Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YHR116W (COX23)2.153ON1511515646e-75
Smik_8.1942.153ON1291015141e-67
Skud_8.1772.153ON1301005123e-67
Suva_15.3132.153ON1321004863e-63
TDEL0B051502.153ON1191003542e-43
Ecym_82052.153ON1141003542e-43
KLTH0B05148g2.153ON111933533e-43
NDAI0B043302.153ON127933491e-42
CAGL0I02728g2.153ON111923472e-42
SAKL0E10934g2.153ON113933462e-42
Kwal_33.147762.153ON111933402e-41
KNAG0H035202.153ON1091003384e-41
ZYRO0G06534g2.153ON112943342e-40
KLLA0F24024g2.153ON122923325e-40
NCAS0B070002.153ON1081013193e-38
ABR130W2.153ON111923142e-37
Kpol_505.202.153ON112933133e-37
KAFR0F007302.153ON108982976e-35
TPHA0F018702.153ON180712767e-31
TBLA0B012402.153ON119901892e-18
TDEL0F051508.391ON15571670.97
ZYRO0F04642gsingletonON54923681.2
KLTH0H02552g6.284ON7738631.8
KAFR0D018505.205ON6327622.0
Suva_10.665.205ON7226622.1
Ecym_82875.205ON5827602.6
TBLA0C061305.205ON6727613.0
AAL161W5.205ON6426603.1
TDEL0A069806.284ON6847603.2
TDEL0F024204.105ON96128653.2
Zrou_YGOB_Anc_5.2055.205ON5027593.8
TDEL0C055203.415ON17269634.4
Smik_12.545.205ON6926587.0
YLL009C (COX17)5.205ON6926578.9
Kwal_56.243936.284ON10026599.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR116W
         (151 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   221   6e-75
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   202   1e-67
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   201   3e-67
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   191   3e-63
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   140   2e-43
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   140   2e-43
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   140   3e-43
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   139   1e-42
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   138   2e-42
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   137   2e-42
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   135   2e-41
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   134   4e-41
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   133   2e-40
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   132   5e-40
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   127   3e-38
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   125   2e-37
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   125   3e-37
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   119   6e-35
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   110   7e-31
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    77   2e-18
TDEL0F05150 Chr6 (965659..966126) [468 bp, 155 aa] {ON} Anc_8.39...    30   0.97 
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    31   1.2  
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    29   1.8  
KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}...    28   2.0  
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    28   2.1  
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    28   2.6  
TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {O...    28   3.0  
AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolo...    28   3.1  
TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {O...    28   3.2  
TDEL0F02420 Chr6 complement(449745..452630) [2886 bp, 961 aa] {O...    30   3.2  
Zrou_YGOB_Anc_5.205 Chr2 (819283..819435) [153 bp, 50 aa] {ON} A...    27   3.8  
TDEL0C05520 Chr3 (987444..987962) [519 bp, 172 aa] {ON} Anc_3.41...    29   4.4  
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    27   7.0  
YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}  C...    27   8.9  
Kwal_56.24393 s56 complement(979862..980164) [303 bp, 100 aa] {O...    27   9.1  

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  221 bits (564), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 118/151 (78%)

Query: 1   MEKPSPTRRQTSSLSTISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAASGPVTD 60
           MEKPSPTRRQTSSLSTIS                                 PAASGPVTD
Sbjct: 1   MEKPSPTRRQTSSLSTISNGMTMTNDNRDTTNTNSGSTSSNNSQPSSSSTPPAASGPVTD 60

Query: 61  RTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDY 120
           RTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDY
Sbjct: 61  RTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDY 120

Query: 121 DRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           DRSKCQEYFDAYRECKKQWLTARRKNRQQWE
Sbjct: 121 DRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  202 bits (514), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 98/101 (97%), Gaps = 1/101 (0%)

Query: 52  PAAS-GPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKL 110
           PA S GPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKL
Sbjct: 29  PATSKGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKL 88

Query: 111 SFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           SFQCLERNDYDRSKCQEYFDAYRECKKQWLTARR NRQQWE
Sbjct: 89  SFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  201 bits (512), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 94/100 (94%), Positives = 98/100 (98%)

Query: 52  PAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLS 111
           PA  GP+TDRTKVNYVPK++DPSSFQYYPDDPENP+NKYKFALKADSQYYDPCEESSKLS
Sbjct: 31  PAPRGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLS 90

Query: 112 FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE
Sbjct: 91  FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  191 bits (486), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 95/100 (95%)

Query: 52  PAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLS 111
           PA  GPVTDR+KVNYVP+S+DPSSFQYYPDDPENPVNKYKFALK DSQYYDPCEESSKLS
Sbjct: 33  PARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLS 92

Query: 112 FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           FQCLERN YDR+KCQ+YFDAYRECKKQWLTARR NRQQWE
Sbjct: 93  FQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  140 bits (354), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 80/100 (80%)

Query: 52  PAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLS 111
           P  +G V D +KV+Y PK  DPS FQYYP++PE+ VN+  FA+K  SQYYDPC+ES+++S
Sbjct: 20  PNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMS 79

Query: 112 FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
             CL+RNDY++  C+EYFDAYRECKKQWL +RR++R QWE
Sbjct: 80  LNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  140 bits (354), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%)

Query: 52  PAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLS 111
           P     VTD+TKVN+ P S+D S+FQ+YPDDPE  +N++KF  K  S YYDPCEESSK+S
Sbjct: 15  PPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMS 74

Query: 112 FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           F+CLE N+YDRS C +YFDAYRECKKQWL ARR++  +W+
Sbjct: 75  FKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  140 bits (353), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 63/93 (67%), Positives = 78/93 (83%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
            D+TKV+Y PK+ +  SF++YPD+PE+  NKY+FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMSMKCLELN 78

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           +YDRS CQEYFDAYRECKKQWL ARR+NR QWE
Sbjct: 79  NYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  139 bits (349), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 75/93 (80%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
           T +  VN+ P   D S+F+YYPDDPE  +NKYKF +K  S+YYDPC+ESS++SF+CL+RN
Sbjct: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           ++DR KC EYFDAYRECKKQWL ARR NR QW+
Sbjct: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  138 bits (347), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (84%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
           TD+ KV+Y PK  D + ++YYPD+PE+ +NKY+FA+K  SQYYDPC+ES+K+SF+CLE N
Sbjct: 19  TDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMSFKCLELN 78

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQW 150
           DYDR +C+EYFDAYRECKKQWL ARRK+R  W
Sbjct: 79  DYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  137 bits (346), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 81/93 (87%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
           TD+ KVN+ P+++D SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           +YDR  C+EYFDAYRECKKQWL +RR+NR QWE
Sbjct: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  135 bits (340), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 76/93 (81%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
            D++K++Y P+     S+++YPD+PE+  NK++FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLELN 78

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           DYDRS CQEYFDAYRECKKQWL ARRKNR QWE
Sbjct: 79  DYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  134 bits (338), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%), Gaps = 1/100 (1%)

Query: 52  PAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLS 111
           PA  G V+ +  V++ P   +P  F+Y+PD P++  +KYKF  K DS++YDPC+ESSK+S
Sbjct: 11  PAVEG-VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMS 69

Query: 112 FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           F CLE+NDYDRSKC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 70  FTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  133 bits (334), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 76/94 (80%)

Query: 58  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 117
           V +  KV+Y P+ D P  FQYYPD PE+ +++Y+FA+K  SQY+DPC+ESS++SF CL+R
Sbjct: 19  VVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDR 78

Query: 118 NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           N+YDR  C+EYFDAYRECKKQWL ARR+NR  WE
Sbjct: 79  NNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  132 bits (332), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 56/92 (60%), Positives = 78/92 (84%)

Query: 60  DRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERND 119
           ++TKVN+ P+  D +++++YPDDPE+ +N+Y+FA+K  S+YYDPC+ESSK+SF+CLE N+
Sbjct: 31  NKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSFKCLELNN 90

Query: 120 YDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           YDR  C +YFDAYRECKKQWL ARR+ R+ WE
Sbjct: 91  YDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  127 bits (319), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 78/101 (77%), Gaps = 1/101 (0%)

Query: 52  PAASGPVTDRTK-VNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKL 110
           P   G  ++R + VN+ P   +P S++Y+PDDP   +NKYKF +K DS+YYDPC+E S++
Sbjct: 7   PEEKGNNSNRKQDVNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSEM 66

Query: 111 SFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           S +CLERN +D+S+CQEYFDAYR+CKK W+  RR+NR+QWE
Sbjct: 67  SRKCLERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  125 bits (314), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
           TDR  VN+ P S D SSFQ+YPD+ E+P+ +Y+ A K  SQY DPC+ES+ +S +CLERN
Sbjct: 20  TDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSMKCLERN 78

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQW 150
           +YDR  C+EYFDAYRECKKQWL+ARRK+  QW
Sbjct: 79  NYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  125 bits (313), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 76/93 (81%), Gaps = 1/93 (1%)

Query: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118
           TD++KV++  K DD    ++YPD+PE+ + KY+F  K  SQYYDPC+ES+++SF CL+RN
Sbjct: 21  TDKSKVDFANK-DDKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRN 79

Query: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           +YD+SKC+ YFDAYRECKKQWL ARR++R QWE
Sbjct: 80  NYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  119 bits (297), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (79%), Gaps = 6/98 (6%)

Query: 58  VTDRTKVNYVPKSDDPSS----FQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQ 113
           VTD+TKVN+V   +DP +    F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+
Sbjct: 13  VTDKTKVNFV--QEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFK 70

Query: 114 CLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151
           CLE N+YDRS C++YFDAYRECKKQWL AR+ +R +WE
Sbjct: 71  CLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  110 bits (276), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 59/71 (83%)

Query: 76  FQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYREC 135
           F++YPD+PE+   KY+F  K  SQYYDPC+ES+K+SF+CL+ NDYDR KC+ YFDAYREC
Sbjct: 103 FKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCLDMNDYDRDKCRAYFDAYREC 162

Query: 136 KKQWLTARRKN 146
           KKQWL ARR N
Sbjct: 163 KKQWLRARRNN 173

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 77.4 bits (189), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 60/90 (66%), Gaps = 3/90 (3%)

Query: 60  DRTKVNYVPKSDD--PSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL-E 116
           D T V++V    D   ++FQY+PD P + + ++ FA K  S++YDPC ES+++S +C+ +
Sbjct: 28  DPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRCMTD 87

Query: 117 RNDYDRSKCQEYFDAYRECKKQWLTARRKN 146
             D  ++ C E+F AYR+CKK W+ A+++ 
Sbjct: 88  HPDDHKTVCAEFFAAYRDCKKAWIDAKKRG 117

>TDEL0F05150 Chr6 (965659..966126) [468 bp, 155 aa] {ON} Anc_8.391
           YLR245C
          Length = 155

 Score = 30.4 bits (67), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 11/71 (15%)

Query: 91  KFALKADSQYYDP--------CEESSKLSFQC---LERNDYDRSKCQEYFDAYRECKKQW 139
           K AL+A    Y P        C  +S L+F C   +E   Y  + C E     +    + 
Sbjct: 22  KLALEARELSYSPYSQFRVGCCLLTSSLTFVCGANVENASYGGAICAERTTIVKAVTSEN 81

Query: 140 LTARRKNRQQW 150
            T R +N+QQW
Sbjct: 82  STERDENKQQW 92

>ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} similar
          to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
          Plasma membrane multidrug transporter member of the
          major facilitator superfamily involved in efflux of
          fluconazole diazaborine benomyl methotrexate and other
          drugs
          Length = 549

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%)

Query: 67 VPKSDDPSSFQYY-PDDPENPVN 88
          VP+  DP   +Y  PDDPE PVN
Sbjct: 76 VPQQKDPFLVEYTGPDDPERPVN 98

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 28.9 bits (63), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 102 DPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQW 139
           DPC+  +     CL +  +D SKC    D+  EC  ++
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKF 40

>KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}
           Anc_5.205 YLL009C
          Length = 63

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 113 QCLERNDYDRSKCQEYFDAYRECKKQW 139
           QCL     D  KC+EY + YR C K +
Sbjct: 33  QCLLFKGADDGKCKEYIEKYRMCMKSF 59

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 28.5 bits (62), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 114 CLERNDYDRSKCQEYFDAYRECKKQW 139
           C+  N  D  KC+E+ D Y+EC K +
Sbjct: 39  CILFNGQDSDKCKEFIDKYKECMKGY 64

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
           Ashbya gossypii AAL161W
          Length = 58

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 113 QCLERNDYDRSKCQEYFDAYRECKKQW 139
           +CL  N  + +KC+E  D YR C K +
Sbjct: 28  ECLLFNGLESTKCKELVDKYRSCMKGY 54

>TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {ON}
           Anc_5.205 YLL009C
          Length = 67

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 113 QCLERNDYDRSKCQEYFDAYRECKKQW 139
           QC+  N  + +KC E+ + Y+EC K +
Sbjct: 37  QCILFNGQESTKCTEFINKYKECMKGY 63

>AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL009C (COX17)
          Length = 64

 Score = 27.7 bits (60), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 114 CLERNDYDRSKCQEYFDAYRECKKQW 139
           CL  N  D  KCQE    Y++C K +
Sbjct: 35  CLLFNGVDAVKCQELVQKYKDCMKGY 60

>TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {ON}
           Anc_6.284 YMR194C-B
          Length = 68

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 102 DPCEESSKLSFQCLERNDYDRSKCQEYFD-AYRECKKQWLTARRKNR 147
           DPC+  +     CL  +DY  SKCQ+  D  YR C K +    ++N+
Sbjct: 3   DPCKPEACAIQNCLISSDYKESKCQDLVDQLYRCCDKFYKEDGKENK 49

>TDEL0F02420 Chr6 complement(449745..452630) [2886 bp, 961 aa] {ON}
           Anc_4.105 YGL016W
          Length = 961

 Score = 29.6 bits (65), Expect = 3.2,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 64  VNYVPKSDDPSSFQYYPDDPENPVNKYK 91
           ++ +PK+D PSS  +Y    EN VN+YK
Sbjct: 739 LDQIPKADLPSSLPFYSYLLENLVNQYK 766

>Zrou_YGOB_Anc_5.205 Chr2 (819283..819435) [153 bp, 50 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 50

 Score = 27.3 bits (59), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 113 QCLERNDYDRSKCQEYFDAYRECKKQW 139
           QC+  N  D  KCQE+ + Y++C + +
Sbjct: 20  QCILFNGQDSGKCQEFVNKYKKCMQGY 46

>TDEL0C05520 Chr3 (987444..987962) [519 bp, 172 aa] {ON} Anc_3.415
           YPR101W
          Length = 172

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 62  TKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYD 121
           T+++Y+P  DD S+ + Y D+ EN + K    L+ +S  +    E++KL  Q L  N  D
Sbjct: 3   TRMDYLPFIDDDSNNERYRDEVENMIEK---ELRPESGLH---PEAAKLKIQ-LRENPLD 55

Query: 122 RSKCQEYFD 130
               +EY D
Sbjct: 56  NISLKEYRD 64

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
           YLL009C (REAL)
          Length = 69

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 114 CLERNDYDRSKCQEYFDAYRECKKQW 139
           C+  N  D  KC+E+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

>YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}
           COX17Copper metallochaperone that transfers copper to
           Sco1p and Cox11p for eventual delivery to cytochrome c
           oxidase; contains twin cysteine-x9-cysteine motifs
          Length = 69

 Score = 26.6 bits (57), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 114 CLERNDYDRSKCQEYFDAYRECKKQW 139
           C+  N  D  KC+E+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

>Kwal_56.24393 s56 complement(979862..980164) [303 bp, 100 aa] {ON}
           [contig 163] FULL
          Length = 100

 Score = 27.3 bits (59), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 114 CLERNDYDRSKCQEYFDAYRECKKQW 139
           CL +  YD SKC +  D   EC  ++
Sbjct: 38  CLTKTGYDESKCSQVIDQLYECCTKF 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,412,652
Number of extensions: 561276
Number of successful extensions: 1307
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1299
Number of HSP's successfully gapped: 47
Length of query: 151
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 51
Effective length of database: 42,014,799
Effective search space: 2142754749
Effective search space used: 2142754749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)