 561 PRSEQAKIGLAQLKLQMEKIDEAIELFED 589
           P S  A+   A L   M + + A++ FE+
Sbjct: 684 PNSNLARFKRANLLYAMGRYNLALQSFEE 712

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 92/208 (44%), Gaps = 22/208 (10%)

Query: 378 PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           P ++  +   L+ K++ ++  + F+KA  ++P++   Y  +G        +  AK+ F+K
Sbjct: 551 PETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRK 610

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDF- 496
           A + +P +   Y  +     K G + E+  +F + +  +P +  V      +  ++ ++ 
Sbjct: 611 AIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYP-INAVLICCCGVALEKLEYQ 669

Query: 497 DTAIKQYDIAKRLEEVQEKIHVGIGPLI---GKATILARQSSQDPTQLDEE--------- 544
           D A++ Y++A  L+            L+   G+   LA QS ++ ++L  E         
Sbjct: 670 DKALEYYELACTLQPNSNLARFKRANLLYAMGRYN-LALQSFEELSKLTPEEPTVHFVLG 728

Query: 545 -------KFNAAIKLLTKACELDPRSEQ 565
                  + N AI+  T A  LDP+  Q
Sbjct: 729 QLYQIMGRKNEAIREFTVAMNLDPKGNQ 756

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 380 SYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQ 439
           ++  +     + +NSQ   + ++ AVD+NP     +Y  GQ Y +L  +  +   FQKA 
Sbjct: 473 AWTLMGHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKAC 532

Query: 440 SLNPENVYPYIQLACLLYKQGKFTES 465
           +L P +   +  LA    K G F ++
Sbjct: 533 TLKPLDKRMWQALASCYVKIGNFNDA 558

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G+ F   KN   AI+ Y++A++++P +   +  +   Y         + +  KA  +KP 
Sbjct: 478 GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 537

Query: 194 HSKALLRRASANESLGNFTDAM--FDLSV-LSLNGDFDGASIEPMLE 237
             +     AS    +GNF DA+  F+ ++ LS+N D D + +  + E
Sbjct: 538 DKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLLYKLAE 584

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 74/163 (45%), Gaps = 6/163 (3%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           N ++   +  ++++++ E   T+YH G+++ I  DY  A E FQ+A + +  N   +  +
Sbjct: 267 NPEKALNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSI 326

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEIL-TDRGDFDTAIKQYDIAKRLE 510
             L Y+  ++ ++ +A+    +L  P + EV      +  T       A+  Y  A RLE
Sbjct: 327 GVLYYQIYQYRDALDAYTRAIRLN-PYISEVWYDLGTLYETCNNQLTDALDAYKQAARLE 385

Query: 511 EVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLL 553
                I   +  L  +   L+ Q      +++ +K N  I L+
Sbjct: 386 PDNTHIRERLDALTNQ---LSTQQGNINQKIEYQKKNENIPLM 425

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G       ++N A + +Q A+  D   P+F+ +I   Y         ++  T+A+ + P 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 194 HSKALLRRASANESLGN-FTDAM 215
            S+      +  E+  N  TDA+
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDAL 375

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F++   F++ I  ++ A+++ PN+ + ++ + A   ++   E+ I+   KAL +KP   +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 197 ALLRRASANESLGNFTD-AMFDLSVLSL 223
           A    A ++ ++G + + A + L+ LS+
Sbjct: 520 ARYNLAVSSINIGCYKEAAQYLLTALSM 547

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 63/152 (41%), Gaps = 6/152 (3%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
            PNSY    + + +     E    F+ AV  NPE+   +   G +    +   N     +
Sbjct: 309 NPNSYEIGCILMENGAKLSEAALAFEAAVQENPEHVDAWLKLGLVQIQNEKEINGITALE 368

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNE-TKLKFPTLPEVPTFFAEILTDRGD 495
           K   L+P+N+     LA     +G    +    N   + ++P L E  T   E+ +D+  
Sbjct: 369 KCLKLDPKNLEAMKNLAISYVNEGYDVSAFTMLNRWIETRYPHLLE-NTHGIELDSDQDR 427

Query: 496 F---DTAIKQY-DIAKRLEEVQEKIHVGIGPL 523
           +   +   KQ+  +A +LE     + +G+G L
Sbjct: 428 YVVNEIVTKQFLQVANKLETADADVQLGLGLL 459

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 54/96 (56%), Gaps = 2/96 (2%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+    F++ I  ++ A+ ++PN+ + ++ + A   ++   E+ I+   KAL++KP   +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSLNGDFDGAS 231
           A    A ++ ++G + +A  + LS L ++ + +G S
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMH-EVEGVS 500

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 19/103 (18%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN----ISACYISTGDLEKVIEFTTKAL 188
           R    F  KNF  ++K +Q   EL  N PV   +    I AC+    D +  I    ++L
Sbjct: 203 RAKLLFRKKNFMASLKLFQ---ELLVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSL 259

Query: 189 EIKPDHS------------KALLRRASANESLGNFTDAMFDLS 219
           E+ P +             K L+   + +E   NF DAM DLS
Sbjct: 260 ELDPTNKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 11/105 (10%)

Query: 367 LLQESINLHPT---PNSYIFL--ALTLADKENSQEFFKFFQKAVDLNPEYPPT-YYHRGQ 420
           L Q+  NL  T   PN    L  A  L  K+N     K FQ+ +  NP   P      G 
Sbjct: 181 LQQDVTNLATTNASPNCMFLLLRAKLLFRKKNFMASLKLFQELLVNNPVLKPDPRIGIGA 240

Query: 421 MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES 465
            ++ L+DYK A   ++++  L+P N     ++ CLL   GKF ++
Sbjct: 241 CFWQLKDYKMAINAWERSLELDPTNKNS--KVLCLL---GKFHKT 280

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 61/133 (45%), Gaps = 19/133 (14%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++++P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 281 QKALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G            A+  Y  
Sbjct: 341 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQ 392

Query: 506 AKRLEEVQEKIHV 518
           A RL+   E IH+
Sbjct: 393 AARLD--PENIHI 403

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 92/220 (41%), Gaps = 19/220 (8%)

Query: 378 PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           P ++  +   L+ +++     K F+KA  L+P +   Y  +G  +       +AK  ++K
Sbjct: 545 PETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRK 604

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFD 497
           A + +P++   Y  L     K G++ E+  +F + +   P    +       L   G  +
Sbjct: 605 ALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKE 664

Query: 498 TAIKQYDIAKRLEEVQEKIHVGIGPLIGKATI--LARQSSQDPTQLDEEKFNA------- 548
             ++ Y++A +L+         +G L+   T   +A Q+ ++  +L  +   A       
Sbjct: 665 KVLQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQT 724

Query: 549 ---------AIKLLTKACELDPRSEQAKIGLAQLKLQMEK 579
                    A+K LT A  LDP+  Q  I   Q K  M++
Sbjct: 725 YRIVGRKKDAVKELTVAMNLDPKGNQVVIDELQ-KCHMQE 763

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 83/211 (39%), Gaps = 22/211 (10%)

Query: 384 LALTLADKENSQEFFKFFQKAV--DLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSL 441
           L L  + + NS +  + F+  +   +    P      G+++F + +Y  + + F + + L
Sbjct: 447 LILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDL 506

Query: 442 NPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIK 501
            P  V      + LL+      +S    N      P  PE       +L+ + D D AIK
Sbjct: 507 QPARVKDMEIYSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIK 566

Query: 502 QYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNAAIKLLTKACEL 559
            ++ A +L+           P    A  L     SS D +       ++A     KA   
Sbjct: 567 AFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKALAC 608

Query: 560 DPRSEQAKIGLAQLKLQMEKIDEAIELFEDS 590
           DP+   A  GL    +++ + +EA+  FE +
Sbjct: 609 DPQHYNAYYGLGTSSMKLGQYEEALLYFEKA 639

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++++ +   T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 294 QKALGYLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 353

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G          + A+  Y  
Sbjct: 354 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLNDALDAYKQ 405

Query: 506 AKRLEEVQEKIHV 518
           A RL+   E IH+
Sbjct: 406 AARLDP--ENIHI 416

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%)

Query: 379 NSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKA 438
           +++  +     + +NSQ   + +++AVD+NP     +Y  GQ Y +L  +  +   FQKA
Sbjct: 444 SAWTLMGHEFVELKNSQAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 503

Query: 439 QSLNPENVYPYIQLACLLYKQGKFTES 465
            +L P +   +  LA    K G   +S
Sbjct: 504 CTLKPLDKRMWQALASCYAKVGNIRDS 530

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 83/203 (40%), Gaps = 16/203 (7%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP----VFYSNISACYISTGDLEKVIE 182
           A   KN+GN  + AK F +A + Y   IE+  ++       Y+N +AC +   +  + + 
Sbjct: 78  AGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLN 137

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 242
               AL+  P + K   R   A  +L    +A   +    L  D     ++ +L+  L K
Sbjct: 138 DCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKK 196

Query: 243 QAMKVLNENLSKDEGR----GSQVLPSNT-SLASFFGIFDSH----LEVSSVNTSSNYDT 293
           Q  K   +N  K++ +    G Q++  N   L     +  +     +  + V+     D 
Sbjct: 197 QEAKK-EQNSKKEQEKQIREGMQIILENAMKLRKIINVKSNESPEIVRDAKVSLEDPVDC 255

Query: 294 AYALLSDALQRLYSATDEGYLVA 316
              L+  AL  LY  TDE   VA
Sbjct: 256 ESQLIFPALV-LYPTTDEFDFVA 277

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYI 172
           +LK +GN  +  +++  A+++Y   +E D   P+ +SN + C I
Sbjct: 6   RLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLI 49

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 2/111 (1%)

Query: 112 IAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACY 171
           I ++  + PS+  ++  ++   G  +   +   EAI+++Q A+ LD  +   +  +   Y
Sbjct: 655 IVEMGDVKPSKLCSWPYRV--LGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAY 712

Query: 172 ISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLS 222
              G +   +    KALE+ P H  A    A++   +G F   +  LSVL+
Sbjct: 713 SVCGRIAASVNVYEKALELNPKHKFARYLLAASLCQMGEFEKGIELLSVLN 763

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 7/139 (5%)

Query: 381 YIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQS 440
           Y  L +   +K+   E  ++FQ AV L+      +   GQ Y +      +   ++KA  
Sbjct: 671 YRVLGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALE 730

Query: 441 LNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT----LPEVPTFFAEILTD---R 493
           LNP++ +    LA  L + G+F +     +    ++P     L ++  F  +  TD   +
Sbjct: 731 LNPKHKFARYLLAASLCQMGEFEKGIELLSVLNEEYPLEEIFLVQLSGFLVDYSTDLHNQ 790

Query: 494 GDFDTAIKQYDIAKRLEEV 512
           G    +I     A RL EV
Sbjct: 791 GYLIKSIGTALKAVRLIEV 809

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 364 AQVLLQESINLHPT-PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMY 422
           A +  + ++ L+ T  N++  +     + +NS    + +++AVD+NP     +Y  GQ Y
Sbjct: 403 AIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAY 462

Query: 423 FILQDYKNAKEDFQKAQSLNP 443
            +L  +  A    QKA SL P
Sbjct: 463 EVLDRHLYALYYLQKACSLKP 483

>ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 101 DYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNR-----GNHFFTAKNFNEAIKYYQYAIE 155
           +Y  L N +      + L  S+R   A+Q  N      G  +   +    +I+++Q A+ 
Sbjct: 636 NYTELGNWQAARVVCERLVGSERAKRALQTVNWPFRVIGIAYLEGQQEANSIEWFQSALR 695

Query: 156 LDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215
           ++ ++   +  +   Y + G +E  I+   KA+E+  +H  A   +A +   +G F +A+
Sbjct: 696 VNQSDVEAWVGLGQAYYACGRIEASIKVFEKAIELDSEHHYAKYLKAQSLSLMGQFDEAI 755

Query: 216 FDLSVLS 222
             L+ L+
Sbjct: 756 DILNALT 762

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 4/119 (3%)

Query: 354  FHFLKNNLL--DAQVLLQESINLHP-TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPE 410
            +H LKN+     A    ++SI     T  S++ L +   D  N +     F K   + P+
Sbjct: 926  YHILKNDKFRDSAIASFKKSIQYQSNTVESWMGLGIATMDV-NYRVAQHCFIKCTAMAPK 984

Query: 411  YPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFF 469
                ++    +     D + A     K+QS+ P++  P++  A +L KQGK  ES   F
Sbjct: 985  EGSVWFDLALLALQNNDAEFALTVLNKSQSIAPQDSSPWLGNALILEKQGKIKESCRMF 1043

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G   F  + + +A+K Y   I+ +P  PV + N +A +       +VI+   KA+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 194 HSKALLRRASA 204
           + KA +R+  A
Sbjct: 496 YIKAYVRKGFA 506

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 404 AVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQ 459
            V+L P +   Y   G  Y  LQ    A+E+F+KA  LN +NV+   +LA + Y Q
Sbjct: 69  CVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNVHAKKELAYVKYLQ 124

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAI-ELDPNEPVFYSNISACYISTGDLEKVIEFTTKA 187
           +LK  GN  +  K + +A+ Y+  A+ +   N+ + YSN +A +I      + +E     
Sbjct: 10  ELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNC 69

Query: 188 LEIKPDHSKALLRRASA-------NESLGNFTDAM 215
           +E+ P+  K   R   A       +E+  NF  A+
Sbjct: 70  VELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 65/135 (48%), Gaps = 19/135 (14%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           + Q+   +  K+++++P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +
Sbjct: 285 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGD-FDT-------AIKQY 503
             L Y+  ++ ++ +A+    +L          + +E+  D G  ++T       A+  Y
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 396

Query: 504 DIAKRLEEVQEKIHV 518
             A RL+   + +H+
Sbjct: 397 RQASRLDP--DNVHI 409

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F++  ++++ +  ++ A+ + P++ + ++ + A   ++   E+ I+   KAL++KP   +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSLN 224
           A    A +  ++G F +A  + L+ LS++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 73/162 (45%), Gaps = 5/162 (3%)

Query: 351 TGIFHFL-KNNLLD-AQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLN 408
           T ++H   K NL D + +L+ E       P ++  +    + +++  E  + F KA  L+
Sbjct: 564 TLLWHLHDKTNLTDLSNILMDE---FRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLD 620

Query: 409 PEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAF 468
           P +   Y  +G  Y  +  Y  AK  ++KA S +  +   Y  +     K G++ ++  +
Sbjct: 621 PNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVY 680

Query: 469 FNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLE 510
           F + +   P+   +       +   G+ + A+  Y++A +++
Sbjct: 681 FEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQ 722

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 55/145 (37%), Gaps = 34/145 (23%)

Query: 400 FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVY------------ 447
           F++KA+  +  +   YY  G     L +Y+ A   F+KA+S+NP N              
Sbjct: 646 FYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKL 705

Query: 448 -------PYIQLAC---------------LLYKQGKFTESEAFFNETKLKFPTLPEVPTF 485
                   Y +LAC               LLY   K+T++   F E     P    V   
Sbjct: 706 GNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFI 765

Query: 486 FAEILTDRGDFDTAIKQYDIAKRLE 510
             ++    G    AIK+Y IA  L+
Sbjct: 766 LGQLYQIMGRKKDAIKRYTIAMNLD 790

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 118 LSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDL 177
           L P+   AY +Q    G+ + +  +++ A  +Y+ AI  D +    Y  +  C +  G+ 
Sbjct: 619 LDPNFVYAYTLQ----GHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEY 674

Query: 178 EKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215
           E+ + +  KA  I P ++  +       E LGN   A+
Sbjct: 675 EQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKAL 712

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 143 FNEAIKYYQYAIELDPNEPVFYSNISACYIST---GDLEKVIEFTTKALEIKPDHSKALL 199
           + +A+ Y++ A  ++P+  +    I  C ++    G+ EK + +   A +I+P  S A  
Sbjct: 674 YEQALVYFEKARSINPSNAIL---ICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKF 730

Query: 200 RRASANESLGNFTDAM 215
           +RA    S+  +T A+
Sbjct: 731 KRAHLLYSMAKYTQAL 746

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 82/211 (38%), Gaps = 19/211 (9%)

Query: 381 YIF-LALTLADKENSQEFFKFFQKAV--DLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           YIF L L  A + +S +  + F   +   +    P      G+++F + +YK + + F+K
Sbjct: 488 YIFALILKSASQFDSYKAIRLFDSKLPKQIKNNMPWCQAQLGKLHFEIVNYKTSLKYFKK 547

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFD 497
            + L P  +      + LL+     T      N    +F   PE       + + + D D
Sbjct: 548 LRLLQPTRIKDLETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSLQKDHD 607

Query: 498 TAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKAC 557
            AI+ +D A +L+           P    A  L     Q    L  + ++ A     KA 
Sbjct: 608 EAIRAFDKATKLD-----------PNFVYAYTL-----QGHEYLSMDSYDTAKTFYRKAI 651

Query: 558 ELDPRSEQAKIGLAQLKLQMEKIDEAIELFE 588
             D     A  G+    +++ + ++A+  FE
Sbjct: 652 SNDLHHYNAYYGMGMCSMKLGEYEQALVYFE 682

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 35/82 (42%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           GN F   K+ +EAI+ +  A +LDPN    Y+     Y+S    +    F  KA+     
Sbjct: 597 GNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLH 656

Query: 194 HSKALLRRASANESLGNFTDAM 215
           H  A       +  LG +  A+
Sbjct: 657 HYNAYYGMGMCSMKLGEYEQAL 678

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 91/220 (41%), Gaps = 19/220 (8%)

Query: 378 PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           P ++  +   L+ +++     K F+KA  L+P +   Y  +G  +       +AK  ++K
Sbjct: 551 PETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRK 610

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFD 497
           A + + ++   Y  L     K G++ E+  +F + +   P    +       L   G  +
Sbjct: 611 ALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKE 670

Query: 498 TAIKQYDIAKRLEEVQEKIHVGIGPLIGKATI--LARQSSQDPTQLDEEKFNA------- 548
            A++ Y++A  L+         +G L+   T   +A Q+ ++  +L  +   A       
Sbjct: 671 KALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQT 730

Query: 549 ---------AIKLLTKACELDPRSEQAKIGLAQLKLQMEK 579
                    AIK LT A  LDP+  Q  I   Q K  M++
Sbjct: 731 YRIVGRKKDAIKELTVAMNLDPKGNQVVIDELQ-KCHMQE 769

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 84/213 (39%), Gaps = 24/213 (11%)

Query: 384 LALTL--ADKENSQEFFKFFQKAV--DLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQ 439
           LAL L  + + NS +  + F+  +   +    P      G+++F + +Y  + + F + +
Sbjct: 451 LALILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLK 510

Query: 440 SLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTA 499
            L P  V      + LL+      +S    N      P  PE       +L+ + D D A
Sbjct: 511 DLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDIMPNKPETWCCIGNLLSLQKDHDAA 570

Query: 500 IKQYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNAAIKLLTKAC 557
           IK ++ A +L+           P    A  L     SS D +       ++A     KA 
Sbjct: 571 IKAFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKAL 612

Query: 558 ELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDS 590
             D +   A  GL    +++ + +EA+  FE +
Sbjct: 613 ACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKA 645

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 46/77 (59%)

Query: 138 FTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKA 197
           ++  +F++ ++ +Q A++++PN+ + ++ + A   ++   E+ I+   KA+ +KP   +A
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 198 LLRRASANESLGNFTDA 214
               A A+ ++G + +A
Sbjct: 512 RYNLAVASMNIGCYQEA 528

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%)

Query: 379 NSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKA 438
           N++  +     + +NS    + +++AVD+NP     +Y  GQ Y +L  +  A    QKA
Sbjct: 431 NAWTLMGHEFVETKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKA 490

Query: 439 QSLNP 443
            SL P
Sbjct: 491 CSLKP 495

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%)

Query: 396 EFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACL 455
           E  K  +KA  LNP++   Y  +G  Y     + NAK  ++KA ++NP +   +  L   
Sbjct: 456 EAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMS 515

Query: 456 LYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLE 510
             K G++ E+   F + +   P    +       L   G  + A+  Y +A  L+
Sbjct: 516 CIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQ 570

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 62/161 (38%), Gaps = 46/161 (28%)

Query: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENV-------------- 446
           ++KA+ +NP +   +Y  G     L  Y  A   F+KA+S+NP NV              
Sbjct: 495 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLG 554

Query: 447 -----YPYIQLAC---------------LLYKQGKFTESEAFFNETKLKFPTLPEVPTFF 486
                  + QLAC               LL+  G++  S A  N  KL+  T  E P  F
Sbjct: 555 RREKALDFYQLACELQPNSSLALFKKSQLLFNLGQY--SNALQNFEKLEQLTPNEAPVHF 612

Query: 487 --AEILTDRGDFDTAIKQYDIAKRLE--------EVQEKIH 517
              ++    G    AI Q+ IA  L+        E  EK H
Sbjct: 613 LLGQLYQIVGRKKDAITQFTIAMNLDPNGIQLVKEALEKCH 653

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 73/182 (40%), Gaps = 30/182 (16%)

Query: 414 TYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG-KFTESEAFFNET 472
           T+   G ++ + +D+  A +  +KA SLNP+  Y Y         QG +++ ++AF N  
Sbjct: 440 TWCCLGNLFSLNRDHDEAIKALKKATSLNPQFAYAYT-------LQGHEYSNNDAFDNAK 492

Query: 473 KLKFPTLPEVPTFF------AEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 526
                 L   P  +             G +D A+  ++ A+ +  V   ++   G  +  
Sbjct: 493 MCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCG--VAL 550

Query: 527 ATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIEL 586
             +  R+ + D  QL              ACEL P S  A    +QL   + +   A++ 
Sbjct: 551 ERLGRREKALDFYQL--------------ACELQPNSSLALFKKSQLLFNLGQYSNALQN 596

Query: 587 FE 588
           FE
Sbjct: 597 FE 598

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 400 FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNP 443
           F+Q A +L P      + + Q+ F L  Y NA ++F+K + L P
Sbjct: 562 FYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTP 605

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 4/92 (4%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPN----EPVFYSNISACYISTGDLEKVIE 182
           A   KN+GN  +  K F +A + Y   IE+  +        Y+N +AC +   +    I 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDA 214
               AL   P + K   R   A  ++  F  A
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa]
           {ON} YGR047C (TFC4) - transcription factor tau (TFIIIC)
           subunit 131 [contig 117] FULL
          Length = 1052

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 381 YIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHR--GQMYFILQDYKNAKEDFQKA 438
           Y  +A  LA  E  QE  +FF   +DLN EY      R   + Y  ++DY+NAK  F K 
Sbjct: 492 YFEVATALAKAERYQEAIEFFTPLLDLN-EYCTLEVFRMLSKCYKEVEDYENAKIIFGKL 550

Query: 439 QSLNPENVYPYIQLACLLYKQG 460
             + PE++   + LA + Y  G
Sbjct: 551 VEMTPEDLETKLTLAEIYYHLG 572

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVI 181
           A   K +GN  + AK F +A + Y   + ++      NE +F +N +AC +   +  K +
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLF-ANRAACELELKNYRKCV 141

Query: 182 EFTTKALEIKPDHSKALLR 200
           E   KAL I P + K   R
Sbjct: 142 EDCGKALTINPKNIKCYYR 160

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G ++   +   E+I+++Q A+ +D ++   +  +   Y + G +E  I+   +ALE+ P+
Sbjct: 667 GVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPE 726

Query: 194 HSKALLRRASANESLGNFTDAM 215
           H  A L  A +   L  F  ++
Sbjct: 727 HKYAGLFLAISLCQLSEFEKSL 748

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 379 NSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKA 438
           +++I +     + +NS    + +++A D+NP     +Y  GQ Y +L  +  A   FQKA
Sbjct: 438 HAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKA 497

Query: 439 QSLNP 443
            +L P
Sbjct: 498 CALKP 502

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++ +P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 281 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G            A+  Y  
Sbjct: 341 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQ 392

Query: 506 AKRLE 510
           A RL+
Sbjct: 393 AARLD 397

>Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 5/91 (5%)

Query: 115 LKGLSPSQRQAYAVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYIS 173
           ++ L P  R   ++QL N G H +   N NE AIK ++  +E +      + ++   Y+ 
Sbjct: 612 VRDLDPGSRTTISIQL-NLG-HTYRKLNENEIAIKCFKCVLEKNDKNSEVHCSLGYLYLK 669

Query: 174 TGDLEKVIEFTTKALEIKPDHSKA--LLRRA 202
           T  L+K I+   K+L +KP++  A  LL+ A
Sbjct: 670 TKKLQKAIDHLHKSLYLKPNNVSATTLLKNA 700

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
             +++  +     + +NS    + +++AVD+NP+    +Y  GQ Y +L+ +  +   FQ
Sbjct: 453 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQ 512

Query: 437 KAQSLNP 443
           KA SL P
Sbjct: 513 KACSLQP 519

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVI 181
           A   K +GN  +  K F +A + Y   I++       NE + Y+N +AC +   +  + I
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESL-YANRAACELEIKNYRRCI 139

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215
               +AL++ P + K   R A A  +L    +A+
Sbjct: 140 NDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++ +P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 283 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 342

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G            A+  Y  
Sbjct: 343 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQ 394

Query: 506 AKRLE 510
           A RL+
Sbjct: 395 AARLD 399

>Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]
           {ON} YHR166C (CDC23) - Cell division cycle protein
           [contig 160] FULL
          Length = 619

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
             +++  +     + +NS    + +++AVD+NP     +Y  GQ Y +L  +  +   FQ
Sbjct: 422 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 481

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTES 465
           K+ +L P +   +  LA    K G   ES
Sbjct: 482 KSCALKPLDKRMWQALASCYEKVGNAAES 510

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAI----ELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           + K+RG  +F   ++  A + Y+ ++    +L P   +  SN+ A  + TGD   +I  +
Sbjct: 399 EFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIS 458

Query: 185 TKALEIKPDHSK 196
           T AL++ P  SK
Sbjct: 459 TSALDLFPKESK 470

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++ +P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 279 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 338

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G            A+  Y  
Sbjct: 339 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQ 390

Query: 506 AKRLE 510
           A RL+
Sbjct: 391 AARLD 395

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 70/165 (42%), Gaps = 22/165 (13%)

Query: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC--LLYK 458
           +++A+  +P++   YY  G  Y  L  Y  A   F+KA+++NP NV   I + C  +  +
Sbjct: 539 YRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVALE 595

Query: 459 QGKFTESEAFFNETKLKFPTLPEVPTF-FAEILTDRGDFDTAIKQYDIAKRLEEVQEKIH 517
           +  + E    + E   +      +  F  A +L     +  A++ ++   +L   +  +H
Sbjct: 596 KLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVH 655

Query: 518 VGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPR 562
             +G L     I+ R+               A+K  T A  LDP+
Sbjct: 656 FLLGQLY---QIMGRKKD-------------AVKEFTVAMNLDPK 684

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 78/197 (39%), Gaps = 30/197 (15%)

Query: 405 VDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTE 464
           V+  P  P T+   G +Y + +D+++A + F+KA  ++    Y Y         QG    
Sbjct: 475 VETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTL-------QGHEHS 527

Query: 465 SEAFFNETKLKFP-TLPEVPTFF------AEILTDRGDFDTAIKQYDIAKRLEEVQEKIH 517
           S    +  K  +   L   P  +             G +D A+  ++ A+ +  V   + 
Sbjct: 528 SNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILI 587

Query: 518 VGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQM 577
              G  + K +              +EK   A++   +ACEL P S  AK   A L   M
Sbjct: 588 CCCGVALEKLSY-------------QEK---ALQYYEQACELQPSSSLAKFKKAHLLYSM 631

Query: 578 EKIDEAIELFEDSAILA 594
            +   A+E FE+ A LA
Sbjct: 632 ARYSAALENFEELAKLA 648

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 125 AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFT 184
           AYA  L+  G+   +  + + A   Y+ A+  DP     Y  +  CY+  G  +K + F 
Sbjct: 516 AYAYTLQ--GHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFF 573

Query: 185 TKALEIKP 192
            KA  I P
Sbjct: 574 EKARNINP 581

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 306 YSATDEGY-LVANDLLTKSTDMYHSLLSANTVDDPLRENA--ALALCYTGIFHFLKNNLL 362
           Y+ T +G+   +ND +  + + Y   L+     DP   NA   L +CY  +  + K    
Sbjct: 517 YAYTLQGHEHSSNDSIDTAKNCYRRALAC----DPQHYNAYYGLGMCYMKLGQYDK---- 568

Query: 363 DAQVLLQESINLHPTPNSYIFLALTLADKENSQE-FFKFFQKAVDLNPEYPPTYYHRGQM 421
            A +  +++ N++P     I       +K + QE   +++++A +L P      + +  +
Sbjct: 569 -ALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKKAHL 627

Query: 422 YFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
            + +  Y  A E+F++   L P+    +  L  L    G+
Sbjct: 628 LYSMARYSAALENFEELAKLAPDEATVHFLLGQLYQIMGR 667

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP----VFYSNISACYISTGDLEKVIE 182
           A   KN+GN  +  K F +A   Y   IE+  ++     +   N +AC +   +  + I 
Sbjct: 77  AENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCIN 136

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDA 214
              +AL++ P + KA  R   A   L    +A
Sbjct: 137 DCREALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F++  ++++ +  ++ A+ + P++ + ++ + A   ++   E+ I+   KAL++KP   +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 197 ALLRRASANESLGNFTDAM-FDLSVLSLN 224
           A    A +  ++G + +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDP-NEP---VFYSNISACYISTGDLEKVIEFT 184
           + +NRG  +F   ++  + + Y+ ++   P N P   + YSNI A  +  G+  K ++ +
Sbjct: 405 EFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNS 464

Query: 185 TKALEIKPDHS 195
           + ALE+ PD +
Sbjct: 465 SSALEMFPDDT 475

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+   +  K+++ +P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  
Sbjct: 273 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 332

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G            A+  Y  
Sbjct: 333 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQ 384

Query: 506 AKRLE 510
           A RL+
Sbjct: 385 AARLD 389

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar to
            uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
            dsRNA virus protection family member contains 8 copies of
            the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%)

Query: 401  FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
            F KA+ LN     ++Y    +     D   A++   KAQS+ PE+   ++ LA +  K+G
Sbjct: 975  FIKAIALNSRETGSWYCMAMLALSNNDTDLARDILMKAQSIAPEDSQSWLGLALIYEKEG 1034

Query: 461  KFTESEAFF 469
              T+S   F
Sbjct: 1035 LATDSARMF 1043

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 17/95 (17%)

Query: 117 GLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGD 176
           G+S  +RQ YA                 E+I+++Q +I +  ++   +  +   Y++ G 
Sbjct: 676 GMSCLERQLYA-----------------ESIEWFQSSIRVSSSDVESWVGLGQAYLNCGR 718

Query: 177 LEKVIEFTTKALEIKPDHSKALLRRASANESLGNF 211
           +E  I+   K LE+  +H  A    A A  +LG F
Sbjct: 719 VEASIKVFKKVLELDENHHFAWYFLAIALSALGEF 753

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 122/328 (37%), Gaps = 56/328 (17%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIE--LDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIK 191
           G+ +    +  +A   YQ A+    DPN P  +  I   Y   G L+   E   K L++ 
Sbjct: 239 GHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHGIGILYDRYGSLDFAEEAFKKVLDLD 298

Query: 192 PDHSKA---LLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVL 248
           P+  KA     R     +  G + +A+  L+ +            P+ E ++  Q   +L
Sbjct: 299 PNFEKANEIYFRLGIIYKHKGRWNEAIESLNCIL------KRPPPPLTESDIWFQIGNIL 352

Query: 249 NENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSA 308
                                  + G  D++  VS  N S+        L   L  LYS 
Sbjct: 353 ENKF------------------DWNGAKDAYEHVSKNNNSN------PKLLKQLGCLYSM 388

Query: 309 TDEGYL---VANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQ 365
            +  +    +A   L KS ++           DP     +    Y G  H  K +   A 
Sbjct: 389 ENVEFYNLDIAMGHLVKSLEL-----------DPTD---STTWYYLGRIHMAKKDFTAAY 434

Query: 366 VLLQESINLHP-TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFI 424
             LQ+++N     P  +  + +       + +    + +A+ LNP     +Y+ G +Y  
Sbjct: 435 ESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYET 494

Query: 425 LQD-YKNAKEDFQKAQSLNPENVYPYIQ 451
             D   +A + +++A SL+PEN  P IQ
Sbjct: 495 CNDQITDALDSYERALSLDPEN--PVIQ 520

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 60/134 (44%), Gaps = 13/134 (9%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G      K+F  A +  Q A+  D   P+F+ +I   Y   G     ++  T+A+ + P 
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPY 480

Query: 194 HSKALLRRASANESLGN-FTDAMFDLS-VLSLNGDFDGASIEPMLERNLNKQAMKVLNEN 251
            S+      +  E+  +  TDA+      LSL+ +       P+++  LN  A+K+ ++ 
Sbjct: 481 ISEVWYNLGTLYETCNDQITDALDSYERALSLDPE------NPVIQGRLN--ALKIQDK- 531

Query: 252 LSKDEGRGSQVLPS 265
             K E   + V+PS
Sbjct: 532 --KSEYDPNNVVPS 543

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 403 KAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKF 462
           K+++L+P    T+Y+ G+++   +D+  A E  Q+A + +  N   +  +  L Y+ G+ 
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 463 TES-EAFFNETKLKFPTLPEV 482
            ++ +A+    +L  P + EV
Sbjct: 465 HDALDAYTRAIRLN-PYISEV 484

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 7/121 (5%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVI 181
           A   KN+GN  + A+ + +A + Y   +E+       NE +F  N +AC +   +  + I
Sbjct: 80  AENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFL-NRAACELELKNHRRCI 138

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLN 241
               +AL   P + K   R   A  SL    +A   +    L  D + A++  +L++ + 
Sbjct: 139 NDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLDKIVK 197

Query: 242 K 242
           K
Sbjct: 198 K 198

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/78 (20%), Positives = 42/78 (53%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F+    F++ I  ++ A+ + PN+   ++ + A   ++   E+ I+   +A+++KP   +
Sbjct: 431 FYANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVR 490

Query: 197 ALLRRASANESLGNFTDA 214
           A    A ++ ++G + +A
Sbjct: 491 ARYNLAVSSMNIGCYKEA 508

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 19/114 (16%)

Query: 414 TYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES-EAFFNET 472
           T+YH G+++ I  DY  A + FQ+A + +  N   +  +  L Y+  ++ ++ +A+    
Sbjct: 287 TWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAI 346

Query: 473 KLKFPTLPEVPTFFAEILTDRGD-FDT-------AIKQYDIAKRLEEVQEKIHV 518
           +L          + +E+  D G  ++T       A+  Y  A RL+   E +H+
Sbjct: 347 RLN--------PYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--ENVHI 390

>TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3.5
           YOL145C
          Length = 1077

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 102/241 (42%), Gaps = 42/241 (17%)

Query: 373 NLHPTPNSYIFLAL---TLADKENSQEFFKFFQKAVDLNPEYPPT-YYHRGQMYFILQDY 428
           N   T  + +FL L    L  K+N     +FFQ+ + LNP   P      G  ++ L+D+
Sbjct: 174 NGRTTKTNCLFLLLRAKILYQKKNYSASLRFFQELLVLNPVLKPDPRIGIGMCFWQLKDH 233

Query: 429 KNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES-------EAF---FNETKLKFPT 478
             A + + +A+ ++PEN     + A +L   G F  S       E F   ++E  L    
Sbjct: 234 SMAVKSWSRAKEIDPEN-----KTASILVLLGDFHNSLTNSENDEQFKKQYSEAILNLEN 288

Query: 479 L-------PEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILA 531
           L       P + T        +G++ + I  Y          EK  +G+  +    TIL+
Sbjct: 289 LYSGNKSNPVILTLLQSYFYFKGEYQSVIDIY----------EKKIMGMSSITAN-TILS 337

Query: 532 RQS---SQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFE 588
             S   ++    L++  +  A  +  ++ +    +  +K GL Q +++ + ++E I  FE
Sbjct: 338 EASFWCARSYYALND--YRKAFTMFQESLKKSEDNLLSKFGLGQTQIKNDLLEEGILTFE 395

Query: 589 D 589
           +
Sbjct: 396 N 396

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
             N++  +     +  NS    + +++AVD+N +    +Y  GQ Y +L  +  +   FQ
Sbjct: 425 CTNAWTLMGHEFVELRNSHAAIECYRRAVDMNTKDFKAWYGLGQAYEVLDMHLYSLYYFQ 484

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTES 465
           KA +L P +   +  LA    K G   E+
Sbjct: 485 KACTLKPLDKRMWQALASCYAKVGNRQEA 513

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 59/133 (44%)

Query: 378 PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQK 437
           P ++  L    + + +  E  ++F+KA +++P +   Y  +G  +        AK  ++K
Sbjct: 509 PQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRK 568

Query: 438 AQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFD 497
           A + +P++   Y  L     K G++ E+  +F + +   P    +       L      +
Sbjct: 569 AIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQE 628

Query: 498 TAIKQYDIAKRLE 510
            A++ Y++A  L+
Sbjct: 629 KALQYYELASELQ 641

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           GN +   ++ +EAI+Y++ A E+DP+    Y+     + S   ++       KA+   P 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 194 HSKALLRRASANESLGNFTDAMF 216
           H  A          LG + +A+ 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALL 598

>KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}
           Anc_2.665 YKL022C
          Length = 780

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 114 QLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYIS 173
           + + L  + + A ++Q  N G+ +    ++  AIK ++Y +E    +   Y  +   Y+ 
Sbjct: 608 ETRELDSNSKTAISIQ-TNLGHTYKKLGDYEHAIKCFKYILEDSERDVDTYCTLGFLYLK 666

Query: 174 TGDLEKVIEFTTKALEIKPDHSKA--LLRRA 202
           T  L+K ++   +AL I+P +  A  +L RA
Sbjct: 667 TNQLQKAVDILHRALAIEPSNQNANEMLVRA 697

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
             +++  +     + +NS    + +++AVD+NP     +Y  GQ Y +L  +  +   FQ
Sbjct: 431 CTSAWTLMGHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 490

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTES 465
           KA +L P +   +  LA    K  K  ES
Sbjct: 491 KACALKPLDKRMWQALASCYEKLSKKDES 519

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
            Anc_7.546 YPR189W
          Length = 1430

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 377  TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
            +  S+I L ++  D  N +     F K++ L+P+    +++   +    +D   A++   
Sbjct: 981  STKSWIALGISTMDI-NWRVSQHCFIKSIALSPKDTEVWFNLSLLALKAKDLDFARQVLA 1039

Query: 437  KAQSLNPENVYPYIQLACLLYKQGKFTESEAFFN 470
            + QS+ P+   P++ +A LL K+G   ES   F+
Sbjct: 1040 RTQSIAPQESSPWLGMALLLEKEGNTQESINMFS 1073

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 25/125 (20%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP----VFYSNISACYISTGDLEKVIEFT 184
           + K+RG  FF A ++  A + Y+ ++   P       V YSN++A     G+ ++ +   
Sbjct: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334

Query: 185 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 223
             ALE+ P                        K + RRA A E + N+  A+ D   L  
Sbjct: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394

Query: 224 NGDFD 228
             +F+
Sbjct: 395 KNNFN 399

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 37/72 (51%)

Query: 144 NEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRAS 203
           +E+++++  A+ +DPN+   +  +   Y + G +E   +   KA+EI P H  A    + 
Sbjct: 702 SESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEIDPLHLYAQYFNSL 761

Query: 204 ANESLGNFTDAM 215
           +   +G F + +
Sbjct: 762 SLAEMGCFEECI 773

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 372 INLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNA 431
           + L  T   Y  + +   +++   E  ++F  A+ ++P    ++   GQ YF     + +
Sbjct: 679 MELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEAS 738

Query: 432 KEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES-EAFFNETKL 474
            + F+KA  ++P ++Y     +  L + G F E  E   N T+L
Sbjct: 739 TKVFEKAIEIDPLHLYAQYFNSLSLAEMGCFEECIEILKNITQL 782

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 403  KAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKF 462
            KA    P+   T+++   +     D   A E   + QSL+PE+  P++ +  ++ + GK 
Sbjct: 993  KAASFAPKDIRTWFNLAILGLKKNDIDFAHEVLTRTQSLSPESTDPWLGIGLIMEQIGKR 1052

Query: 463  TES 465
            TES
Sbjct: 1053 TES 1055

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%)

Query: 379 NSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKA 438
           +++  +     + +NS    + +++AVD+NP     +Y  GQ Y +L  +  +   FQKA
Sbjct: 488 SAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 547

Query: 439 QSLNP 443
            +L P
Sbjct: 548 CALKP 552

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 2/67 (2%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE- 189
           K  GN  F    + EA+  Y   I   P  PV YSN +   I   +    I+   + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 190 -IKPDHS 195
            + P+H+
Sbjct: 72  ALGPEHA 78

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 406 DLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES 465
           +++P    T+YH G+++ I  DY  A + FQ+A + +  N   +  +  L Y+  ++ ++
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 466 -EAFFNETKLKFPTLPEV 482
            +A+    +L  P + EV
Sbjct: 367 LDAYTRAIRLN-PYISEV 383

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIEL--DPNEPVFYSNISACYISTGDLEKVIEFTTKALEIK 191
           G+ +    +   A   YQ A+    +PN P  +  I   Y   G LE   E   K LE+ 
Sbjct: 138 GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLEYAEEAFAKVLELD 197

Query: 192 PDHSKA---LLRRASANESLGNFTDAM 215
           P+  KA     R     +  G +T A+
Sbjct: 198 PNFEKANEIYFRLGIIYKHQGKWTQAL 224

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 43/78 (55%)

Query: 137 FFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSK 196
           F++   F++ I  ++ A+ + P + + ++ + A   ++   E+ I+   KAL++KP   +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 197 ALLRRASANESLGNFTDA 214
           A    A ++ ++G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 95/248 (38%), Gaps = 43/248 (17%)

Query: 346 LALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKE--NSQEF---FKF 400
           +A C  G  H L  +  +A     ++I L P    +   A TL   E  N+  F      
Sbjct: 493 IAWCSMGNLHSLNKDHDEAITAFGKAIQLDP----FFAYAYTLQGHEYSNNDAFDNAKSC 548

Query: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460
           F+KA+ +   +    Y  G     L  ++ A   F+KA++LNP NV   I   C      
Sbjct: 549 FRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNV---ILNCCCGVALE 605

Query: 461 KFTESEAFFNETKLKFPTLPEVPTFF---AEILTDRGDFDTAIKQYDIAKRLEEVQEKIH 517
           +  + E   N  +L     P         +++L + G + +A+  ++  + L   +  +H
Sbjct: 606 RLQQPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVH 665

Query: 518 VGIGPL---IGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLK 574
             +G L   +GK         QD           A+   T A  LDP+  Q       +K
Sbjct: 666 FLLGNLYQIVGK--------KQD-----------AMNQYTIAMNLDPKGSQL------IK 700

Query: 575 LQMEKIDE 582
             MEK  E
Sbjct: 701 EAMEKCHE 708

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 119 SPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLE 178
           S SQ Q   ++     +H  T++  N+ + + +Y   LD        NI ACY    DL+
Sbjct: 47  SYSQEQIVRIR---SAHHLDTSRPDNKRLYHPKYIKILD--------NICACYEKLDDLK 95

Query: 179 KVIEFTTKALEIKPDHSKALLR 200
             +  + K+L++ PD++K  +R
Sbjct: 96  SCLSISQKSLKLDPDNAKCYIR 117

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 33/68 (48%)

Query: 142 NFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRR 201
           N    + Y   ++   P       N++AC+    DL++ + ++ K ++++P + K  +RR
Sbjct: 48  NVGAVVSYNDKSLTHHPRYIKLLDNLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRR 107

Query: 202 ASANESLG 209
               + LG
Sbjct: 108 GKVLQKLG 115

>TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1059

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 96/230 (41%), Gaps = 38/230 (16%)

Query: 381 YIFL-ALTLADKENSQEFFKFFQKAVDLNPEYPPT-YYHRGQMYFILQDYKNAKEDFQKA 438
           ++FL A  L  K+N     + FQ+ + +NP   P      G  ++ L+DYK A   +++A
Sbjct: 185 FLFLRAKLLYQKKNYAASLRSFQELLVINPVIQPDPRIGIGLCFWQLKDYKIAIASWKRA 244

Query: 439 QSLNPENVYPYIQLACLLYKQGKFTES------EAFFNETKLKFPTLPEVPTFFAE---- 488
             LNP N     Q A +L   G F ES      +  F ET  K   L  +   F+E    
Sbjct: 245 HELNPNN-----QSAAILVLLGDFHESLVTSENDTVFQETYSK--VLQNLNGLFSEDREN 297

Query: 489 --ILT-------DRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPT 539
             +LT        +GD++  I  Y         + KI  GI   +    +          
Sbjct: 298 PVLLTLLEVYFYLKGDYNKVIDIY---------ESKIK-GISTTVTSTVLSESLFWCGRA 347

Query: 540 QLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFED 589
               E +  A  +  ++ + +  +  AK G+ Q +++ + ++E+I  FE+
Sbjct: 348 YYALEDYRKAFTMFQQSLKQNEDNMLAKFGVGQTQVKNKLVEESILTFEN 397

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 6/93 (6%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP-----NEPVFYSNISACYISTGDLEKVI 181
           A   KN+GN  + AK + +A + Y   I++       NE +F SN +AC +   +  + +
Sbjct: 78  AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLF-SNRAACELELKNYRRCV 136

Query: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDA 214
               +AL+    + K   R A A   L    DA
Sbjct: 137 NDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} similar
           to uniprot|P89105 Saccharomyces cerevisiae YOL145C CTR9
           Component of the Paf1p complex which is a large complex
           that binds to and modulates the activity of RNA
           polymerase II and is required for expression of a subset
           of genes including cyclin genes contains TPR repeats
          Length = 1096

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 374 LHPTPNSYIFL--ALTLADKENSQEFFKFFQKAVDLNP-EYPPTYYHRGQMYFILQDYKN 430
           +   PNS   L  A  L  K+N     + FQ+ + +NP  YP      G  ++ L+DYK 
Sbjct: 176 IQSKPNSMFLLLRAKLLYQKKNYMASLRAFQELLVINPVMYPDPRIGIGMCFWQLKDYKL 235

Query: 431 AKEDFQKAQSLNPEN 445
           A   +++A  LNP N
Sbjct: 236 AIAAWKRALELNPVN 250

>NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3.5
           YOL145C
          Length = 1087

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 96/222 (43%), Gaps = 39/222 (17%)

Query: 391 KENSQEFFKFFQKAVDLNPEYPPT-YYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPY 449
           K+N     K FQ+ +  NP   P      G  ++ L+DYK A + +++A  L+  +    
Sbjct: 200 KKNYVASLKLFQELLVSNPVLKPDPRIGIGACFWHLKDYKMAIKSWERATQLDANSS--- 256

Query: 450 IQLACLLYK-QGKFTESEAFFNETKLK---------FPTL------------PEVPTFFA 487
             + CLL K     TESE   N+T+ K           TL            P + T   
Sbjct: 257 ASILCLLGKFHNSLTESE---NDTQFKENYTASLMDLNTLYNDTNHPENKENPVLLTLLQ 313

Query: 488 EILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFN 547
                + DF+  +K YD     E+++    +    ++ ++T+   ++      LD+  + 
Sbjct: 314 SYFYYKNDFENVLKIYD-----EKIKPISTLVADSILSESTLWCGRAYY---ALDD--YR 363

Query: 548 AAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFED 589
            A  +  ++ + +  +  AK+GL Q +L+   ++E+I  FE+
Sbjct: 364 KAFAMFQESLKTNEENLLAKLGLGQAQLKTNLLEESILTFEN 405

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYI 172
             K+ GN  F    ++ AI+ Y+  I L+P   V YSN++  Y+
Sbjct: 37  HFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYL 80

>CAGL0J02134g Chr10 complement(212192..215047) [2856 bp, 951 aa]
           {ON} similar to uniprot|P40559 Saccharomyces cerevisiae
           YIL002c INP51
          Length = 951

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 24/168 (14%)

Query: 464 ESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPL 523
           ES  +F+E  ++FP     PT+          FD   +QYD +++L     +I      +
Sbjct: 757 ESFPYFHEMPIEFP-----PTY---------KFDPGTRQYDTSEKL-----RIPAWTDRI 797

Query: 524 IGKATILARQS---SQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKI 580
           +G+  +L + +   + D    D    +A         +   ++E + +   +L  ++E  
Sbjct: 798 LGRGDVLRQLTYTYAPDVLFSDHRPVSAVFSANVTVVDEKKKAELSSVIHTKLMERLEGC 857

Query: 581 DE--AIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKM 626
           DE   IE+  D       +D+++   T   A   QKR R  P  S+++
Sbjct: 858 DEDERIEILNDGNFKLNELDDEISNITNMNAKPEQKRARKLPPPSSEI 905

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 28/71 (39%)

Query: 131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEI 190
           K  GN  F   ++  A K+Y   I  +P  P+ YSN +   I     ++ I      L  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 191 KPDHSKALLRR 201
             D     ++R
Sbjct: 67  SSDPEHEAIKR 77

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 48/126 (38%), Gaps = 9/126 (7%)

Query: 108 GEPDIAQLKGLS-PSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIEL----DPNEPV 162
           G  ++  LK L+   +    A   KN+GN  +  K + +A   Y   IE+    D     
Sbjct: 59  GNVELEALKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGS 118

Query: 163 FYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDL 218
            Y N +AC +   +    I    KAL       KA  R   A   L    +A    +F L
Sbjct: 119 LYLNRAACELELRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGL 178

Query: 219 SVLSLN 224
            + S N
Sbjct: 179 KLDSQN 184

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 51/114 (44%), Gaps = 19/114 (16%)

Query: 414 TYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES-EAFFNET 472
           T+YH G+++ +  DY  A + FQ+A + +  N   +  +  L Y+  ++ ++ +A+    
Sbjct: 380 TWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAI 439

Query: 473 KLKFPTLPEVPTFFAEILTDRG--------DFDTAIKQYDIAKRLEEVQEKIHV 518
           +L          + +E+  D G          + A+  Y  A RL+     +H+
Sbjct: 440 RLN--------PYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP--NNVHI 483

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 378 PNSYIFL--ALTLADKENSQEFFKFFQKAVDLNPEYPPT-YYHRGQMYFILQDYKNAKED 434
           PN+   L  A  +  K+N     K FQ+ + +NP   P      G  ++ L+DYK A + 
Sbjct: 180 PNAMFILLRAKLMYQKKNYVASLKLFQELLVINPVLKPDPRIGIGMCFWQLKDYKLAIQA 239

Query: 435 FQKAQSLNPENVYPYIQLACLLYKQGKFTES 465
           +++A  L+P N     + A +L   GKF  S
Sbjct: 240 WERALQLDPNN-----KQASILVLLGKFHNS 265

>KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {ON}
           Anc_2.665 YKL022C
          Length = 704

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 127 AVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTT 185
           AV ++    H +     NE AI+ ++Y ++    +P  Y  +   Y+ T  L+K I+   
Sbjct: 552 AVSIQTNLGHTYRKLGDNERAIECFKYVLQDSEKDPDLYVTLGFLYLQTKQLQKGIDCLH 611

Query: 186 KALEIKPDHSKA 197
           +AL IKP  + A
Sbjct: 612 RALAIKPGMTSA 623

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 59/147 (40%), Gaps = 8/147 (5%)

Query: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNE----PVFYSNISACYISTGDLEKVIE 182
           A   K +GN  +  K +  A   Y+  IE++ N      + + N +AC +   +    I 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 183 FTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 242
              KAL   P + K   R A A  ++  + ++   +    L  D   +S+  +L+  + K
Sbjct: 134 DCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVDSRNSSLLNLLKTIIKK 192

Query: 243 QAMKV---LNENLSKDEGRGSQVLPSN 266
           Q  K    L     K E  G  ++  N
Sbjct: 193 QEEKTAYRLKLEREKQEKEGKMIILEN 219

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 61/135 (45%), Gaps = 19/135 (14%)

Query: 393 NSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQL 452
           N+Q       K+++++     T+YH G+++ +  DY  A + FQ A + +  N   +  +
Sbjct: 297 NTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 356

Query: 453 ACLLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGD-FDT-------AIKQY 503
             L Y+  ++ ++ +A+    +L          + +E+  D G  ++T       A+  Y
Sbjct: 357 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 408

Query: 504 DIAKRLEEVQEKIHV 518
             A RL+     +H+
Sbjct: 409 KQAARLDT--NNVHI 421

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
           G       ++  A   +Q+A+  D   P F+ +I   Y         ++  T+A+ + P 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 194 HSKALLRRASANESLGN-FTDAM 215
            S+      +  E+  N  TDA+
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDAL 405

>NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72
          Length = 631

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
             +++  +     + +NS    + +++AVD+N      +Y  GQ Y +L  +  +   FQ
Sbjct: 435 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYFQ 494

Query: 437 KAQSLNPENVYPYIQLACLLYKQGKFTESEAFF 469
           KA +L P +   +  L     K G  TE+   F
Sbjct: 495 KACTLKPLDRRMWQALGTCYTKIGNKTEAIKCF 527

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 6/98 (6%)

Query: 166 NISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNG 225
           N +AC+   G+LEK +   TK   I+P + K  +R+    + L    DA         N 
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALRNA 158

Query: 226 DFDGASIEPMLERNLNKQAMKVL--NENLSKDEGRGSQ 261
           +F   S    L+ N++K  + ++   +NL KD+   S+
Sbjct: 159 NFATDS----LKINVSKTFIDIIVHQKNLVKDKILSSR 192

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 3/102 (2%)

Query: 94  AKSGEGFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNR--GNHFFTAKNFNEAIKYYQ 151
           A S  GF +     GE D A +   S + R    + L N   G  +        A +Y+ 
Sbjct: 468 APSWIGFSHTFALEGEHDQA-ISAYSTASRFFPGMHLPNLFLGMQYMALNTLTLAEEYFT 526

Query: 152 YAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193
            A ++ PN+P+  + +   +    DL+K   +  KALE   D
Sbjct: 527 LAYDIYPNDPLLLNEMGVLHFKKNDLQKSKRYLKKALEAAKD 568

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/125 (20%), Positives = 57/125 (45%), Gaps = 17/125 (13%)

Query: 395 QEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLAC 454
           Q+      K+++++     ++YH G+++ I  DY +A + FQ+A + +  N   +  +  
Sbjct: 341 QKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGV 400

Query: 455 LLYKQGKFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGDF--------DTAIKQYDI 505
           L Y+  ++ ++ +A+    +L          + +E+  D G          + A+  Y  
Sbjct: 401 LYYQIAQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQVNDALDAYKQ 452

Query: 506 AKRLE 510
           A RL+
Sbjct: 453 AARLD 457

>Kpol_1028.101 s1028 complement(221597..222760) [1164 bp, 387 aa]
           {ON} complement(221597..222760) [1164 nt, 388 aa]
          Length = 387

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 121 SQRQAYAVQLKNRGNHFFTAKNFN-EAIKYYQYAIELDPNEPVFYSNISACYISTGDLEK 179
           S+  ++ + L+ + N + T++N+N   IK Y       P EP  Y+N   C   +   E 
Sbjct: 30  SRTVSHEITLETKKNKYMTSRNYNPNLIKLYTVTKSFTPTEPFMYTNNRMCPFISVQKES 89

Query: 180 VIEFTT 185
           +++  +
Sbjct: 90  IVQIIS 95

>Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           T N++  +     +  NS    + +++AVD+ P     ++  GQ Y +L  +  +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 437 KAQSLNP 443
           KA +L P
Sbjct: 490 KACTLKP 496

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 362 LDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQM 421
           L  +VL Q+  N    P +Y+     L  K    + F    K  +  P+   T++  G  
Sbjct: 376 LCEKVLEQDEFNFDVLP-TYVQCLYELGGK---NKLFLVSHKLAESFPKSSVTWFAVGTY 431

Query: 422 YFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPE 481
           YF + +   A++ F KA  L+P   Y ++  A     +G+  ++ + ++     FP    
Sbjct: 432 YFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPG-TH 490

Query: 482 VPTFFAEILTDRGDFDTAIKQY 503
           +P  +  +   R D  T  ++Y
Sbjct: 491 LPHLYLGMQYSRMDTLTLAEEY 512

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192
           G ++F+  N  EA KY+  A  LDPN    +   +  Y   G+ E+ +   + A    P
Sbjct: 429 GTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFP 487

>Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           T N++  +     +  NS    + +++AVD+ P     ++  GQ Y +L  +  +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 437 KAQSLNP 443
           KA +L P
Sbjct: 490 KACTLKP 496

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 25/104 (24%)

Query: 133 RGNHFFTAKNFNEAIKYYQYAIELDP-NEP---VFYSNISACYISTGDLEKVIEFTTKAL 188
           RG+ FF   ++  A++ Y+ ++   P + P   + YSNI+A  +  G+   +++   KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 189 EIKPDH---------------------SKALLRRASANESLGNF 211
           ++ P                       SK +LR+A A E L NF
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>AFR663W Chr6 (1648116..1651232) [3117 bp, 1038 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR047C (TFC4)
          Length = 1038

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 371 SINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEY--PPTYYHRGQMYFILQDY 428
           S N     + Y  +A+ L   +  QE  +FF   +++ PEY  P  Y    + Y  ++DY
Sbjct: 458 SENFADIADLYFEVAVNLTKMDKFQEAIEFFVPLLEI-PEYQTPDLYKPLSKCYREVEDY 516

Query: 429 KNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461
           +NAK+   K   L PE++   + L  + Y+ G+
Sbjct: 517 ENAKDILIKLVELMPEDLESKLSLTEIHYRLGE 549

>KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar to
           uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 621

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
             +++  +     + +NS    + +++AVD+NP     +Y  GQ Y +L  +  +   FQ
Sbjct: 424 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 483

Query: 437 KAQSLNP 443
           K+ +L P
Sbjct: 484 KSCALKP 490

>Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           T N++  +     +  NS    + +++AVD+ P     ++  GQ Y +L  +  +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 437 KAQSLNP 443
           KA +L P
Sbjct: 490 KACTLKP 496

>YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}
           CDC23Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 626

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 377 TPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQ 436
           T N++  +     +  NS    + +++AVD+ P     ++  GQ Y +L  +  +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 437 KAQSLNP 443
           KA +L P
Sbjct: 490 KACTLKP 496

>TPHA0N01870 Chr14 (397082..399646) [2565 bp, 854 aa] {ON} Anc_2.665
           YKL022C
          Length = 854

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 115 LKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYIST 174
           +K L PS +   ++Q  N  N F     ++ AI+  +  +E+   +   Y  +   Y+  
Sbjct: 686 IKDLEPSSKIVISIQ-TNLSNTFRKLDEYDMAIRCLKNILEVSGKDANIYCLLGFLYLKV 744

Query: 175 GDLEKVIEFTTKALEIKPDHSKA--LLRRA 202
             L K IE+  ++L +KP +S A  +L+ A
Sbjct: 745 KKLPKAIEYLHQSLSLKPINSIAENILKHA 774

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 435 FQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNE-TKLKFPTLPEVPTFFAEILTDR 493
           ++ A+ L PE   P  + A LL+  GKF+ +   F   TKL  P    V     +I    
Sbjct: 646 YELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLS-PEEVTVHFMLGQIYQTM 704

Query: 494 GDFDTAIKQYDIAKRLEEVQEKI 516
           G    AIK+Y IA  L+ +  ++
Sbjct: 705 GRKKDAIKEYTIALNLDPMGNQV 727

>AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL162C
           (JJJ2)
          Length = 535

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 9/61 (14%)

Query: 154 IELDPNEPVFYSNISACYISTGDL----EKVIEFTTKALEIKPDHSKALLRRASANESLG 209
           IEL P  P F+ NI    +   D+    EK++EF TKA  +K    +AL  R+SA+E+L 
Sbjct: 428 IEL-PTMPSFHCNI----LDKSDIKLCREKILEFNTKANRLKKQLIQALSLRSSADEALE 482

Query: 210 N 210
           N
Sbjct: 483 N 483

>KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3.5
           YOL145C
          Length = 1076

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 42/94 (44%), Gaps = 8/94 (8%)

Query: 375 HPTPNSYIFL--ALTLADKENSQEFFKFFQKAVDLNPEYPPT-YYHRGQMYFILQDYKNA 431
            P  N    L  A  L  K+N     K FQ+ +  NP   P      G  ++ L+DY+ A
Sbjct: 187 QPKINCLFLLMRAKLLYQKKNYMASLKSFQELLVTNPVLKPDPRIGIGLCFWQLKDYQMA 246

Query: 432 KEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES 465
              +++A  L+PEN    I   CLL   GKF  S
Sbjct: 247 ISAWERALELDPENKTASI--LCLL---GKFHNS 275

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 10/104 (9%)

Query: 352 GIFHFLKNNLLDAQVLLQESIN----LHPTPNSYIFLALTLADK-----ENSQEFFKFFQ 402
           G+ +F +N+L  A+  L+ ++     L+PT  + + + + LA       EN +   K F+
Sbjct: 606 GVMYFKRNDLHKAKRYLKRALEAVKELNPTSRTSVSIQMNLAHAYRRLGEN-ERAIKCFK 664

Query: 403 KAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENV 446
             ++++ +   TY   G +Y   ++ + A +    A SL P N+
Sbjct: 665 TVLEVSSKDSDTYCSLGFLYLKTKELQRAIDHLHTALSLKPSNL 708

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 76/197 (38%), Gaps = 15/197 (7%)

Query: 392 ENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQ 451
           E  +E  K+F K+  L+P + P +      Y I  +   A   +  A    P    P + 
Sbjct: 511 EKIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAYSTAARFFPGIHLPNLF 570

Query: 452 LACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILT---DRGDFDTAIKQYDIAKR 508
           L         F+ +E +F    L + T P+ P    E+      R D   A K+Y + + 
Sbjct: 571 LGMQYMALNTFSLAEEYFT---LAYDTCPQDPLLLNEMGVMYFKRNDLHKA-KRY-LKRA 625

Query: 509 LEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKI 568
           LE V+E     + P    +  +    +    +L E +   AIK      E+  +      
Sbjct: 626 LEAVKE-----LNPTSRTSVSIQMNLAHAYRRLGENE--RAIKCFKTVLEVSSKDSDTYC 678

Query: 569 GLAQLKLQMEKIDEAIE 585
            L  L L+ +++  AI+
Sbjct: 679 SLGFLYLKTKELQRAID 695

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 3/93 (3%)

Query: 99  GFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNR--GNHFFTAKNFNEAIKYYQYAIEL 156
           GF +     GE D A +   S + R    + L N   G  +     F+ A +Y+  A + 
Sbjct: 536 GFAHTYAIEGEQDQA-ISAYSTAARFFPGIHLPNLFLGMQYMALNTFSLAEEYFTLAYDT 594

Query: 157 DPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189
            P +P+  + +   Y    DL K   +  +ALE
Sbjct: 595 CPQDPLLLNEMGVMYFKRNDLHKAKRYLKRALE 627

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 414 TYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTES-EAFFNET 472
           T+YH G+++ +  DY  A + FQ+A + +  N   +  +  L Y+  ++ ++ +A+    
Sbjct: 314 TWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAI 373

Query: 473 KLKFPTLPEVPTFFAEILTDRG 494
           +L          + +E+  D G
Sbjct: 374 RLN--------PYISEVWYDLG 387

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,355,180
Number of extensions: 2803971
Number of successful extensions: 11399
Number of sequences better than 10.0: 337
Number of HSP's gapped: 11229
Number of HSP's successfully gapped: 586
Length of query: 639
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 523
Effective length of database: 40,180,143
Effective search space: 21014214789
Effective search space used: 21014214789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)