Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YHR112C5.423ON37837820260.0
Smik_8.1905.423ON42037819340.0
Skud_8.1735.423ON37837819110.0
Suva_15.3085.423ON37837819060.0
NDAI0B055905.423ON38037516490.0
NCAS0F032905.423ON40437516420.0
KAFR0E038605.423ON37837816230.0
CAGL0I01276g5.423ON38037315470.0
SAKL0G02222g5.423ON37837615400.0
TBLA0A036805.423ON38437314460.0
Kpol_1031.235.423ON37937814330.0
CAGL0K05665gsingletonON37937614120.0
KNAG0C049905.423ON38037713900.0
ZYRO0F09768g5.423ON37337413880.0
KLLA0E21319g5.423ON38037813780.0
ZYRO0F15664gsingletonON37337413760.0
NDAI0F00140singletonON37837713480.0
TBLA0B03020singletonON37937213390.0
KNAG0F01580singletonON37937513290.0
TDEL0G00140singletonON38137912681e-175
Ecym_55235.423ON38137612581e-173
TDEL0G04970singletonON38137912421e-171
NDAI0B00595singletonON37837712291e-169
AER250C5.423ON37437412171e-167
TPHA0A06070na 1ON37336012061e-165
KLTH0E16566g5.423ON38137111601e-158
Kwal_55.222215.423ON38037111361e-154
NDAI0H024007.97ON3934003655e-39
KAFR0K007607.97ON3924023542e-37
TPHA0L005707.97ON3914003505e-37
Kpol_1044.107.97ON3913963507e-37
NCAS0F015207.97ON4294013517e-37
Ecym_26297.97ON3923963481e-36
CAGL0H06369g7.97ON3914023462e-36
KLLA0F07909g7.97ON3913963402e-35
SAKL0B09614g7.97ON3923973359e-35
TDEL0H035307.97ON3913963243e-33
YAL012W (CYS3)7.97ON3944003227e-33
Smik_1.557.97ON3944003218e-33
AEL341W7.97ON3933973201e-32
TBLA0E022407.97ON3873983192e-32
Suva_1.567.97ON3953993173e-32
Skud_1.497.97ON3943983131e-31
KLTH0D02728g7.97ON3924013103e-31
KNAG0D047407.97ON3904003078e-31
ZYRO0D05742g7.97ON3913963061e-30
Skud_19.6singletonON4013872603e-24
CAGL0L06094g8.145ON4504032463e-22
Skud_7.888.145ON4654122447e-22
YGL184C (STR3)8.145ON4654122421e-21
Smik_7.898.145ON4654122392e-21
ACL059C8.145ON4532622313e-20
ZYRO0G19162g8.145ON4552822295e-20
Suva_7.798.145ON4654182296e-20
KLTH0E06644g8.145ON4603912271e-19
SAKL0H24882g8.145ON4593892261e-19
KLLA0C17028g8.145ON4604172252e-19
Suva_17.6singletonON4013952242e-19
Ecym_84058.145ON4722642252e-19
Kwal_47.172218.145ON4634152233e-19
Smik_7.375na 1ON4013542206e-19
NDAI0D028804.53ON4474472136e-18
TDEL0D06630singletonON4023542101e-17
TDEL0B046608.145ON4643882083e-17
KAFR0F030704.53ON4454422003e-16
NCAS0A058104.53ON4474562003e-16
KNAG0I029204.53ON4454381914e-15
TPHA0F004204.53ON4424381843e-14
YFR055W (IRC7)na 1ON3402931815e-14
ZYRO0G22198g4.53ON4454381782e-13
ADL031W4.53ON4674441747e-13
TBLA0C044004.53ON4454251711e-12
KLTH0G00418gsingletonON5682621712e-12
Kpol_1041.444.53ON4444401666e-12
Ecym_83654.53ON4443941659e-12
KLTH0D17930g4.354ON6522651669e-12
SAKL0H23892g4.53ON4423191641e-11
KLTH0D03652g4.53ON4444351641e-11
Suva_10.3974.53ON4443941622e-11
Smik_12.3834.53ON4443941622e-11
CAGL0D06402g4.53ON4424421594e-11
Skud_12.3844.53ON4443941595e-11
YLR303W (MET17)4.53ON4443941586e-11
TDEL0E05710singletonON5562551587e-11
SAKL0G18172g4.354ON6732601588e-11
AER164C4.354ON6453351579e-11
ZYRO0B08338g4.354ON6403041571e-10
NCAS0A062704.354ON6592731542e-10
Ecym_51694.354ON6812511543e-10
TPHA0L003304.354ON7172881533e-10
Kpol_1028.804.354ON6893331533e-10
Smik_10.4234.354ON6392591524e-10
Suva_12.2214.354ON6392571507e-10
KLLA0D04037g4.53ON4443901481e-09
YJR130C (STR2)4.354ON6394061481e-09
TDEL0E056204.53ON4464531471e-09
YML082W4.354ON6493021472e-09
Skud_10.3534.354ON6402581462e-09
Kwal_14.791na 2ON5712601462e-09
YLL058Wna 2ON5752591453e-09
Skud_12.10na 2ON5712581453e-09
TDEL0D006104.354ON6522711444e-09
Suva_13.684.354ON6882541436e-09
Suva_10.8na 2ON5722591426e-09
KLLA0B04378g4.354ON6882631401e-08
Smik_13.554.354ON6992521391e-08
Kwal_47.166444.354ON6523141382e-08
Kwal_26.74374.53ON4443061363e-08
Skud_13.594.354ON6492511364e-08
NDAI0D032604.354ON6962681347e-08
Smik_12.3na 2ON5662571283e-07
KAFR0B068304.354ON6673031284e-07
KNAG0M003304.354ON6312951213e-06
CAGL0M00550g4.354ON5692611186e-06
Kwal_26.7197singletonOFF8762890.002
KAFR0E043904.370ON1431116900.018
KAFR0E04410na 3ON1436116860.048
NDAI0F027002.171ON124132712.9
KLLA0B00242gsingletonON59047695.1
KLLA0D00231gsingletonON59047695.1
KLTH0H05324gna 4ON58647695.5
Kwal_26.71947.97ON152125657.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR112C
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   785   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   749   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   740   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   738   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   639   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   637   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   629   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   600   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   597   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   561   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   556   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   548   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   540   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   539   0.0  
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   535   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   534   0.0  
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                523   0.0  
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   520   0.0  
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   516   0.0  
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      493   e-175
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   489   e-173
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   483   e-171
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              478   e-169
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   473   e-167
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   469   e-165
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   451   e-158
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   442   e-154
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   145   5e-39
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   140   2e-37
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   139   5e-37
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   139   7e-37
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   139   7e-37
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   138   1e-36
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   137   2e-36
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   135   2e-35
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   133   9e-35
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   129   3e-33
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   128   7e-33
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   128   8e-33
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   127   1e-32
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   127   2e-32
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   126   3e-32
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   125   1e-31
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   124   3e-31
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   122   8e-31
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   122   1e-30
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...   104   3e-24
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...    99   3e-22
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    99   7e-22
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    98   1e-21
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    97   2e-21
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    94   3e-20
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    93   5e-20
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    93   6e-20
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    92   1e-19
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    92   1e-19
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    91   2e-19
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    91   2e-19
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    91   2e-19
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    91   3e-19
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    89   6e-19
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      87   6e-18
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    86   1e-17
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    85   3e-17
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    82   3e-16
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    82   3e-16
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    78   4e-15
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    75   3e-14
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    74   5e-14
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    73   2e-13
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    72   7e-13
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    70   1e-12
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    70   2e-12
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    69   6e-12
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    68   9e-12
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    69   9e-12
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    68   1e-11
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    68   1e-11
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    67   2e-11
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    67   2e-11
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    66   4e-11
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    66   5e-11
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    65   6e-11
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    65   7e-11
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    65   8e-11
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    65   9e-11
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    65   1e-10
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    64   2e-10
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    64   3e-10
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    64   3e-10
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    64   3e-10
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    63   4e-10
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    62   7e-10
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    62   1e-09
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    62   1e-09
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    61   1e-09
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    61   2e-09
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    61   2e-09
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    61   2e-09
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    60   3e-09
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    60   3e-09
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    60   4e-09
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    60   6e-09
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    59   6e-09
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    59   1e-08
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    58   1e-08
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    58   2e-08
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    57   3e-08
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    57   4e-08
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    56   7e-08
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     54   3e-07
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    54   4e-07
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    51   3e-06
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    50   6e-06
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    39   0.002
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    39   0.018
KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {...    38   0.048
NDAI0F02700 Chr6 (663106..666831) [3726 bp, 1241 aa] {ON} Anc_2....    32   2.9  
KLLA0B00242g Chr2 complement(9894..11666) [1773 bp, 590 aa] {ON}...    31   5.1  
KLLA0D00231g Chr4 complement(9854..11626) [1773 bp, 590 aa] {ON}...    31   5.1  
KLTH0H05324g Chr8 (472845..474605) [1761 bp, 586 aa] {ON} simila...    31   5.5  
Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W ...    30   7.8  

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 NDLIKDLASALKELQDAA 378
           NDLIKDLASALKELQDAA
Sbjct: 361 NDLIKDLASALKELQDAA 378

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/378 (95%), Positives = 369/378 (97%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MVDLST+LIHGDDKDNRVTDVAPPINVSTTFRYDDDDL+PWTERENLDFMEKKP+YSRLA
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPK+IFIGQSYHGVRAIANIL+RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           Y I+Q+PLEDIEK ASEGDIVHLE+PVNPYGTSSDIESLA RAHAKGALLIVDSTFASPP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQY WNFGADIVLYSATKYFGGHSDLLSGVLVVKEE TSRQLKDDRIYLGTNVANLESFM
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYEMRITKQSENATKLV+FLSDHQSEF KVLK IYHSSLQ EEFVKKQLVGGYG
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAITL TKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 361 NDLIKDLASALKELQDAA 378
           NDLIKDLASALKELQDAA
Sbjct: 403 NDLIKDLASALKELQDAA 420

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/378 (93%), Positives = 365/378 (96%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MV+LST LIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAI NIL RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           Y ++Q+PLEDIEK ASEGDIVHLESPVNPYGTS DIESLA RAH KGALLIVDSTFASPP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQYAWNFGAD+VLYSATKYFGGHSDLLSGVLVVK+EA SRQLKDDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYEMRITKQSENATKLV+FLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAI L+ KEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 NDLIKDLASALKELQDAA 378
            DLIKDL+SALKELQD A
Sbjct: 361 EDLIKDLSSALKELQDTA 378

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/378 (93%), Positives = 368/378 (97%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MVDLSTALIH DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEK+PVYSRLA
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+ILDGYAV+YSSGLAAF+AAMVHYNPKKIFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           Y I+QHPLEDIE+ A+EGDIVHLESPVNPYGTS DIES ARRAHAKGALLI+DSTFASPP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK+EA SR+LKDDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTYE+RI KQSENATK+V+FLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVFAITL TKEQCK  PLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 NDLIKDLASALKELQDAA 378
           +DLI+DLASALKELQDAA
Sbjct: 361 DDLIRDLASALKELQDAA 378

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/375 (78%), Positives = 340/375 (90%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           M  LSTALIH DDKDNRV+DVAPPINV+TTFRYD+DDL+PWTERENLDFMEK P+YSRLA
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESIFSEILDG+AVIYSSGLAAF+AAM+HYNPK+IFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           +  +QH L++IE+ A  GDIVHLE+PVNP+GTS D+E  A++AH KGALL+VDSTFA PP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ  W+F  DI+++SATKYFGGHSDLLSGVLVVKEEA +RQL+DDRIYLGTNVANLESFM
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT+EMR+ KQSENATK+V FL  ++ ++DKVLK+I HSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+I+L  KEQCK+ P  LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIRVS+GCE+A
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 361 NDLIKDLASALKELQ 375
           +DLI+DLA+AL+ LQ
Sbjct: 361 DDLIQDLANALETLQ 375

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/375 (78%), Positives = 338/375 (90%)

Query: 2   VDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAH 61
           + LST LIHGDDKDNRV+DVAPPINV+TTFRYD +DLIPW+ERENLDFM+K P+YSRL H
Sbjct: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87

Query: 62  PNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNY 121
           PNSTRLESIFSE+L+G+AVIYSSG++AF+AAMVHYNPK++F+GQSYHG RAIANILTRNY
Sbjct: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147

Query: 122 GIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPL 181
            +EQHPLEDIEK A +GDIVHLE+PVNPYGTS DI   ARRAHAKGALL VDSTFA PPL
Sbjct: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207

Query: 182 QYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFML 241
           Q  W F ADIV++SATKYFGGHSDLLSGVLVVK+E  +RQL+DDRIYLGTNVANLES++L
Sbjct: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267

Query: 242 LRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGP 301
           LRSLRT++MRI +QSENATK+V+FL+D++ +F  VL  IYHSSLQTE FVKKQL GGY P
Sbjct: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327

Query: 302 VFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAN 361
           VF+ITL  KEQCK+ PL LKYFHHATSLGGIESLVEWRAMTDPYIDQTLIR+S+GCE A+
Sbjct: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387

Query: 362 DLIKDLASALKELQD 376
           DLI DL++AL +LQD
Sbjct: 388 DLINDLSAALNKLQD 402

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/378 (76%), Positives = 342/378 (90%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           M  L T+LIH DDKDNRV+DVAPPINVSTT+RYD+ DLIPW ERENLDFMEKKPVYSRLA
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN+TRLES+FSEIL+G+AVIYSSG AAFYAAMVHYNPKKIF+GQ YHG+RAIANI+TRN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           YG+EQ+ L+DIEK A EGDIV +ESP+NPYGTS DI+S+A +AH+KGA+++VDSTFA PP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQYAW+ GAD+VL+SATKYFGGHSDLLSGV+VVK+E   ++L+DDRIYLGTNV NLES+M
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLR+YE+RI KQSENATK+V FL+ ++  FDKVLK +YHSSLQ E FVKKQLVGGYG
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+++L T +QCK+ P KLKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIRVS+G E+A
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 NDLIKDLASALKELQDAA 378
           +DLIKDL +AL+EL + A
Sbjct: 361 DDLIKDLETALQELHNGA 378

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/373 (73%), Positives = 331/373 (88%)

Query: 3   DLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHP 62
           DL+T LIHGDD  NRV DVAPPINV+TTFRYD++DL+PW ERE+L+FM++ P+YSRL HP
Sbjct: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64

Query: 63  NSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYG 122
           N+TRLESIFSEIL+G+AVIYSSGLAAF+AAM H+NPK++FIGQSYHGV  IA+IL+RNYG
Sbjct: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124

Query: 123 IEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQ 182
           + Q  L+DIE+ A +GDIVH+E+PVNP+GTS D++S A +AH++GALL+VDSTFA PPLQ
Sbjct: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242
           YAWNFGADI+++SATK+FGGHSDLLSGVLV K+E  S++LKDDRIYLGTNVANLES +LL
Sbjct: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244

Query: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           RSLRT+EMRI KQS+N TK+V  L  ++ ++ KVL+ ++HSSLQ E FVKKQL+GGY PV
Sbjct: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304

Query: 303 FAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAND 362
           F+ITL  KEQCKQLPLKLKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR S+GCESA+D
Sbjct: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADD 364

Query: 363 LIKDLASALKELQ 375
           LI DL +A  EL+
Sbjct: 365 LIADLDAAFIELE 377

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 327/376 (86%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MV L T LIH DDKDNRVTD+  PINV+TTFRYD+++LI W +REN DF+E  PVYSRLA
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN+TRLESIFSEIL G+AVIYSSGLAA++A + HYNPKK+FIGQSYHG   IA+I TRN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
            G++Q+PL+ IE+ ASEGDIVHLE+PVNP+GTS DIE  AR+AHAKGALL++DSTFA PP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ  W FGAD+V++S TKYFGGHSDLLSGV+VVK    ++++K+DRIYLGTN+ANLES++
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT+EMR+ KQSENAT LV++L DH+SEF+KVL  IYHSSLQTE+FVKKQL GGYG
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+I L +K QCK+LP KL+ F HATSLGG+ESLVEWRA+TDPYI+QTLIRVSVGCE  
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 361 NDLIKDLASALKELQD 376
            DLIKDLA ALK+LQD
Sbjct: 361 EDLIKDLAGALKQLQD 376

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/373 (68%), Positives = 320/373 (85%)

Query: 3   DLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHP 62
           DL T LIHGDD +NRVTDVAPPIN++TTFRYD++DLIPW ER +L FME KP+YSRLAHP
Sbjct: 8   DLETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHP 67

Query: 63  NSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYG 122
           NS+RLE++FS+ILDG AVIY+SG++AF+AAM ++NPK++F+GQ+YHG  A  NIL RN  
Sbjct: 68  NSSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGT 127

Query: 123 IEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQ 182
           +++H  ++IE+ A +GDIVHLESPVNPYGTS DIE   ++AH+KG L+++DSTFA PPLQ
Sbjct: 128 LKKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQ 187

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242
           Y W+F  DIV++SATK+FGGHSDLLSGVLVVK+E  ++ L++DRIYLGTN+ANLES++LL
Sbjct: 188 YVWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLL 247

Query: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           RSLRT+EMRI KQS +AT++V+FL+D++ +F+KVLK IYHSSLQ E+FVKKQL GGY PV
Sbjct: 248 RSLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPV 307

Query: 303 FAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAND 362
           F+I L+ KEQCK LP  LKYF HATSLGG+ESL+EWRA+TDPYI QTLIRVSVGCE+  D
Sbjct: 308 FSIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQD 367

Query: 363 LIKDLASALKELQ 375
           LI DL  AL  +Q
Sbjct: 368 LINDLDQALTVIQ 380

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/378 (68%), Positives = 323/378 (85%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MV+LST LIH DDK+NRVTDVAPPINV+TTFRY++ DLIP  ERE++ F++++PVYSR  
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN TRLE++FSE L G+AVIYSSGL+A++AA++ +NPK+IF+ Q+YHG  AIA +  RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
             ++++ L++IE+ A +GDIVHLESPVNP+GTS DIE+ A+RAHAKGALL+VD TFA PP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ  W+FGADIV++SATKYFGGHSDLL GVLVVK++     LK+DRI LGTN+ANLES++
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT+EMRI KQSEN TK+V++L +++ ++ KVL+ I HSSLQ E+FVKKQL GGY 
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+ITL T EQCK    +LKYF HATSLGG+ESLVEWRA++DP+IDQTL+RVSVGCESA
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 361 NDLIKDLASALKELQDAA 378
           +DLIKDLASAL+ LQD A
Sbjct: 361 DDLIKDLASALQNLQDEA 378

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 318/376 (84%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MV+L+T LIH DDK NRV+DVAPPINVSTT+RY ++DLIPW +REN DFM++ PVYSR  
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN TRLE+IFS+IL+G+AV+Y+SGLAAF+AAM+HYNPK++F+GQ YHGV  I+++ TRN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           + ++Q  LEDI + A +GD+VHLESPVNP+GT  D++ LA  AH+KGA++I+DSTFA PP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQYAW+ GAD++++SATKYFGGHSDLL G+LV K++  SR LK+DRI LG+ + NLES++
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           L+RSLRTYEMRI KQSEN  K+V++L+D++ ++  VL  IYHSS+Q++ FVK QLVGGY 
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
            VF+  L ++EQCK+ P KLKYFHHATSLGGIESL+EWRA++D  IDQ L+RVSVGCESA
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 361 NDLIKDLASALKELQD 376
            DLI DL+ AL+EL++
Sbjct: 361 KDLIDDLSQALQELEN 376

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/377 (66%), Positives = 315/377 (83%), Gaps = 2/377 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           M  L+T LIH DD+DNRV DVAPPINVSTT+RYD DDL+PW +RE+L+FM+K+P+YSRLA
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+IL G+AV+Y+SGLAAF+AA++HYNPK++FI QSYHG RAIA+ILTR 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGT-SSDIESLARRAHAKGALLIVDSTFASP 179
            G++Q  L+D+ + A  GD+VHLESPVNP GT   D+  LA +AH +GA+LIVDSTFA P
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ  W FG D+V++SATKYFGGHSDLLSGVLV +++ T+  L+DDRIYLGTNVANLE++
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGG 298
           +LLRSLRT+E+RI +QS N T +V +L+DH+ ++  VL  +YHSSLQT E +V +QL GG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 299 YGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCE 358
           + PVFA+TL + +QCK+ P  L YF HATSLGG+ESLVEWRAMTDP+IDQTL+RVSVGCE
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 359 SANDLIKDLASALKELQ 375
           +A DLI DL +AL  LQ
Sbjct: 361 NAEDLIADLTTALNALQ 377

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/374 (64%), Positives = 313/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MVDL T L+HGDD+ NRVTDVAPPINV++TFRYD+D+LIPW ++ NLDF+++ PVYSR  
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN  RLE++FS  L G+A+ YS GL  F   MVH+NPK++F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           YG+E++ L DIEK A +GDIVH+E+P+NP+GTS DI  LARRAH+KGALL+VDSTFA PP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ AW+FGAD++++SATKYF GHSDLLSGVLVVK++  + +LK+DRIYLG+N+ANLES++
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTY++RI +Q+ENATK+V++L+DH+ ++  +++ +YHSSLQTEEFVKKQL GGY 
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGYT 299

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF++T  T+EQCK+    LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 NDLIKDLASALKEL 374
           +DLI DL++ L +L
Sbjct: 360 DDLINDLSTVLSQL 373

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/378 (64%), Positives = 316/378 (83%), Gaps = 2/378 (0%)

Query: 2   VDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAH 61
           + LST L+H DDK NRVTD+  PINV+TTFRY++ DLIPW ERE+   +EKKP+YSRLAH
Sbjct: 1   MSLSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAH 60

Query: 62  PNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNY 121
           PNS R+ES+ S++L+G AV+Y++GLAA++A + +YNPK++FIG+ YHG R+IA+I TRN+
Sbjct: 61  PNSLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNW 120

Query: 122 GIEQHPLE--DIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
            +EQH LE  +I + A +GD+VH+E+PVNPYGTS DI++ A   H+KGA+L++DSTFA P
Sbjct: 121 NLEQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ  W+FG D++L+SATKYFGGHSDLL+GVL VK++  + +L+ DRIYLGTN+ANLE+F
Sbjct: 181 PLQNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAF 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRT+EMRI  QSENATKLV +L +H+S+F+ VL+ ++HSSLQTE FVK+QL GGY
Sbjct: 241 LLLRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGY 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           GPVFA+TL +KEQC++ P  L  F HATSLGG+ESLVEWRA+TDPYI  TLIRVSVG E+
Sbjct: 301 GPVFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

Query: 360 ANDLIKDLASALKELQDA 377
            +DLIKD A+ALK LQ A
Sbjct: 361 VDDLIKDFANALKTLQGA 378

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/374 (64%), Positives = 313/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MVDL+T L+HGDD+ NRVTDVAPPINV++TFRYD+D+L+PW +  NLD +++ PVYSR  
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN  RLE++FS  L G+AV YS GL  F +AMVH+NPK++F+ Q YHGV+ I  I+ RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           YG+E++ L DIEK A +GDIVH+E+P+NP+GTS DI  LARRAHAKGALL+VDSTFA PP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ AW+FGAD++++SATKYFGGHSDLLSGVLVVK++ T+ +LK+DRI LG+N++NL+S++
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRTY++RI +QSE+ATK+V++L+DH+++F   L  +YHSSLQ+++FVKKQL GGYG
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYG 299

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF++TL T+EQCK+    LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 300 PVFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 NDLIKDLASALKEL 374
            DL  DL + L +L
Sbjct: 360 EDLTNDLTTVLSQL 373

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/377 (64%), Positives = 318/377 (84%), Gaps = 1/377 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTE-RENLDFMEKKPVYSRL 59
           M  LSTALIHGDDK NRVTDVAPPINVSTTFR+D+++LIP  E ++ L  +++ PVY+R 
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  AHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           +HPNS+R++++ S++L G+AVIY+SG +AF+A M HYNPK+ F+   Y GV AIA+++TR
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
           NYG+EQH L++IE+ A  GDIVHLE+P+NP+GTSSDIE+LA+R H KGA+L +D+T A P
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ AW FGADI+L+SATKYFGGHSDLL+GVLVVK +  + +L +DRI+LGTN+ NLES+
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRTYEMRI KQ  N  K++ +L++++S+F+KVL  IYHSSLQ ++FV+KQL G Y
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
            PVFAITL++ +QCK+LPL LKYF HATSLGG+ESL+EWRAM+D  IDQ LIRVS+GCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 360 ANDLIKDLASALKELQD 376
           A+DLIKDL +AL+ LQ+
Sbjct: 361 ADDLIKDLENALQILQN 377

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/372 (64%), Positives = 306/372 (82%), Gaps = 1/372 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTEREN-LDFMEKKPVYSRL 59
           MV L+T LIH DDK+NRVTDVAPPINVS+TFRYD+++LIP  E ++ L  +E+ PVYSR 
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRE 60

Query: 60  AHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           +HPNS+R++SI S++L G+AVIY+SG +AF+A M HYNPK+ F+   Y GV AIA+++TR
Sbjct: 61  SHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
           NYG+EQH L++IE+ A  GD+VHLESP+NP+GT+SDI++LA R H+KGA+L +DST A P
Sbjct: 121 NYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ  WNFGADIVL+SATKYFGGHSDLL+GVL VK +  + +L +DRI+LGTN+ NLES+
Sbjct: 181 PLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRTYEMRI KQS+NATK+V++L +H+      LK I+H+SLQ E F+ KQL GG+
Sbjct: 241 LLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGH 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           G VF+I L +  QCK+LPL LKYF HATSLGGIESL+EWRAM+D  IDQ LIRVSVGCE+
Sbjct: 301 GAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

Query: 360 ANDLIKDLASAL 371
             DLIKDL +AL
Sbjct: 361 VEDLIKDLENAL 372

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 303/375 (80%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           M   +T+ IH DD++NRV DVAPPINVS T+RYD+D+L    E+E L+ M+  PVYSR A
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN TRLES+ S IL+G+AV+Y+SG +AFYAA+VHYNPK++FI +SY G+ AIA+I+TRN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           YG++QH  ++IEK A  GDIVHLESP+NPYG SSDI++LA RAHAKGALL+VDST A PP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ  W+FG DI+++SATKYFGGHSDLL+G+LV K++  S QLK DRIYLGT   NLESF+
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           LLRSLRT EMR+ KQSENATK+V++L D++  FDKVL  IYHSSLQ E FV  Q+ GGY 
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           P+F+  L T +Q K  P KLK F HATSLGGIESL+EWR +++P +DQTL+R+SVGCE+ 
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 NDLIKDLASALKELQ 375
           +DLI DL +AL++ Q
Sbjct: 361 DDLIADLQNALQQAQ 375

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  493 bits (1268), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 227/379 (59%), Positives = 301/379 (79%), Gaps = 1/379 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTEREN-LDFMEKKPVYSRL 59
           M  LSTA IH DD  NRVTDVAPPINVSTTFRYD+++L+P  E EN ++ +E+ PVYSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  AHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           +HPNS RL+++ S+IL G+A +Y+SG++AF+A + HYNPK+ F+   Y GVR IA +   
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
            +G+E + L  IE+ A +GD++HLE P+NPYGT  DI +LA+R H KGA+L +DST A P
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ AW+FGAD+V++SATKY GGHSDLL+GV+VVK     R+L  +RI+LGTNV NLESF
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRT+EMR+ KQSENA K+V FL ++++++ KVL  +YHSSLQ E FV++QL GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           G VF++TL + EQCK+LP KL YF HATSLGG+ESL+EWRA++D  ID  L+R+S+GCE+
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 ANDLIKDLASALKELQDAA 378
           A+DLI+DL +AL+ LQ AA
Sbjct: 361 ADDLIQDLDNALQVLQGAA 379

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  489 bits (1258), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/376 (62%), Positives = 291/376 (77%), Gaps = 1/376 (0%)

Query: 1   MVDLSTALIHGDDK-DNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRL 59
           M  LST LIH DD   + VTDVAPPINVSTTFRYD+D+L+      +    E  PVYSR 
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSRE 60

Query: 60  AHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
            HPNS R  SI S  L+GYAV Y+SGL+AF AA+ HYNPK++FIGQSYHG   +A+I  R
Sbjct: 61  GHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVR 120

Query: 120 NYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
           NYG+ +  L++IE+ A  GD+VH+ESP+NPYGT+ DIE    + H KGA++++DSTFA P
Sbjct: 121 NYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ AW FG DI+++S TKY GGHSDLL GVLVVK++A  RQL  DRIYLGTN+ANL+S+
Sbjct: 181 PLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSY 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +L+RSLRT E+R+ KQS+ ATKLV +L  H SEF  VL  I H+SLQ EEFVKKQL GG+
Sbjct: 241 LLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGH 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
            PVF+I L T +QC++LP KLK+FHHATS GG+ESL+EWRA++DP I++TL+RVSVGCE 
Sbjct: 301 TPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCED 360

Query: 360 ANDLIKDLASALKELQ 375
            NDLI DLA+AL+ LQ
Sbjct: 361 HNDLINDLANALRYLQ 376

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  483 bits (1242), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/379 (59%), Positives = 296/379 (78%), Gaps = 1/379 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTEREN-LDFMEKKPVYSRL 59
           M  LST  IH DD  NRV+DVAPPINV+TTFR+D+D+LIP  E EN ++ +E+ PVY+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  AHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
            HPNS R++SI S IL G+A +Y+SG +AF+A M   NPK++F+  +Y GV  IA+++  
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
            YG++   L+ IE+ A +GD+VHLE+P+NP+G  ++I +LA R H KGALL VDST A P
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ AW+FGADIV++SATKY GGHSDLL+GVLVVK+  T R L  +RIYLGTN+ NLESF
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLRSLRT+EMR+TKQSENA K+V FL ++ +++ KVL  +YHSSLQ EEFV+KQL GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           G VF++ L + EQ K+LP KL YF HATSLGG+ESL+EWRAM+D  ID  L+R+SVGCE+
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 ANDLIKDLASALKELQDAA 378
            +DLI+DL   L+ LQ+AA
Sbjct: 361 VDDLIQDLDQGLQALQNAA 379

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  478 bits (1229), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 229/377 (60%), Positives = 307/377 (81%), Gaps = 1/377 (0%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTE-RENLDFMEKKPVYSRL 59
           MV LST LIHGDDK NRVT VAPPINVSTTFR+D ++LIP  E ++ L  +++ PVY++ 
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKE 60

Query: 60  AHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR 119
           ++PNS+R++++ S++L G+AVIY+SG + F+A M HYNPK+ F+   Y GV AIA++LTR
Sbjct: 61  SYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTR 120

Query: 120 NYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASP 179
           NYG+EQ  L++IE+ A  GDIVHLE+P+NP+GTSSD+E+L  R H KGA+L +D+T ASP
Sbjct: 121 NYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASP 180

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
           PLQ AW FGADI+L+SATKY GGHSDLL+GVLVVK +  + +L +DRI+LGTN+ NLES+
Sbjct: 181 PLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGY 299
           +LLR L TYEMRI KQ +N  K++ +L++++S+F+KV+  IYHSS Q ++F++KQL G Y
Sbjct: 241 LLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLY 300

Query: 300 GPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
            PVFAITL++ +QCK+LPL LKYF HATSLG  ESL+EWRA++D  IDQ LI VS+GCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

Query: 360 ANDLIKDLASALKELQD 376
           A+DLIKDL +AL+ LQ+
Sbjct: 361 ADDLIKDLENALQILQN 377

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  473 bits (1217), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 214/374 (57%), Positives = 284/374 (75%)

Query: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60
           MV+L T+LIH DD  NRV DVAPPINV+TTFRY +DDLIP  ER           YSR++
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
           HPN  R E + +E L G AV+YSSGLAAF AA+ H+NPK++FIG+ YHG   +A+I  RN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
           +G+++  LE++ + +  GD+VH+ESP+NPYGT  D+  +A  AH KGA +++D+TFA PP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
           LQ  W  GAD+V++S TKYFGGHSDLL GV  V++ A +RQL+ DR+YLGTN+ANLE+++
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300
           L+RS+RT EMR+ +QS +ATK+V +L  H++EF  VL  ++HSSLQTE +V++ L GG  
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           PVF+I L T EQCK+LP  LK FHHATSLGG+ESL+EWRAM+D  ++Q L+R+SVGCES 
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 361 NDLIKDLASALKEL 374
            DLI DLA A ++L
Sbjct: 361 EDLIADLAGAFRQL 374

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  469 bits (1206), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 290/360 (80%), Gaps = 1/360 (0%)

Query: 17  RVTDVAPPINVSTTFRYDDDDLIPWTE-RENLDFMEKKPVYSRLAHPNSTRLESIFSEIL 75
           +++D+APPINVSTT+RYD+ +LIP  E ++ L  +E+ PVYSR +H NS+R++ + S++L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  DGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQHPLEDIEKCA 135
           +G+AVIY+SG +AF+A M HYNPK+IF  +SY G++AIAN++TRNYG++Q+ L+DI+K A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 SEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYS 195
            EGDI+H+E+P+NP+GT+ +I+ +A +AHAK ALL VDST A PPLQ A++FGADIVL+S
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 ATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQ 255
           ATKY GGHSDLL+GVLVVK E  +R L +DRI+LGTN+ NLESF+LLRSLRTYEMR++ Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 SENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLYTKEQCKQ 315
           S+N  K+V FL  ++ ++  V++ IYHSSLQ E FV +QL  G+  VFA+   ++EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 316 LPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQ 375
               LKYF HATSLGG+ESLVEWRAM+DP ID  LIR S+GCE+A DLI+DL SAL  L+
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRLE 367

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  451 bits (1160), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 210/371 (56%), Positives = 279/371 (75%)

Query: 5   STALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNS 64
           STA IHGDD+ NRV+DVAPPINVSTTFRYDD+ L P T        +   +YSRL HPN+
Sbjct: 5   STATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNA 64

Query: 65  TRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIE 124
            RLE + +EILDG  V+Y+SGLAA++A ++H NPK++F    YHG  A+A I++R  G+E
Sbjct: 65  DRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGME 124

Query: 125 QHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYA 184
             PLE++E     GD+VHLE P NPYG   +++  A + H  GAL++VDST A PPL+  
Sbjct: 125 ILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNT 184

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRS 244
           W FGADIV++S TKYFGGHSDLLSG++ V++E  ++QL++DR YLGT  A+LES++LLRS
Sbjct: 185 WEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRS 244

Query: 245 LRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304
           LRT E+R+ KQS N T+LV +L+ H+  ++ V+K I H+SLQ EEFVKKQL GGYGPVF+
Sbjct: 245 LRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFS 304

Query: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLI 364
           + L+++EQCK L      F HATSLGG ESL+EWRAM+DP+ ++ LIRVSVG E+A DLI
Sbjct: 305 LLLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLI 364

Query: 365 KDLASALKELQ 375
           +DLA  L++++
Sbjct: 365 EDLAGTLEKIE 375

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  442 bits (1136), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 283/371 (76%)

Query: 5   STALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNS 64
           +T  IH DD  NRV+DVAPPINVSTTFRYD++ L+P T    +   +   +YSRL HPN+
Sbjct: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64

Query: 65  TRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIE 124
            RLE++ S++LD +AV+Y+SGLAA++A +VH+ PK++F+   YHG + +A I++R  G+E
Sbjct: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124

Query: 125 QHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYA 184
              LEDIE    EGD+VH+E P+NP+G + D+   A R H+ G L+++DST   PPL+ A
Sbjct: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRS 244
           W++GADI+++S TKYFGGHSDLLSG++ V +EA + QLK+DR YLGT  A+LESF+LLRS
Sbjct: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRS 244

Query: 245 LRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304
           LRT ++R+ +QS+N T+LV +L+++  +F  V++ I H+SLQTE FVK+Q+ GG+GPVFA
Sbjct: 245 LRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304

Query: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLI 364
           + L +++QC+++   + +F HATSLGG+ESL+EWRAM+DP   +TLIRVSVG E+  DLI
Sbjct: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364

Query: 365 KDLASALKELQ 375
            DLA +L+++ 
Sbjct: 365 ADLAGSLEKIN 375

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  145 bits (365), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 128/400 (32%), Positives = 190/400 (47%), Gaps = 52/400 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  IH     +    V  PI++STTF+                    +P+    YSR 
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFKQS---------------APAQPIGTYEYSRS 53

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLA--AFYAAMVHYNPKKIFIGQSYHGVRAIANI 116
            +PN   LE+  + + +G Y + +SSG A  A     +  N   I IG  Y G       
Sbjct: 54  QNPNRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTK 113

Query: 117 LTRNYGIEQHPLEDIEK-----CASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKGAL 169
           +   +G+E     D+ K           +V +ESP NP    +DIE++++  ++  K  L
Sbjct: 114 VANAHGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDIL 173

Query: 170 LIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYL 229
           L+VD+TF SP L    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  +
Sbjct: 174 LVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAV 233

Query: 230 GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE 289
           G   +  +S++  R L+T  +R+ + S  ATK+  FLS + +     +K + +  L T E
Sbjct: 234 GAIPSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYPGLPTHE 288

Query: 290 ---FVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MT 342
               VKKQ    +GG    F I     E   +     + F  A SLGGIESL+E  A MT
Sbjct: 289 NYDIVKKQHREALGGGMISFRIN-GGSEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMT 347

Query: 343 DPYIDQT----------LIRVSVGCESANDLIKDLASALK 372
              I +           LIR+SVG E A DL+ D+  AL+
Sbjct: 348 HGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  140 bits (354), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 197/402 (49%), Gaps = 54/402 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  IH     +    V  PI++STTFR                    +P+    YSR 
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFRQS---------------APAQPIGTYEYSRS 53

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIAN 115
            +PN   LE   + + +G Y + +SSG +A  A ++   P+    I IG  Y G      
Sbjct: 54  QNPNRENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFT 112

Query: 116 ILTRNYGIE----QHPLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHA--KGA 168
            +   +G+E       L D+ K   E   +V +ESP NP    +DIE+++++  +  K  
Sbjct: 113 KVANAHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDI 172

Query: 169 LLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIY 228
           LL+VD+TF SP L    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  
Sbjct: 173 LLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  ++++  R LRT  +R+ + S +A K+  FL ++++     ++ + +  L T 
Sbjct: 233 IGAIPSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VEAVNYPGLPTH 287

Query: 289 ---EFVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-M 341
              + VKKQ    +GG    F I     E   +     + F  A SLGG+ESL+E  A M
Sbjct: 288 KDYDVVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVM 346

Query: 342 TDPYIDQ----------TLIRVSVGCESANDLIKDLASALKE 373
           T   I +           L+R+SVG E  +DL++D+  AL++
Sbjct: 347 THGGIPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  139 bits (350), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 127/400 (31%), Positives = 193/400 (48%), Gaps = 50/400 (12%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAEPIGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLA--AFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120
              LE   + + +G Y + +SSG A  A     +  N   I IG  Y G     + +   
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVANT 117

Query: 121 YGIE----QHPLEDIEKCASEGD-IVHLESPVNPYGTSSDIESLAR--RAHAKGALLIVD 173
           +G++       + D+ K   E   +V +ESP NP    +DIE +A+  ++  K  LL+VD
Sbjct: 118 HGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVVD 177

Query: 174 STFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNV 233
           +TF SP L    NFGADIV++SATKY  GHSD++ GVL         +L+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAIP 237

Query: 234 ANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF--V 291
           +  ++++  R L+T  +R+ + + NATK+  FL    ++ D V+   Y       ++  V
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAALNATKIAEFL----AQSDNVVAVNYPGLPTNPDYAIV 293

Query: 292 KKQ----LVGGYGPVFAITLYTK---EQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTD 343
           KKQ    L GG      I+   K   E   +     + F  A SLGGIESL+E  A MT 
Sbjct: 294 KKQHRDALGGGM-----ISFRVKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 348

Query: 344 PYIDQT----------LIRVSVGCESANDLIKDLASALKE 373
             I +           L+R+SVG E  +DL++D+ +AL++
Sbjct: 349 GGIPKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  139 bits (350), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 198/396 (50%), Gaps = 44/396 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +G Y + +SSG +A  + ++   P+    + IG  Y G       +  
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIE----QHPLEDIEKCASEGD-IVHLESPVNPYGTSSDIESLAR--RAHAKGALLIV 172
            +G+E     + +E++ +   E   +V +ESP NP    +DI  +++  ++  K  +L+V
Sbjct: 117 THGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   ++    +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF-- 290
            +  +S+++ R L+T  +R+ + + NATK+  FL+ +++    V+   Y     +E F  
Sbjct: 237 PSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNEN----VIAVNYPGLPSSENFEV 292

Query: 291 VKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           VKKQ    +GG    F I     E   +     + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VKKQHRDALGGGMISFRIK-GGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 DQT----------LIRVSVGCESANDLIKDLASALK 372
            +           LIR+SVG E ++DL+ D+  AL+
Sbjct: 352 PKEQREASGVFDDLIRLSVGIEDSDDLLDDIKQALQ 387

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  139 bits (351), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 194/401 (48%), Gaps = 54/401 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  IH     +    V  PI++STTF+                     PV    YSR 
Sbjct: 46  FATKAIHAGTHTDVHGSVIEPISLSTTFKQSS---------------PANPVGIYEYSRS 90

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIAN 115
            +PN   LE+  + + +G Y + +SSG +A  A ++   P+    I IG  Y G      
Sbjct: 91  QNPNRENLENAIAALENGKYGLAFSSG-SATTATVLQSLPQGSHAISIGDVYGGTHRYFT 149

Query: 116 ILTRNYGIEQHPLEDIEK-----CASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKGA 168
            +   +G+E     D+ K           +V +ESP NP    +DI+++A   ++  K  
Sbjct: 150 KVANAHGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDI 209

Query: 169 LLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIY 228
           +L+VD+TF SP L    +FGADIV++SATKY  GHSD++ GVL   ++A   +L+  +  
Sbjct: 210 ILVVDNTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNA 269

Query: 229 LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  +S++  R L+T  +R+ + S NATK+ +FL     +   ++K + +  L T 
Sbjct: 270 IGAIPSPFDSWLAHRGLKTLHLRVRQASLNATKIAQFL-----QSSPLVKAVNYPGLPTH 324

Query: 289 E---FVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-M 341
           E    V+KQ    +GG    F I     E   +     + F  A SLGGIESL+E  A M
Sbjct: 325 ENYAVVQKQHREALGGGMISFRIQ-GGSEAASKFSSSTRLFTLAESLGGIESLLEVPAVM 383

Query: 342 TDPYIDQT----------LIRVSVGCESANDLIKDLASALK 372
           T   I +           L+R+SVG E  +DL+ D+  AL+
Sbjct: 384 THGGIPKEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALE 424

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  138 bits (348), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 195/396 (49%), Gaps = 44/396 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
           +ST ++H  +  +    V  PI++STTF+      +P    E          YSR  +PN
Sbjct: 9   ISTKVVHAGEHVDIHGSVIEPISLSTTFK-QASPAVPVGAYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  + + +SSG +A  A ++   P+    I IG  Y G     N +  
Sbjct: 58  RKNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVAN 116

Query: 120 NYGIE----QHPLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLAR--RAHAKGALLIV 172
            +G+E     + +ED+     E   +V +ESP NP    +DI+ +++  ++  K  +L+V
Sbjct: 117 AHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGAV 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYH--SSLQTEEF 290
            +  ++++  R L+T  +R+   S +A ++  FL     + DKV+   Y   SS    + 
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFL----VKSDKVISVNYPGLSSHPNNDI 292

Query: 291 VKKQLVGGYGPVFAITLYTK---EQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           VKKQ   G G    I+   K   +   +     + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VKKQHRDGLGGGM-ISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 --DQT--------LIRVSVGCESANDLIKDLASALK 372
             DQ         LIR+SVG E   DL+KD+  AL 
Sbjct: 352 PKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  137 bits (346), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 195/402 (48%), Gaps = 54/402 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  IH    ++    V  PI++STTF+  +                 KP+    YSR 
Sbjct: 9   FATKAIHAGAHEDIHGSVIEPISLSTTFKQSE---------------PAKPIGTYEYSRS 53

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIAN 115
            +PN   LE+  + +  G Y + +SSG +A  A ++   P+    + IG  Y G      
Sbjct: 54  QNPNRENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFT 112

Query: 116 ILTRNYGIE----QHPLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHA--KGA 168
            +   +G++     + +ED+ K   +   +V +ESP NP    +DI+ +A       K  
Sbjct: 113 KVANAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDI 172

Query: 169 LLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIY 228
           LL+VD+TF SP L     FGADIV++SATKY  GHSD++ GVL    +    +L+  +  
Sbjct: 173 LLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  ++++  R L+T  +R+ + S NATK+  FL     E ++ +  + +  LQ+ 
Sbjct: 233 IGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFL-----ESNENVVAVNYPGLQSH 287

Query: 289 ---EFVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-M 341
              + VKKQ    +GG    F I     E   +     + F  A SLGGIESL+E  A M
Sbjct: 288 PNYDVVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVM 346

Query: 342 TDPYIDQT----------LIRVSVGCESANDLIKDLASALKE 373
           T   I +           L+R+SVG E   DL++D+  AL++
Sbjct: 347 THGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/396 (31%), Positives = 194/396 (48%), Gaps = 46/396 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGTHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +G Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIE----QHPLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHA--KGALLIV 172
            +G+E     + + ++     E   +V +E+P NP    +DIE +A+ A +  K  LL+V
Sbjct: 117 AHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   ++    +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE--- 289
            +  +S+++ R ++T  +R+ + S +A K+  FLS +++     +  + +  L T E   
Sbjct: 237 PSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNEN-----VIAVNYPGLPTHESYA 291

Query: 290 FVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
            VKKQ    +GG    F I     E         + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVKKQHRDALGGGMISFRIK-GGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IDQT----------LIRVSVGCESANDLIKDLASAL 371
           I +           L+R+S+G E  +DL++D+  AL
Sbjct: 351 IPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  133 bits (335), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 195/397 (49%), Gaps = 46/397 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHTDVHGSVIEPISLSTTFK-QTAPAQPVGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RKNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIE----QHPLEDIEKCASEGD-IVHLESPVNPYGTSSDIESLAR--RAHAKGALLIV 172
            +G+E     + +ED+ +   E   +V +ESP NP    +DIE +++  ++  K  LL+V
Sbjct: 117 AHGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL   ++    +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT---EE 289
            +  ++++  R L+T  +R+ + +  ATK+  FLS  QSE D V   + +  L T     
Sbjct: 237 PSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLS--QSE-DVV--AVNYPGLPTHPNHN 291

Query: 290 FVKKQLVGGYGPVFAITLYTK---EQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V KQ   G G    I+   K   E   +     + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVLKQHRDGLGGGM-ISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 I--DQT--------LIRVSVGCESANDLIKDLASALK 372
           I  DQ         LIR+S+G E  +DL+ D+  AL+
Sbjct: 351 IPKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQALE 387

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  129 bits (324), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 120/396 (30%), Positives = 186/396 (46%), Gaps = 46/396 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDIHGSVIEPISLSTTFK-QSSPAAPLGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RKNLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIEQHPLEDIEK-----CASEGDIVHLESPVNPYGTSSDIESLARRAHA--KGALLIV 172
            +G++     D+ K           +V +ESP NP    +DI  + + A    K  L++V
Sbjct: 117 AHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    NFG DIV++SATKY  GHSD++ GVL   ++A   +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT---EE 289
            +  +S++  R L+T  +R+ + +  ATK+  FL     E D  +  + +  L +    E
Sbjct: 237 PSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFL-----EQDSNVLAVNYPGLASNPDRE 291

Query: 290 FVKKQLVGGYGPVFAITLYTK---EQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V++Q   G G    I+   K   +   +     + F  A SLGGIESL+E  A MT   
Sbjct: 292 IVQRQHRDGLGGGM-ISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IDQT----------LIRVSVGCESANDLIKDLASAL 371
           I +           LIR+SVG E ++DL+ D+  AL
Sbjct: 351 IPKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEAL 386

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  128 bits (322), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 121/400 (30%), Positives = 194/400 (48%), Gaps = 47/400 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH  +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIE----QHPLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLAR--RAHAKG--ALL 170
            +G+E       L D+ +   E   +V +E+P NP    +DI+ +A   + HA G   +L
Sbjct: 117 AHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 IVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLG 230
           +VD+TF SP +    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE-- 288
              +  ++++  R L+T  +R+ + + +A K+  FL+   ++ + V+   Y   L+T   
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLA---ADKENVVAVNY-PGLKTHPN 292

Query: 289 -EFVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTD 343
            + V KQ    +GG    F I     E   +     + F  A SLGGIESL+E  A MT 
Sbjct: 293 YDVVLKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 351

Query: 344 PYIDQT----------LIRVSVGCESANDLIKDLASALKE 373
             I +           L+R+SVG E  +DL++D+  ALK+
Sbjct: 352 GGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  128 bits (321), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 193/400 (48%), Gaps = 47/400 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH  +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHIDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RENLEKAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIEQHPLEDI-----EKCASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKG--ALL 170
            +G+E     D+     +   +   +V +E+P NP    +DI+ +A   + HA G   +L
Sbjct: 117 AHGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 IVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLG 230
           +VD+TF SP +    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE-- 288
              +  ++++  R L+T  +R+ + + +A K+  FL+   S+ + V+   Y   L+T   
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLA---SDKENVVAVNY-PGLKTHPN 292

Query: 289 -EFVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTD 343
            + V KQ    +GG    F I     E   +     + F  A SLGGIESL+E  A MT 
Sbjct: 293 YDVVLKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 351

Query: 344 PYIDQT----------LIRVSVGCESANDLIKDLASALKE 373
             I +           L+R+SVG E  +DL++D+  ALK+
Sbjct: 352 GGIPKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  127 bits (320), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 184/397 (46%), Gaps = 48/397 (12%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  IH     +    V  PI++STTF+                     PV    YSR 
Sbjct: 9   FATKAIHAGAHTDLHGSVIEPISLSTTFKQSS---------------PGNPVGAYEYSRG 53

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIAN 115
            +PN   LE   + +    Y + +SSG +A  A +V   P+    I IG  Y G      
Sbjct: 54  QNPNRQNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFT 112

Query: 116 ILTRNYGIE----QHPLEDIEKCASEGD-IVHLESPVNPYGTSSDIESLARRAHA--KGA 168
            +   +G+E       LED+ K   +   +V +ESP NP    +DI+ +A    A  +  
Sbjct: 113 KVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDI 172

Query: 169 LLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIY 228
           +L+VD+TF SP L    NFGADIV++SATKY  GHSD++ G L     +   +L   +  
Sbjct: 173 ILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE 288
           +G   +  ++++  R L+T  +R+ + +++A K+  +L   QSE    +      S +  
Sbjct: 233 IGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYL--EQSEHVVSVNYPGLPSHRGY 290

Query: 289 EFVKKQLVGGYGPVFAITLYTKEQCKQLPL---KLKYFHHATSLGGIESLVEWRA-MTDP 344
           +  +KQ   G G    I+   K   +   L     + F  A SLGGIESL+E  A MT  
Sbjct: 291 QIAQKQHRDGLGGGM-ISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHA 349

Query: 345 YIDQT----------LIRVSVGCESANDLIKDLASAL 371
            I +           L+RVSVG E  +DL++D+  AL
Sbjct: 350 GIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQAL 386

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  127 bits (319), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 187/398 (46%), Gaps = 50/398 (12%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+            + +   E    YSR  +PN
Sbjct: 9   FATKAIHAGAHIDVHGSVIEPISLSTTFKQS-------APSQPIGIYE----YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +G Y + +SSG +A  A ++   P+    I IG  Y G       +  
Sbjct: 58  RKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIE----QHPLEDIEKCASEGD-IVHLESPVNPYGTSSDIESLARRAHA--KGALLIV 172
            +G+E     + +E++         +V +ESP NP    +DI+ +        K  L++V
Sbjct: 117 AHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLNKDILVVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT---EE 289
            +  ++++  R L+T  +R+ + S +A K+  FL+      D  +  + +  L++    +
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQ-----DPNVIAVNYPGLESHPNRD 291

Query: 290 FVKKQLVGGYGPVFAITLYTK---EQCKQLPLKLKYFHHATSLGGIESLV---------- 336
            VKKQ   G G    I+   K   E   +   K + F  A SLGGIESL+          
Sbjct: 292 IVKKQHRDGLGGGM-ISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 337 ---EWRAMTDPYIDQTLIRVSVGCESANDLIKDLASAL 371
              E R  T  Y D  L+R+SVG E  +DL+ D+  AL
Sbjct: 351 IPKEAREATGVYDD--LVRLSVGIEDVDDLLADVKQAL 386

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  126 bits (317), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 186/399 (46%), Gaps = 44/399 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH  +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIEQHPLEDIEK-----CASEGDIVHLESPVNPYGTSSDIESLA-----RRAHAKGAL 169
            +G+E     D+ K           +V +E+P NP    +DI+ +A       A ++  +
Sbjct: 117 AHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVI 176

Query: 170 LIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYL 229
           L+VD+TF SP +    NFGADIV++SATKY  GHSD++ GVL    +    +L+  +  +
Sbjct: 177 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAI 236

Query: 230 GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKV----LKTIYHSSL 285
           G   +  ++++  R L+T  +R+ + + +A K+  FL+  +     V    LKT  H + 
Sbjct: 237 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKENIVAVNYPGLKT--HPNY 294

Query: 286 QTEEFVKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDP 344
                  +  +GG    F I     E   +     + F  A SLGGIESL+E  A MT  
Sbjct: 295 DVVVKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHG 353

Query: 345 YIDQT----------LIRVSVGCESANDLIKDLASALKE 373
            I +           L+R+SVG E A+DL+ D+  ALK+
Sbjct: 354 GIPKEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  125 bits (313), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 117/398 (29%), Positives = 187/398 (46%), Gaps = 43/398 (10%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH  +  +    V  PI++STTF+       P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  Y + +SSG +A  A ++   P+    + IG  Y G       +  
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIEQHPLEDI-----EKCASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKG--ALL 170
            +G+E     D+     +       +V +E+P NP    +DI+ +A   + HA G   +L
Sbjct: 117 AHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 IVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLG 230
           +VD+TF SP +    +FGADIV++SATKY  GHSD++ GVL    +    +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKV----LKTIYHSSLQ 286
              +  ++++  R L+T  +R+ + + +A K+  FL+  +     V    LKT  H +  
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENIVAVNYPGLKT--HPNYD 294

Query: 287 TEEFVKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPY 345
                 +  +GG    F I     E   +     + F  A SLGGIESL+E  A MT   
Sbjct: 295 VVLKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGG 353

Query: 346 IDQT----------LIRVSVGCESANDLIKDLASALKE 373
           I +           LIR+SVG E  +DL++D+  ALK+
Sbjct: 354 IPKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  124 bits (310), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 184/401 (45%), Gaps = 52/401 (12%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  IH     +    V  PI++STTF+                    +P+    YSR 
Sbjct: 9   FATLAIHAGAHTDVHGSVIEPISLSTTFKQS---------------APAQPIGAYEYSRS 53

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIAN 115
            +PN   LE+  + +    + + +SSG +A  A ++   P     I IG  Y G      
Sbjct: 54  QNPNRANLEAAVAALERAQFGLAFSSG-SATTAVVLQSLPTDSHAISIGDVYGGTHRYFT 112

Query: 116 ILTRNYGIEQHPLEDIEK-----CASEGDIVHLESPVNPYGTSSDIESLARRAHAKGA-- 168
            +   +G++     D+E+           +V LESP NP    +DI  +A  AHA     
Sbjct: 113 QVAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDI 172

Query: 169 LLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIY 228
           L++VD+TF SP +      GADIV++SATKY  GHSD++ GVL    E    +L+  +  
Sbjct: 173 LVVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNA 232

Query: 229 LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYH--SSLQ 286
           +G   +  +S++  R L+T  +R+   +++A ++ +FL       D+V    Y   SS  
Sbjct: 233 IGAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFL----EASDRVEHVNYPGLSSHP 288

Query: 287 TEEFVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MT 342
               V+KQ    +GG    F I        +      + F  A SLGGIESLVE  A MT
Sbjct: 289 AYAVVQKQHRDALGGGMISFRIKGGAGAAAR-FTSTTRLFTLAESLGGIESLVEVPAVMT 347

Query: 343 DPYIDQ----------TLIRVSVGCESANDLIKDLASALKE 373
              I +           LIR+SVG E  +DL++D+  AL++
Sbjct: 348 HGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  122 bits (307), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 116/400 (29%), Positives = 185/400 (46%), Gaps = 52/400 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPV----YSRL 59
            +T  +H  +  +    V  PI++STTF+                     P+    YSR 
Sbjct: 7   FATLAVHAGEHTDVHGSVIEPISLSTTFKQSS---------------PANPIGVYEYSRS 51

Query: 60  AHPNSTRLESIFSEILDG-YAVIYSSGLAAFYAAM--VHYNPKKIFIGQSYHGVRAIANI 116
            +PN   LE+  + +    Y + +SSG AA    M  +      + IG  Y G       
Sbjct: 52  QNPNRDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTK 111

Query: 117 LTRNYGIE----QHPLEDIEKCASEGD-IVHLESPVNPYGTSSDIESL--ARRAHAKGAL 169
           +   +G+E     + LE++     +   +V +ESP NP    +DI+++  A +   K  L
Sbjct: 112 VANTHGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDIL 171

Query: 170 LIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYL 229
           L+VD+TF SP L     FGADIV++SATKY  GHSD++ GVL    +    +L+  +  +
Sbjct: 172 LVVDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAI 231

Query: 230 GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT-- 287
           G   +  ++++  R L+T  +R+ + S  A K+  FLS       K ++ + +  L+T  
Sbjct: 232 GAIPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSA-----SKHVEAVNYPGLKTHP 286

Query: 288 -EEFVKKQ---LVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRA-MT 342
               V++Q    +GG    F +         +     + F  A SLGGIESL+E  A MT
Sbjct: 287 NHAVVQRQHRDALGGGMISFRVK-GGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMT 345

Query: 343 DPYIDQ----------TLIRVSVGCESANDLIKDLASALK 372
              I +           LIR+SVG E   DL++D+  AL+
Sbjct: 346 HGGIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 118/396 (29%), Positives = 186/396 (46%), Gaps = 44/396 (11%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  IH     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFK-QSAPAQPLGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +G + + +SSG +A  A ++   P+    I IG  Y G       +  
Sbjct: 58  RKNLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 120 NYGIEQHPLEDIEK-----CASEGDIVHLESPVNPYGTSSDIESLARRAHA--KGALLIV 172
            +G++     ++ K           ++ +ESP NP    +DI  + +      K  L++V
Sbjct: 117 AHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVV 176

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN 232
           D+TF SP L    +FG D+V++SATKY  GHSD++ GVL         +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYH--SSLQTEEF 290
            +  ++++  R L+T  +R+ + +  ATK+  FL  +    D+V+   Y   +S  + + 
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSN----DRVIAVNYPGLASHPSHDV 292

Query: 291 VKKQLVGGYGPVFAITLYTK---EQCKQLPLKLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           V++Q   G G    I+   K   E   +     + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VQRQHRDGLGGGM-ISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 --DQT--------LIRVSVGCESANDLIKDLASALK 372
             DQ         LIR+SVG E   DL++D+  ALK
Sbjct: 352 PEDQREASGVYDDLIRLSVGIEDTEDLLEDIKQALK 387

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 110/387 (28%), Positives = 167/387 (43%), Gaps = 39/387 (10%)

Query: 11  GDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESI 70
           G + D +   V PP+   +T  +   D        +++ M+ +  Y     P    LE  
Sbjct: 20  GRNPDEQNGFVNPPLYKGSTIIHKKLD--------DVEHMKGRFFYGTAGSPTIANLEDA 71

Query: 71  FSEILDGYAVIYS-SGLAAFYAAMVHYNPKK--IFIGQS-YHGVRAIANILTRNYGIEQH 126
           ++ +  G   + S SGL +   A++        I I  S Y   R + + L   +GIE  
Sbjct: 72  WTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPTRMLCDGLLAKFGIETE 131

Query: 127 PL-----EDIEKCASEGD-IVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180
                  EDI+K       ++ LESP +      DI +L   A   G   I+D+T+A+P 
Sbjct: 132 YYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNTWATPL 191

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATS--RQLKDDRIYL-GTNVANLE 237
              A   G DI L + TKY GGHSDLL G+    EE     R   D    L G +    +
Sbjct: 192 FFDAHGHGIDISLEAGTKYLGGHSDLLIGLTSANEECWPLLRSTYDAMAMLPGAD----D 247

Query: 238 SFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVG 297
             + LR +RT  +R+ +    A  L  +L D + E +KVL   +      E +V+     
Sbjct: 248 CLLALRGMRTLHLRLKEAERKALDLAAWLED-RDEVEKVLHPAFKDCPGHEYWVRD--YK 304

Query: 298 GYGPVFAITL---YTKEQCKQLPLKLKYFHHATSLGGIESLV-------EWRAMTDPYID 347
           G   +F+I L   YT+   + +  K+K FH   S GG ESL+       + +A   P+  
Sbjct: 305 GSSGLFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLITPVNPARQRKAANWPHRG 364

Query: 348 QTLIRVSVGCESANDLIKDLASALKEL 374
             L R+ VG E   DL +DL    + L
Sbjct: 365 FAL-RIQVGLEELTDLKRDLELGFERL 390

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 109/403 (27%), Positives = 175/403 (43%), Gaps = 77/403 (19%)

Query: 24  PINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILD----GYA 79
           P+ +STTF+ D        E EN  +      YSR  +P  T L+   +++ D     + 
Sbjct: 11  PLYLSTTFKVD-------LENENNQYD-----YSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 80  VIYSSGLAAFYAAMVHYNPKK-----IFIGQS-YHGVRAIANIL-------------TRN 120
              SSG+ A    +  + P +     I  G   Y G + + N+L             T N
Sbjct: 59  FAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTEN 118

Query: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKGALLIVDSTFAS 178
           +  + + L  I+K     DI+ LESP NP     DI  L +  R ++   L+++D+T  S
Sbjct: 119 FKAKFYDLVTIKKTIV--DIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMS 176

Query: 179 PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYL-----GTNV 233
                   FGAD+V  SATKY  GH D+++GV++ K      +L  ++IY      G+ +
Sbjct: 177 GLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKN-----KLLAEKIYFLINSTGSGL 231

Query: 234 ANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----HQSEFDKVLKTIYHSSLQTEE 289
             ++S++L+R L+T  +R+ KQ  NA  +  +L +         +  LKT Y   L++  
Sbjct: 232 NPMDSWLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRY-IGLKSHP 290

Query: 290 FVKKQLVGGYGPVFAITLYTKEQCKQLPLK--------LKYFHHATSLGGIESLVEW--- 338
             +       GP   I+L    Q   +P+         LK ++   S G + SL+     
Sbjct: 291 DYELHRSFNKGPGAVISL----QTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCL 346

Query: 339 --RAMTDPYI------DQTLIRVSVGCESANDLIKDLASALKE 373
              A  DP +       + LIR+  G E    L +DL  A  E
Sbjct: 347 MSHASIDPELRKERQFPEDLIRLCCGIEDVKALQEDLLGAFVE 389

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 98.6 bits (244), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 106/412 (25%), Positives = 180/412 (43%), Gaps = 57/412 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D ++       +N D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQNFD-------YSRSGNPT 54

Query: 64  STRLESIFSE---ILDGYAVIYSSGLAAF---------YAAMVHYNPKKIFIGQSYHGVR 111
            + L++   +   +     +  SSG+ A               ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANILT-RNYGIEQH-PLEDIEK------CASEGDIVHLESPVNPYGTSSDIESLAR-- 161
            + N    + + +  H    D EK         + D V LESP NP     DI  + R  
Sbjct: 115 RLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFV 174

Query: 162 RAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEA 217
           +  +   ++IVD+T  S     PLQ   N   D+V  SATKY  GH DL+ GV++ K   
Sbjct: 175 KRISPETIVIVDNTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 TSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----HQSEF 273
            + +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  L  +L +      +E 
Sbjct: 233 IASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTET 292

Query: 274 DKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHATSLG 330
           +K  KT +       +F + +    G G V +    + E  K+L    KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFG 352

Query: 331 GIESLVEW-----RAMTDPYI------DQTLIRVSVGCESANDLIKDLASAL 371
            + SL+        A  DP +       + L+R+  G E+  DL KDL +A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 106/412 (25%), Positives = 182/412 (44%), Gaps = 57/412 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D ++     + +N D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSGNPT 54

Query: 64  STRLESIFSEIL---DGYAVIYSSGLAAFYAAMV---------HYNPKKIFIGQSYHGVR 111
            + L+    ++        +  SSG+ A    +          ++ P  I     Y G +
Sbjct: 55  RSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANILTR-NYGIEQH-PLEDIEKCAS------EGDIVHLESPVNPYGTSSDIESLAR-- 161
            + N   + ++ +  H    D EK  +      + D V LESP NP     DI  + R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 RAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEA 217
           +  +    ++VD+T  S     PLQ   N G D+V  SATKY  GH DL+ GV++ K   
Sbjct: 175 KCISPDTTVVVDNTMMSGLNCNPLQL--NPGCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 TSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----HQSEF 273
            + +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  L  +L +      +  
Sbjct: 233 IASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRT 292

Query: 274 DKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHATSLG 330
           +K  KT +       +F + K    G G V +    + E  K+L    KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 331 GIESLVEW-----RAMTDPYI------DQTLIRVSVGCESANDLIKDLASAL 371
            + SL+        A  DP +       + L+R+  G E+  DL KDL +A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 106/412 (25%), Positives = 182/412 (44%), Gaps = 57/412 (13%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D    +     ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVD----LSNETAQDYD-------YSRSGNPT 54

Query: 64  STRLESIFSEIL---DGYAVIYSSGLAAF---------YAAMVHYNPKKIFIGQSYHGVR 111
            + L++   ++        +  SSG+ A          +    ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANILTR-NYGIEQH-PLEDIEKCAS------EGDIVHLESPVNPYGTSSDIESLAR-- 161
            + N   + ++ +  H    D EK  +      + D V LESP NP     DI  + R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 RAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEA 217
           +  +    ++VD+T  S     PLQ   + G D+V  SATKY  GH DL+ GV++ K   
Sbjct: 175 KCISPETTVVVDNTMMSGLNCNPLQL--DPGCDVVYESATKYLNGHHDLMGGVIISKTAE 232

Query: 218 TSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----HQSEF 273
            + +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  L  +L D      +E 
Sbjct: 233 IAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTET 292

Query: 274 DKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHATSLG 330
           +K  KT +       +F + +    G G V +    + E  K+L    KL  +    S G
Sbjct: 293 NKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 331 GIESLVEW-----RAMTDPYI------DQTLIRVSVGCESANDLIKDLASAL 371
            + SL+        A  DP +       + LIR+  G E+  DL KDL +A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDLLAAM 404

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 125/262 (47%), Gaps = 42/262 (16%)

Query: 143 LESPVNPYGTSSDIESLAR--RAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYF 200
           LESP NP    +D+ +L    +AHA G  ++VD+T  S         GAD V  SATKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLSGVLVVKEEATSRQLKDDRIY----LGTNVANLESFMLLRSLRTYEMRITKQS 256
            GH D+++GV+V    A +R L ++  +    +G  +A +++++L+R L+T  +R+ KQ 
Sbjct: 208 NGHHDIMAGVIV----AATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQ 263

Query: 257 ENATKLVRFLSDHQSEFDKVLKTIYHSSLQT---------EEFVKKQLVGGYGPVFAI-- 305
            NA  L  +L     E         + +LQT         +  + +    G G V +I  
Sbjct: 264 HNAMVLAHWL----REVCGFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQT 319

Query: 306 ---TLYTKEQCKQLPLKLKYFHHATSLGGIESLVEW-----RAMTDPYIDQT------LI 351
               L  +  C +   KL+++    S G + SL+        A  DP + +       LI
Sbjct: 320 GDTALSERIVCSK---KLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLI 376

Query: 352 RVSVGCESANDLIKDLASALKE 373
           R+S G E   DL +DL +AL++
Sbjct: 377 RLSCGVEDVEDLQQDLLAALED 398

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 132/282 (46%), Gaps = 34/282 (12%)

Query: 115 NILTRNYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKGALLIV 172
           N+ T N+   Q     ++K     D VH+ESP NP     D+  +    ++ +    +IV
Sbjct: 124 NVDTSNFDKFQEAFLSVDKV----DCVHIESPTNPMCKVVDVPRIISFVKSVSPQTYVIV 179

Query: 173 DSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYL--- 229
           D+T  S  L    + GAD V  SATK+  GH D+++GV+V + +  +     D IY    
Sbjct: 180 DNTMMSGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVN 234

Query: 230 --GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----HQSEFDKVLKTIYHS 283
             G  +A ++S++L+R L+T  +R+ +Q  NA  L  +L       QS+ + +L+T Y  
Sbjct: 235 ATGCGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVG 294

Query: 284 SLQTEEF-VKKQLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHATSLGGIESLVEW-- 338
                +F + +    G G V +    +    +++     LK +    S G + SL+    
Sbjct: 295 LQSHPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLPC 354

Query: 339 ---RAMTDPYI------DQTLIRVSVGCESANDLIKDLASAL 371
               A  DP +       + LIR+ VG E   DL KDL +A+
Sbjct: 355 SMSHASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 180/418 (43%), Gaps = 65/418 (15%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ +   PP+ +STTF+ D ++       ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQDYD-------YSRSGNPT 54

Query: 64  STRLESIFSEIL---DGYAVIYSSGLAAF---YAAMVHYN------PKKIFIGQSYHGVR 111
            + L++   ++        +  SSG+ A       +V  N      P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIL------------TRNYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESL 159
            + N              T N+   +   + ++K     D V LESP NP     DI  +
Sbjct: 115 RLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKV----DCVLLESPTNPLCKVVDIPKI 170

Query: 160 AR--RAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVV 213
            R  +  +    +IVD+T  S     PLQ   N   D+V  SATKY  GH DL+ GV++ 
Sbjct: 171 LRYVKCVSPDTKVIVDNTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIIS 228

Query: 214 KEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----H 269
           K    + +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  L  +L D     
Sbjct: 229 KTAEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFK 288

Query: 270 QSEFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHA 326
            +  +K  KT +       +F + +    G G V +    + E  K+L    KL  +   
Sbjct: 289 PTATNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVT 348

Query: 327 TSLGGIESLVEW-----RAMTDPYI------DQTLIRVSVGCESANDLIKDLASALKE 373
            S G + SL+        A  DP +       + L+R+  G E+  DL KDL +A+ E
Sbjct: 349 VSFGCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDLLAAMVE 406

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 98/391 (25%), Positives = 169/391 (43%), Gaps = 55/391 (14%)

Query: 23  PPINVSTTFR---YDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILD--- 76
           PPI  STTF+    +DD   P+              Y+R  +P  T ++    ++ D   
Sbjct: 25  PPIYQSTTFKIGSLEDDASQPYD-------------YTRSGNPTRTVVQHQIGKLYDVDA 71

Query: 77  GYAVIYSSGLAAF---YAAMVHYNPKK---IFIGQSYHG--VRAIANILTRNYGIEQH-- 126
              +  SSG+ A      A+V  N  +   I  G   +G   R + ++ +RN+    H  
Sbjct: 72  AQVLAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQRLLTHLESRNHARVLHVD 131

Query: 127 -----PLEDIEKCASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKGALLIVDSTFASP 179
                   ++ K     D V LESP NP    +D+  L    ++  +  L+ +D+T  S 
Sbjct: 132 TANYETFVEVFKQQEHVDCVLLESPTNPLLKVADLPRLTHFIKSANEACLVAIDNTMMSG 191

Query: 180 PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESF 239
            L     F  D+V  SATKY  GH D+++G++V +    ++++       G+ ++  +S+
Sbjct: 192 MLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQEIYFVINSTGSGLSPFDSW 251

Query: 240 MLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDK-----VLKTIYHSSLQTEEF-VKK 293
           +L+R L+T  +R+ +Q  NA  L  +L +      K       +T +       +F + K
Sbjct: 252 LLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGKKGVKGSPRTRFVGLKSHPQFELHK 311

Query: 294 QLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHATSLGGIESLVEW-----RAMTDPYI 346
               G G V +    + E  ++L    K+K +    S G + SL+        A  DP +
Sbjct: 312 SFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCVNSLISMPCKMSHAAIDPAL 371

Query: 347 DQT------LIRVSVGCESANDLIKDLASAL 371
            Q       L+R+  G E+ +DL  DL  A+
Sbjct: 372 RQERDFPEDLVRLCCGIENISDLQNDLLEAM 402

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 101/389 (25%), Positives = 172/389 (44%), Gaps = 50/389 (12%)

Query: 22  APPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILD--GYA 79
            PP+  STTF+    +          D  +++  Y+R  +P  + L+   +++ +  G+ 
Sbjct: 24  VPPLYQSTTFKQSSLE----------DDADQEYDYTRSGNPTRSVLQEQIAKLYNVPGFQ 73

Query: 80  VI-YSSG-------LAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTR-NYGIEQH-PLE 129
           V   SSG       L A      ++ P  I     Y G + +   L R N+    H    
Sbjct: 74  VFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQRLLTFLERKNHARVIHVDTT 133

Query: 130 DIEKCASEG------DIVHLESPVNPYGTSSDIESLAR---RAHAKGALLIVDSTFASPP 180
           D +K  S        D V LESP NP    +D+  L +   +A+ K   ++VD+T  S  
Sbjct: 134 DFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQANPK-CHVVVDNTMVSGL 192

Query: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240
                 F  D+V  S TKY  GH D+++GV++ + +  +++L       G  ++ ++ ++
Sbjct: 193 NCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQELYFVINSTGCGLSPMDCWL 252

Query: 241 LLRSLRTYEMRITKQSENATKLVRFLSD----HQSEFDKVLKTIYHSSLQTEEF-VKKQL 295
           L+R L+T  +R+ +Q  NA  L R+L        +  +K+L+T Y       +F + +  
Sbjct: 253 LIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLLRTRYVGLKSHPQFELHRSF 312

Query: 296 VGGYGPVFAITLYTKEQCKQL--PLKLKYFHHATSLGGIESLVEW-----RAMTDPYI-- 346
             G G V +    + E  K+L    KLK +    S G + SL+        A  DP +  
Sbjct: 313 NKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSLISMPCKMSHASIDPELRK 372

Query: 347 ----DQTLIRVSVGCESANDLIKDLASAL 371
                + L+R+  G E   DL KDL +A+
Sbjct: 373 ERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 111/417 (26%), Positives = 176/417 (42%), Gaps = 68/417 (16%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
           L+T+L+     D   + V PP+  STTF+    D     + +  D       Y+R  +P 
Sbjct: 6   LNTSLVSVSHNDKYGSSV-PPLYQSTTFKASSFD-----QLQEYD-------YTRSGNPT 52

Query: 64  STRLESIFSEILDG-----YAVIYSSGLAAFYAAM------VHYNPKKIFIGQSYHGVRA 112
            T L+   + + D      +AV  SSG+ A    +        + P  I     Y G + 
Sbjct: 53  RTVLQQQIANLYDVAPEQVFAV--SSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQR 110

Query: 113 IANIL-TRNYGIEQHP-LEDIE------KCASEGDIVHLESPVNPYGTSSDIESLARRAH 164
           +   L TRN+    H    D E          + DIV LESP NP    +D+  L +   
Sbjct: 111 LLTFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVK 170

Query: 165 AKG-----ALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATS 219
            KG       ++VD+T  S        FGAD+V  S TKY  GH D+++GV++ K++   
Sbjct: 171 QKGGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIAKKDVAP 230

Query: 220 RQLKDDRIYL-----GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD----HQ 270
                  +Y      G  ++ ++S++L+R L+T  +R+ KQ  NA  L  +L D      
Sbjct: 231 ------SVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKP 284

Query: 271 SEFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITL--YTKEQCKQLPLKLKYFHHAT 327
           ++ ++ LKT +       +F + K    G G V +I        +      +L  +    
Sbjct: 285 TDNNQQLKTRFVGLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTSKRLNIWAVTV 344

Query: 328 SLGGIESLVEW-----RAMTDPYIDQT------LIRVSVGCESANDLIKDLASALKE 373
           S G + SL+        A  DP + +       LIR+  G E   DL  DL +A +E
Sbjct: 345 SFGCVNSLISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFEE 401

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 105/395 (26%), Positives = 168/395 (42%), Gaps = 38/395 (9%)

Query: 3   DLSTAL-IHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAH 61
           D++T L + G + D +   V PP+   +T  +         +  +++ M+ +  Y     
Sbjct: 11  DITTQLTVIGRNPDEQNGFVNPPLYKGSTIIHK--------KLSDVESMKGRFFYGTAGS 62

Query: 62  PNSTRLESIFSEILDGYAVIYS-SGLAAFYAAMVHYNPKK--IFIGQS-YHGVRAIANIL 117
           P    LE  ++ +      + S SGL +   A++        I I  S Y   R + + L
Sbjct: 63  PTIANLEDAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTRVLCDGL 122

Query: 118 TRNYGIEQH---PL--EDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLI 171
              +GI+     P   EDIEK       ++ LESP +      DI +L   A   G   I
Sbjct: 123 LAKFGIQTEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKKHGIRTI 182

Query: 172 VDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATS--RQLKDDRIYL 229
           +D+T+A+P    A   G DI L + TKY GGHSD L G+    +E     R   D    L
Sbjct: 183 LDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDFLLGLTSANQECWPLLRSTYDAMAML 242

Query: 230 -GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTE 288
            G +   L     LR +RT  +R+ +    A  L  +L   + E + VL   +      +
Sbjct: 243 PGADDCQLA----LRGMRTLHLRLKEAERKALDLAAWLGK-RDEVETVLHPAFEDCPGHK 297

Query: 289 EFVKKQLVGGYGPVFAITL---YTKEQCKQLPLKLKYFHHATSLGGIESLV------EWR 339
            +++     G   +F+I L   +T+   + +  K+K FH   S GG ESL+      E R
Sbjct: 298 YWLRD--YKGSSGLFSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVKPAEQR 355

Query: 340 AMTDPYIDQTLIRVSVGCESANDLIKDLASALKEL 374
              +       +R+ VG E  +DL +DL    + L
Sbjct: 356 KPHNWPHRGFALRIQVGLEELSDLKRDLELGFERL 390

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 125/264 (47%), Gaps = 36/264 (13%)

Query: 140 IVHLESPVNPYGTSSDIESLAR--RAH--AKGALLIVDSTFASPPLQYAWNFGADIVLYS 195
            V LESP NP    +D+  L    ++H    G  ++VD+T  S         GAD+V  S
Sbjct: 160 CVLLESPTNPLMKVADLPKLISFVKSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYES 219

Query: 196 ATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIY----LGTNVANLESFMLLRSLRTYEMR 251
           ATK+  GH D+++GV+V    A S +L  D  +    +G  +A ++S++L+R L+T  +R
Sbjct: 220 ATKFLNGHHDIMAGVIV----AASVELAQDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVR 275

Query: 252 ITKQSENATKLVRFLSDH----QSEFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFA-- 304
           + +Q  NA  L  +L D      +E +  L+T +       +F + +    G G V +  
Sbjct: 276 MYQQQHNAMVLAHWLQDSCGFAPTEQNSQLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIE 335

Query: 305 ---ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEW-----RAMTDPYI------DQTL 350
              I L  K  C +   K KY++   S G + SL+        A  DP +       + L
Sbjct: 336 TGDIELSEKIVCSK---KFKYWNVTVSFGCVNSLISMPCKMSHASIDPELRKDRKFPEDL 392

Query: 351 IRVSVGCESANDLIKDLASALKEL 374
           IR+  G E  +DL  DL  A +++
Sbjct: 393 IRICCGIEDVSDLQWDLLGAFEDV 416

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 109/415 (26%), Positives = 177/415 (42%), Gaps = 68/415 (16%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFR---YDDDDLIPWTERENLDFMEKKPVYSRLA 60
           L + + H D   + V    PPI  STTF+    +DD   P+              Y+R  
Sbjct: 12  LVSVVQHSDQHGSSV----PPIYQSTTFKIGSLEDDASQPYD-------------YTRSG 54

Query: 61  HPNSTRLESIFSEI--LDGYAVI-YSSGLAAF---YAAMV----HYNPKKIFIGQSYHGV 110
           +P  T ++    ++  +D   V+  SSG+ A      A+V     Y P  I     Y G 
Sbjct: 55  NPTRTVVQHQIGKLYGVDASQVLAVSSGMTALDVILRALVLTNNSYVPTIIAGDDLYGGT 114

Query: 111 RAIANIL-TRNYGIEQH-------PLEDIEKCASEGDIVHLESPVNPYGTSSDIESLAR- 161
           + +   L +RN+    H           +       D V LESP NP    +D+  + R 
Sbjct: 115 QRLLTYLESRNHARVLHVDTTNYDAFTALFNAQPRVDCVLLESPTNPLLKVADLPRITRF 174

Query: 162 -RAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSR 220
            +   +  ++ +D+T  S  L    +F  D+V  SATKY  GH D+++G++V    A S 
Sbjct: 175 VKQSNEKCVVAIDNTMMSGMLCNPLHFHCDVVYESATKYLNGHHDIMAGIVV----ARSA 230

Query: 221 QLKDDRIYL----GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSD------HQ 270
           QL  +  ++    G  ++  +S++L+R L+T  +RI +Q  NA  L  +L +      H 
Sbjct: 231 QLAGEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQHNAMVLAHWLENSCGFVSHG 290

Query: 271 SEFDKVLKTIYHSSLQTEEF-VKKQLVGGYGPVFAITLYTKEQCKQL--PLKLKYFHHAT 327
            +    L+T +       EF + K    G G V +    + E  ++L    K+K +    
Sbjct: 291 KKGKGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGSFEHSRRLVSSKKIKLWAVTV 350

Query: 328 SLGGIESLVEW-----RAMTDPYIDQT------LIRVSVGCESANDLIKDLASAL 371
           S G + SL+        A  DP + Q       L+R+  G E+  DL  DL  A+
Sbjct: 351 SFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENIVDLQNDLLEAM 405

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 95/354 (26%), Positives = 151/354 (42%), Gaps = 29/354 (8%)

Query: 45  ENLDFMEKKPVYSRLAHPNSTRLESIFSEILDGYAVIYS-SGLAAFYAAMVHYNPKK--I 101
           E+L+  + +  Y     P    LE  ++ +      + S SGL +   A++  +     I
Sbjct: 46  EDLEQRKGRFFYGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHI 105

Query: 102 FIGQS-YHGVRAIANILTRNYGIEQHPL-----EDIEKCASEGD-IVHLESPVNPYGTSS 154
            I  S Y   R + + L   +GIE         EDIEK       ++ LESP +      
Sbjct: 106 LITDSVYFPTRMLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQ 165

Query: 155 DIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK 214
           +I +L   A   G   I+D+T+A+P    A   G DI L + TKY GGHSDLL G++   
Sbjct: 166 NIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLGLVSAN 225

Query: 215 EEATS--RQLKDDRIYL-GTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQS 271
           EE     R   D    L G +    +  + LR +RT  +R+ +    A  L  +    + 
Sbjct: 226 EECWPLLRSTYDAMAMLPGAD----DCLLALRGMRTLHLRLKEAERKALDLAAWFK-KRD 280

Query: 272 EFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITL---YTKEQCKQLPLKLKYFHHATS 328
           E +KVL   +      E +V+     G   +F+I L   +T+   + +   +K F    S
Sbjct: 281 EVEKVLHPAFEDCPGHEYWVRD--YKGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYS 338

Query: 329 LGGIESLV-----EWRAMTDPYIDQTL-IRVSVGCESANDLIKDLASALKELQD 376
            GG +SL+       +    P+      +R+ VG E   DL +DL    + L +
Sbjct: 339 WGGYDSLITPVNPPTQRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERLTE 392

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 179/447 (40%), Gaps = 107/447 (23%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           DD  NR   V  PI  +T++ ++D +        NL F  K P  VYSR  +P    LE 
Sbjct: 18  DDNANRPRAV--PIYATTSYVFNDSE-----HGSNL-FGLKVPGYVYSRFQNPTQNVLEE 69

Query: 70  IFSEILDGYA-VIYSSGLAA---FYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQ 125
             + +  G A V  +SG AA       + H     I     Y G      +  +  GIE 
Sbjct: 70  RMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGTYNQFKVAFKRLGIEA 129

Query: 126 HPL-----EDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS- 178
             +     +D EK   +    V+LES  NP     D E +   AH  G  ++VD+TF + 
Sbjct: 130 RFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAHKHGVPVVVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV---------------------- 212
                P++Y    GADIV +SATK+ GGH   ++G++V                      
Sbjct: 190 GFFCQPIKY----GADIVTHSATKWIGGHGTTIAGMIVDSGKFPWADYPEKFPQFSKPAE 245

Query: 213 -----VKEEATS----------RQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSE 257
                +  EA              L+D    LG  ++   +F+L++ + T  +R  +  +
Sbjct: 246 GYHGTIFNEAYGNLAYIVHVRVELLRD----LGPAISPFAAFLLIQGIETLSLRGERHGQ 301

Query: 258 NATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA-----ITLYTKEQ 312
           NA KL ++L   QS +   +      S    E  KK L  G+G V +     I   TKE+
Sbjct: 302 NALKLAQWL--EQSPYVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSFGVKDIPGQTKEE 359

Query: 313 CKQLPL---------KLKYFHHATSLGGIESLVEWRAMTDPY----------------ID 347
               P           LK   +  ++G  ++LV       PY                + 
Sbjct: 360 LAAKPFSASGAQVVDSLKLASNLANVGDSKTLV-----IAPYFTTHEQLDDDEKLLSGVT 414

Query: 348 QTLIRVSVGCESANDLIKDLASALKEL 374
           + LIRVSVG E  +D+I D   + +++
Sbjct: 415 KDLIRVSVGTEFIDDIIADFQQSFEKV 441

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 159/354 (44%), Gaps = 31/354 (8%)

Query: 45  ENLDFMEKKPVYSRLAHPNSTRLESIFSEILDGYAVIYS-SGLAAFYAAM--VHYNPKKI 101
           E+L+ +  +  Y     P    LE  ++E+      + S +GL +   A+  V  +   I
Sbjct: 46  ESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHI 105

Query: 102 FIGQSYHGVRA-IANILTRNYGIEQH---PL--EDIEK-CASEGDIVHLESPVNPYGTSS 154
            +  S +G  A   N + R +G+      PL  +DIE+   +   ++ LESP +      
Sbjct: 106 LLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQ 165

Query: 155 DIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK 214
           D+ ++ + A       ++D+T+A+P    A ++G DI + + TKY GGHSDLL G+    
Sbjct: 166 DVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLGL---- 221

Query: 215 EEATSR---QLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQS 271
             A SR    L+     +G      +  + LR LRT ++R+ +    A  L  +L + ++
Sbjct: 222 TSANSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWL-EARN 280

Query: 272 EFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITL---YTKEQCKQLPLKLKYFHHATS 328
           E +++L   +        +V+     G   VF   L   +++   K +  K++ F    S
Sbjct: 281 EVERILHPAFEDCPGHSLWVRD--YSGSTGVFTFILKDQFSRAGLKDMLEKMQIFKLGYS 338

Query: 329 LGGIESLV-------EWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQ 375
            GG ESL+         R  T  +    L R+ VG E  +D ++DL    + L+
Sbjct: 339 WGGYESLLIPVNSTSRDRIRTWSHFGYAL-RIQVGLEDIDDQLRDLEMGFERLK 391

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 96/388 (24%), Positives = 171/388 (44%), Gaps = 53/388 (13%)

Query: 24  PINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILD---GYAV 80
           P+ +STTF+ D D+     E +  D       YSR  +P  + L+    ++ +    + +
Sbjct: 29  PLYLSTTFKVDLDN----PESQVFD-------YSRSGNPTRSLLQYQIGKLYEVPVEHVL 77

Query: 81  IYSSGLAAF--------YAAMVHYNPKKIFIGQSYHGV--RAIANILTRNYGIEQH-PLE 129
             +SG+ A          ++  H     I  G   +G   R +A + ++++    H    
Sbjct: 78  AVASGMTALDVILRGLVISSATHV--PTIIAGDDLYGGSNRLLAYLESKSHARAVHVDTT 135

Query: 130 DIEKCAS------EGDIVHLESPVNPYGTSSDIESLAR--RAHAKGALLIVDSTFASPPL 181
           D+EK  +      + D V LESP NP     D+  L    +  +   ++IVD+T  S   
Sbjct: 136 DMEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRISPSTVVIVDNTMMSGLQ 195

Query: 182 QYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFML 241
                +G D+V  SATKY  GH D++ G++V K    ++++       G+ ++ ++S++L
Sbjct: 196 CNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDSWLL 255

Query: 242 LRSLRTYEMRITKQSENATKLVRFLSD----HQSEFDKVLKTIYHSSLQTEEF-VKKQLV 296
            R L+T  +R+ +Q  N+  + ++L +      +E +  LKT Y        F + +   
Sbjct: 256 NRGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSALKTRYVGLKTNPGFELHRSFN 315

Query: 297 GGYGPVFAITLYTKEQCKQLPLK--LKYFHHATSLGGIESLVEW-----RAMTDPYIDQT 349
            G G V +    + E  +++      + F    S G + SL+        A  DP + + 
Sbjct: 316 KGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDPEVRKQ 375

Query: 350 ------LIRVSVGCESANDLIKDLASAL 371
                 LIR+ VG E   DL KDL  A+
Sbjct: 376 REFPEDLIRLCVGIEDVGDLQKDLLYAM 403

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 115/442 (26%), Positives = 176/442 (39%), Gaps = 102/442 (23%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           D  DN     A PI  +T++ +DD      ++  +  F  + P  VYSR  +P S  LE 
Sbjct: 16  DAGDNAHRPRAVPIYATTSYVFDD------SKHGSQLFGLEVPGYVYSRFQNPTSNVLEE 69

Query: 70  -IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQ 125
            I +      A+  +SG AA   A   + H     +     Y G      +  + +GIE 
Sbjct: 70  RIAALEGGAAALAVASGQAAQTLAIQGLAHNGDNIVATSYLYGGTYNQFKVAFKRFGIEA 129

Query: 126 HPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS- 178
             +E     D EK   E    V+LES  NP     D E +   AH  G  ++VD+TF + 
Sbjct: 130 RFVEGDNQDDFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV---------------------- 212
                P++Y    G DIV +SATK+ GGH   L GV++                      
Sbjct: 190 GFFCQPIKY----GVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDYPEKFPQFSKPAE 245

Query: 213 -----VKEEA----------TSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSE 257
                +  EA           +  L+D    LG+ ++   +F+LL+ + T  +R  +  E
Sbjct: 246 GYHGTIYNEAYGNLAYIVHVRTELLRD----LGSLMSPFAAFLLLQGVETLSLRGERHGE 301

Query: 258 NATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV--FAITLYTKEQCKQ 315
           NA KL ++L   QS +   +      S    E  KK L  G+G +  F +        + 
Sbjct: 302 NALKLAKWLE--QSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFGVKDLPNADTET 359

Query: 316 LPLK---------LKYFHHATSLGGIESLVEWRAMTDPY----------------IDQTL 350
            P K         LK   +  ++G  ++LV       PY                + + L
Sbjct: 360 DPFKLSGAQVVDNLKIASNLANVGDSKTLV-----IAPYFTTHQQLNDEEKLASGVTKDL 414

Query: 351 IRVSVGCESANDLIKDLASALK 372
           IRVSVG E  +D+I D   + +
Sbjct: 415 IRVSVGTEFIDDIINDFQQSFE 436

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 183/456 (40%), Gaps = 105/456 (23%)

Query: 2   VDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRL 59
           V L     + DD  NR   V  PI  +T++ ++D      ++     F  + P  VYSR 
Sbjct: 8   VQLHAGQENPDDNKNRPRAV--PIYATTSYVFND------SKHGAQLFGLEVPGYVYSRF 59

Query: 60  AHPNSTRLESIFSEILDGYA-VIYSSGLAA---FYAAMVHYNPKKIFIGQSYHGVRAIAN 115
            +P +   E   + +  G A V  SSG AA     + + H     +     Y G      
Sbjct: 60  QNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTYNQFK 119

Query: 116 ILTRNYGIEQHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAHAKGAL 169
           +  +  G+E   ++     D EK   E    V+LES  NP     D E +   AH  G  
Sbjct: 120 VAFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHKHGIP 179

Query: 170 LIVDSTFAS-----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKD 224
           ++VD+TF +      PL+    FGADIV +SATK+ GGH   ++GV+V   +   +   +
Sbjct: 180 VVVDNTFGAGGFFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWKDYPE 235

Query: 225 -----------------DRIY----------------LGTNVANLESFMLLRSLRTYEMR 251
                            +  Y                LG  +    +F+LL+ + T  +R
Sbjct: 236 KFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVETLSLR 295

Query: 252 ITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITL- 307
             + + NA  L ++L     E    +  + +  L++    E  KK L  G+G V +  + 
Sbjct: 296 CERHASNALALAKWL-----EKSPYVSWVSYPGLESHSHHENAKKYLSNGFGGVLSFGVK 350

Query: 308 ----YTKEQCKQLPL---------KLKYFHHATSLGGIESLVEWRAMTDPY--------- 345
                ++E+ K+ P           L+   +  ++G  ++LV       PY         
Sbjct: 351 DLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLV-----IAPYFTTHQQLDD 405

Query: 346 -------IDQTLIRVSVGCESANDLIKDLASALKEL 374
                  + + LIRVSVG E  +D+I D   + +++
Sbjct: 406 DEKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 110/438 (25%), Positives = 174/438 (39%), Gaps = 92/438 (21%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLD-FMEKKP--VYSRLAHPNSTRLE 68
           D  DN     A PI  +T++ ++D        +   D F  K P  VY R  +P    LE
Sbjct: 16  DPNDNNHRPRAVPIYATTSYVFED-------SKHGADLFGLKVPGYVYGRFQNPTQAVLE 68

Query: 69  S-IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIE 124
             + +      A+  +SG AA   A   + H     +     Y G      +  + +GIE
Sbjct: 69  DRLAALEGGAAALATASGQAAQTLAIQGLAHCGDNIVSTSFLYGGTYNQFKVAFKRFGIE 128

Query: 125 QHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS 178
              +E     D EK   E    V+LES  NP     D E +   AH  G  ++VD+TF +
Sbjct: 129 ARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGA 188

Query: 179 -----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKD--------- 224
                 PL+Y    GADIV +SATK+ GGH   L G++V   +   +   +         
Sbjct: 189 GGFFCQPLKY----GADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKDYPEKFPQFSKPA 244

Query: 225 ----DRIY--------------------LGTNVANLESFMLLRSLRTYEMRITKQSENAT 260
                 IY                    LG+ ++   +F+L++ + T  +R  +  +NA 
Sbjct: 245 EGYHGTIYNEAYGNLAYIVHVRTELLRDLGSMISPFAAFLLIQGVETLSLRGERHGQNAL 304

Query: 261 KLVRFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPV--FAITLYTKEQCKQ 315
           KL ++L     E    +  + +  L +    E  KK L  G+G +  F +        + 
Sbjct: 305 KLAKWL-----EASPYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFGVKDLPNAATET 359

Query: 316 LPLK---------LKYFHHATSLGGIESLVEWRAMTD-----------PYIDQTLIRVSV 355
            P K         LK   +  ++G  ++LV     T              + + LIRVSV
Sbjct: 360 DPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLADEEKLASGVTKDLIRVSV 419

Query: 356 GCESANDLIKDLASALKE 373
           G E  +D+I+D   A ++
Sbjct: 420 GTEYIDDIIEDFKQAFEK 437

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 107/438 (24%), Positives = 181/438 (41%), Gaps = 91/438 (20%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           D  DN     A PI  +T+F ++D      +      F  +KP  +YSR+ +P    LE 
Sbjct: 16  DPGDNAHRPAAVPIYQTTSFVFED------SHHGAQLFGLEKPGYMYSRVGNPTVDVLEK 69

Query: 70  -IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIE- 124
            + +      AV  SSG AA   A   + H     +     Y G      +  +  GI+ 
Sbjct: 70  RLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQFKVAFKRLGIDV 129

Query: 125 -----QHPLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS 178
                 +P ED EK   E    V++ES  NP     D E +   AH  G  ++VD+TF +
Sbjct: 130 RFVLGDNP-EDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGA 188

Query: 179 -----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV------------------VKE 215
                 P+++    G DIV +SATK+ GGH   ++GV+V                     
Sbjct: 189 GGFFCQPIKH----GVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDYPEKFPQFSKPS 244

Query: 216 EATSRQLKDDRIY---------------LGTNVANLESFMLLRSLRTYEMRITKQSENAT 260
           E     + +D +                LG  +  + +F+LL+ + T  +R  +Q +NA 
Sbjct: 245 EGYHGMIFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLSLRAERQGQNAL 304

Query: 261 KLVRFLSDHQSEFDKVLKTIYHSSLQTEEF---VKKQLVGGYGPVFAITLYT-------- 309
           KL ++L     E    +  + +  L +  +    KK L  G+G V +I +          
Sbjct: 305 KLAQWL-----EKSPHVNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIGVKPLKDVSDSD 359

Query: 310 --KEQCKQLPLKLKYFHHATSLGGIESLV------EWRAMTD-----PYIDQTLIRVSVG 356
             K+   Q+   LK   +  ++G  ++LV        + ++D       + + LIR+S+G
Sbjct: 360 PFKKSGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSGVTEDLIRISIG 419

Query: 357 CESANDLIKDLASALKEL 374
            E  +D+I D   + +++
Sbjct: 420 TEFIDDIIADFEQSFEKV 437

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 124/293 (42%), Gaps = 17/293 (5%)

Query: 52  KKPVYSRLAHPNSTRLESIFSEILDGYAVIYS-SGLAAFYAAMVHYNPKK---IFIGQSY 107
           K   Y     P    LE+ ++ +  G   + S SGL +   A++  +      +     Y
Sbjct: 52  KGRFYGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVY 111

Query: 108 HGVRAIANILTRNYGIEQHPLE-----DIEKCASEGD-IVHLESPVNPYGTSSDIESLAR 161
              R + + L   +G+E    +     DIEK       ++ LESP +      DI +L  
Sbjct: 112 VPTRMLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVS 171

Query: 162 RAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQ 221
            A   G   I+D+T+A+P    A   G DI + + TKY GGHSDLL G+    EE     
Sbjct: 172 VAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWP-L 230

Query: 222 LKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIY 281
           L+     +       +  + LR +RT  +R+ +    A  L  +L + + E +KVL   +
Sbjct: 231 LRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGN-RDEVEKVLHPAF 289

Query: 282 HSSLQTEEFVKKQLVGGYGPVFAITL---YTKEQCKQLPLKLKYFHHATSLGG 331
                 E +V+     G   +F+I L   +T+   +++   +K      S GG
Sbjct: 290 EDCPGHEYWVRD--YKGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 110/438 (25%), Positives = 179/438 (40%), Gaps = 109/438 (24%)

Query: 22  APPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLESIFSEILDGY- 78
           A PI  +T++ +DD      ++  +  F  + P  +YSR+ +P +   E   + +  G  
Sbjct: 26  AVPIYSTTSYVFDD------SKHGSQLFGLETPGYIYSRIMNPTADVFERRIAALEGGVG 79

Query: 79  AVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQHPLEDIEKCA 135
           A+  SSGLAA   A   + H     +     Y G      I  + +GIE   +E  +   
Sbjct: 80  ALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKIAFKRFGIESRFIEGDDPSG 139

Query: 136 SEGDI------VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS-----PPLQYA 184
            E  I      V+LE+  NP     D E +   AH  G  ++VD+TF +      P+++ 
Sbjct: 140 LEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGVPVVVDNTFGAGGYYCQPIKH- 198

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLV---------------------------VKEEA 217
              GAD+V++SATK+ GGH   + GV+V                           V  EA
Sbjct: 199 ---GADVVVHSATKWIGGHGTTIGGVIVDSGNFPWKEYPKKFPQFSEPSEGYHGLVFNEA 255

Query: 218 TSRQ----------LKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLS 267
              Q          L+D    LG +++   +F+LL+ L T  +R  + + NA KL ++L 
Sbjct: 256 LGNQAFIGHVRAELLRD----LGPSLSPFAAFLLLQGLETLSLRAERHASNALKLAQWL- 310

Query: 268 DHQSEFDKVLKTIYHSSLQTEEF---VKKQLVGGYGPVFAIT---LYTKEQCKQLPLK-- 319
               E    +  + +  L         KK L  G+G V +     L    + K+ P K  
Sbjct: 311 ----EKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVLSFGAKDLPDNPEEKENPFKAA 366

Query: 320 -------LKYFHHATSLGGIESLVEWRAMTDPY----------------IDQTLIRVSVG 356
                  L+   +  ++G  ++LV       PY                + + LIRVSVG
Sbjct: 367 GAQISDNLELASNLANVGDCKTLV-----IAPYFTTHLQLNHEEKLAAGVSKDLIRVSVG 421

Query: 357 CESANDLIKDLASALKEL 374
            E  +D+I D   + K++
Sbjct: 422 TEFIDDIIADFEQSFKKV 439

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 107/444 (24%), Positives = 174/444 (39%), Gaps = 108/444 (24%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           D  +N  +  A PI  +T++ ++D      ++     F  + P  +YSR+ +P +  LE 
Sbjct: 16  DAAENANSPRAVPIYATTSYVFND------SKHGAQLFGLEAPGFIYSRIMNPTNDVLEK 69

Query: 70  -IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQ 125
            I +      A+  +SG AA   A   + H     +     Y G      +  +  GIE 
Sbjct: 70  RIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGSYNQFKVAFKRLGIEC 129

Query: 126 HPLE-----DIE-KCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS- 178
             +E     D E +  S+   V LES  NP     D E +   AH  G  ++VD+TF + 
Sbjct: 130 RFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAHRHGIPVVVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV---------------------- 212
                P++    FGADIV +SATK+ GGH   + G++V                      
Sbjct: 190 GYFCQPIK----FGADIVTHSATKWIGGHGTAIGGLVVDSGKFPWKDYPAKFPQFSEPSE 245

Query: 213 -----VKEEATS----------RQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSE 257
                V  EA              L+D    LG  ++   +F+ L+ L T  +R  +  +
Sbjct: 246 GYHGLVLNEALGPLAFVGHARIELLRD----LGPALSPFAAFLFLQGLETLSLRAERHGQ 301

Query: 258 NATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVK---KQLVGGYGPVFAITLYT----- 309
           NA  L ++L     E    +  + +  L++ +++    + L  GYG V +  +       
Sbjct: 302 NALALAKYL-----ETSAYVSWVSYPGLESHDYLSNATRYLQNGYGGVLSFGVKPLPDTD 356

Query: 310 ------KEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------------ID 347
                 K    Q    LK+  +  ++G  ++LV       PY                + 
Sbjct: 357 EEADPFKAAGAQFVDNLKFASNLANVGDSKTLV-----IAPYFTTHQQLSESEKLASGVT 411

Query: 348 QTLIRVSVGCESANDLIKDLASAL 371
           + LIRVSVG E   D+I D   A 
Sbjct: 412 RDLIRVSVGTEYLQDIIADFEQAF 435

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 107/425 (25%), Positives = 176/425 (41%), Gaps = 84/425 (19%)

Query: 22  APPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES-IFSEILDGY 78
           A PI  +T++ +DD      ++     F  +KP  +YSR+ +P +  LE  + +      
Sbjct: 26  AVPIYATTSYVFDD------SKYGAEIFGLEKPGFIYSRIMNPTNDVLERRLAALEGGAA 79

Query: 79  AVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQHPLE-----D 130
           A+  +SG AA   A   + H     +     Y G      +  +  GIE   +E     D
Sbjct: 80  ALAVASGQAAQTLAITGLAHSGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVEGDAPED 139

Query: 131 IEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS-----PPLQYA 184
            EK   E    V+LE+  NP     D + +   AH  G  ++VD+TF +      P++Y 
Sbjct: 140 FEKLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIKY- 198

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLV------VKE--EATSRQLKDDRIY-------- 228
              GADIV +SATK+ GGH   ++G ++       KE  E   +  K    Y        
Sbjct: 199 ---GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFNEA 255

Query: 229 -----------------LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQS 271
                            LG  ++   SF+LL+ + T  +R  +Q EN   L ++L   +S
Sbjct: 256 MGNLAFIGHVRTELLRDLGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWL--EKS 313

Query: 272 EFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV--FAITLYTKEQCKQLPLK---------L 320
            +   +      S    E  KK L  G+G V  F +        ++ P K         L
Sbjct: 314 AYVSWVSYPGLVSHSHHENAKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGAQAVDNL 373

Query: 321 KYFHHATSLGGIESLV------EWRAMTD-----PYIDQTLIRVSVGCESANDLIKDLAS 369
           K   +  ++G  ++LV        + ++D       + + LIRVSVG E  +D+I D   
Sbjct: 374 KLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDIIADFQQ 433

Query: 370 ALKEL 374
           + +++
Sbjct: 434 SFEKI 438

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 121/262 (46%), Gaps = 41/262 (15%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V LE+P NP     D++ L   A+  G  ++VD T        L Y     ADIV  S T
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNVDVLPY-----ADIVCTSLT 374

Query: 198 KYFGGHSDLLSGVLVVKEEAT--SRQLKDDRIYLGTNVANLESFMLLRS-LRTYEMRITK 254
           K F G S+++ G +++  ++   S  L+  R      +  LE  ++L +  R +E R T+
Sbjct: 375 KLFSGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTR 434

Query: 255 QSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLYT 309
            +EN  KL++ +     E  K+ K +Y+ ++ ++E  K     +   GGYG +F+++ + 
Sbjct: 435 TNENTMKLIQEV--LLPEEGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFN 492

Query: 310 KEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIRV 353
           +E  K      K+++  T   G  +   +  +  PY+                  +L+RV
Sbjct: 493 EEDAK------KFYNSLTVFKGPSNGTNF-TLACPYVHLAHHFELEEVSTFGAHSSLVRV 545

Query: 354 SVGCESANDLIKDLASALKELQ 375
           SVG E+   L+   +S +  L+
Sbjct: 546 SVGLENTQWLLNAFSSVINLLR 567

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 105/440 (23%), Positives = 169/440 (38%), Gaps = 94/440 (21%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           D   N     A PI  +T++ ++D      ++     F  + P  +YSR+ +P     E 
Sbjct: 16  DASTNANNPNAVPIYATTSYVFND------SKHGAQLFGLETPGYIYSRIMNPTVDVFEK 69

Query: 70  IFSEILDGYAVI-YSSGLAAFYAA---MVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQ 125
             + +  G A +  SSG AA   A   + H     +     Y G      +  +  GI  
Sbjct: 70  RIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKVAFKRLGINV 129

Query: 126 HPLE-----DIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS- 178
             +E     D EK   E    V+LE+  NP     D E +   AH  G  ++VD+TF + 
Sbjct: 130 KFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKHGIPVVVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVK--------EEATSRQLKDDR 226
                P++Y    G DIV +SATK+ GGH   ++G ++           E   +  K   
Sbjct: 190 GYFCQPIKY----GCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPERFPQFSKPSE 245

Query: 227 IY-------------------------LGTNVANLESFMLLRSLRTYEMRITKQSENATK 261
            Y                         LG  +    +F+LL+ + T  +R  +  EN  K
Sbjct: 246 GYHGLVFNDAFGPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSLRGERHGENTLK 305

Query: 262 LVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV--FAITLYTKEQCKQLPLK 319
           L ++L   +S +   +      S    E  KK L  G+G V  F +        ++ P K
Sbjct: 306 LAKWLE--KSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNASDEKDPFK 363

Query: 320 ---------LKYFHHATSLGGIESLVEWRAMTDPY----------------IDQTLIRVS 354
                    LK   +  ++G  ++LV       PY                + + LIRVS
Sbjct: 364 ASGAQVVDNLKLALNLANVGDSKTLV-----IAPYFTTHQQLNEEEKLASGVTKDLIRVS 418

Query: 355 VGCESANDLIKDLASALKEL 374
           VG E  +D+I D   + +++
Sbjct: 419 VGTEYIDDIIADFQQSFEKV 438

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 154/394 (39%), Gaps = 80/394 (20%)

Query: 55  VYSRLAHPNSTRLESIFSEILDGYAVI-YSSGLAA---FYAAMVHYNPKKIFIGQSYHGV 110
           +YSR+ +P    LE   + +  G   +  +SG AA      A+       +     Y G 
Sbjct: 54  LYSRMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGT 113

Query: 111 RAIANILTRNYGIEQH-----PLEDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAH 164
                +  +  G+E         ED E+   +    +++ES  NP  T  D E +   AH
Sbjct: 114 YNQLKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAH 173

Query: 165 AKGALLIVDSTFASP-----PLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATS 219
             G  ++VD+TF +      P++    FGADI+ +SATK+  GH   ++G +V       
Sbjct: 174 KHGIPVVVDNTFGAAGFFCKPIE----FGADIITHSATKWINGHGTAIAGAIVDSGNFPW 229

Query: 220 RQLKD-------------DRIY--------------------LGTNVANLESFMLLRSLR 246
            Q  D               +Y                    LG+ ++   +F+ L+ L 
Sbjct: 230 TQYPDKFPQFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLE 289

Query: 247 TYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV--FA 304
           T  +R  + + N+  L R L D  S +   +      S  +    KK L  G G +  F 
Sbjct: 290 TLSLRCERHARNSIDLARHLED--SPYVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFG 347

Query: 305 ITLYTK----EQCKQLPL---------KLKYFHHATSLGGIESLV------EWRAMTD-- 343
           I  + K    E+  ++            LK   +  ++G  ++LV        + +TD  
Sbjct: 348 IKPFDKTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEE 407

Query: 344 ---PYIDQTLIRVSVGCESANDLIKDLASALKEL 374
                 D+ +IRVSVG E  +D+I D   A K +
Sbjct: 408 KLKAGADKDVIRVSVGTEYIDDIIADFEQAFKTV 441

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 119/265 (44%), Gaps = 24/265 (9%)

Query: 128 LEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNF 187
           L+DI     +   V +E+P NP     D+  L   A+A G  ++VD T A   +      
Sbjct: 384 LKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDET-AGGFVNIDVLP 442

Query: 188 GADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLR 243
            ADIV  S TK F G S++++G +V+   +        + +   +  +L    ++  L R
Sbjct: 443 HADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFA-QQFFSSDSFEDLLWCEDAIYLER 501

Query: 244 SLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLV-----GG 298
           + R +  R    ++N  +L+  +   Q    K+ K I+  SL +EE  +   V     GG
Sbjct: 502 NSRDFATRTLTVNKNTQRLLEDVLLPQE--GKLFKKIFFPSLTSEETKRNYDVVLCPQGG 559

Query: 299 YGPVFAITLYTKEQ----------CKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQ 348
           YG +F++T Y +EQ          CK   L    F  A     +    E   +    +++
Sbjct: 560 YGGLFSLTFYREEQARVFFDVLELCKGPSLGTN-FTLACPYAILAHYAELEEVAKYGVER 618

Query: 349 TLIRVSVGCESANDLIKDLASALKE 373
           +L+RVSVG ESA  L    + A+KE
Sbjct: 619 SLVRVSVGLESAESLNHVFSHAIKE 643

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 128/319 (40%), Gaps = 91/319 (28%)

Query: 129 EDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS-----PPLQ 182
           ED EK   E    ++LES  NP     D E +   AH  G  ++VD+TF +      P++
Sbjct: 137 EDFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPIK 196

Query: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEE-------------------------- 216
           +    GADIV +SATK+ GGH   ++G ++   +                          
Sbjct: 197 W----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFN 252

Query: 217 -----------ATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRF 265
                      A +  L+D    LG  ++   SF+LL+ L T  +R  + + NA KL ++
Sbjct: 253 DAFGPLAFIGHARTELLRD----LGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQW 308

Query: 266 LSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLYT-----------KE 311
           L     E    +  + +  L++    E  KK L  G+G V +  +             K 
Sbjct: 309 L-----EKSPYVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGVKPLPNASEESDPFKA 363

Query: 312 QCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------------IDQTLIRVSV 355
              Q+   LK   +  ++G  ++LV       PY                +   LIRVSV
Sbjct: 364 SGAQVVDNLKLASNLANVGDSKTLV-----IAPYFTTHQQLSHEEKLASGVTDDLIRVSV 418

Query: 356 GCESANDLIKDLASALKEL 374
           G E  +D+I D   + +++
Sbjct: 419 GTEFIDDIIADFEQSFEKI 437

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 174/435 (40%), Gaps = 84/435 (19%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           D  +N     A PI  ++++ ++D      ++     F  +KP  +YSR+ +P     E 
Sbjct: 16  DATENAHNPRAVPIYATSSYVFND------SQHGAQLFGLEKPGYMYSRIVNPTVDVFER 69

Query: 70  IFSEILDGYAVI-YSSGLAA---FYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQ 125
             + +  G A +  +SG AA     + + H     +     Y G      +  R  GIE 
Sbjct: 70  RIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGTYNQFKVAFRRLGIET 129

Query: 126 HPLE-----DIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS- 178
             +E     D EK   +    V+LE+  NP     D E +   AH  G  ++VD+TF + 
Sbjct: 130 RFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKY-----------------------------FGGHSD 205
                P++Y    GADIV +SATK+                             F   S+
Sbjct: 190 GYFAQPIKY----GADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEYPEKFPQFSKPSE 245

Query: 206 LLSGVLVVKEEATSRQLKDDRIY----LGTNVANLESFMLLRSLRTYEMRITKQSENATK 261
              G+++         +   RI     LG  +    +F LL+ + T  +R  + + NA K
Sbjct: 246 GYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFAAFQLLQGVETLSLRCERHATNALK 305

Query: 262 LVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLYTKEQCKQL--PLK 319
           L ++L   +S +   +     SS    E  KK L  G+G V +  +       ++  P K
Sbjct: 306 LAQYLE--KSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSFGVKDLPNAHEIEDPFK 363

Query: 320 ---------LKYFHHATSLGGIESLV------EWRAMTD-----PYIDQTLIRVSVGCES 359
                    LK   +  ++G  ++LV        + +TD       + + LIRVSVG E 
Sbjct: 364 ASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEF 423

Query: 360 ANDLIKDLASALKEL 374
            +D+I D   A +++
Sbjct: 424 IDDIIGDFEQAFEKV 438

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 103/394 (26%), Positives = 154/394 (39%), Gaps = 84/394 (21%)

Query: 55  VYSRLAHPNSTRLES-IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGV 110
           VYSR  +P S  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 111 RAIANILTRNYGIEQHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAH 164
                I  + +GIE   +E     D EK   E    V+LE+  NP     D E +   AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 165 AKGALLIVDSTFAS-----PPLQYAWNFGADIVLYSATKYF------------------- 200
             G  ++VD+TF +      P++Y    GADIV +SATK+                    
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPW 230

Query: 201 ---------------GGHSDLLS---GVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242
                          G H  + +   G L       +  L+D    LG  +    SF+LL
Sbjct: 231 KDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLL 286

Query: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           + + T  +R  +  ENA KL ++L   QS +   +     +S    E  KK L  G+G V
Sbjct: 287 QGVETLSLRAERHGENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGV 344

Query: 303 --FAITLYTKEQCKQLPLK---------LKYFHHATSLGGIESLV------EWRAMTDPY 345
             F +        +  P K         LK   +  ++G  ++LV        + + D  
Sbjct: 345 LSFGVKDLPNADKETDPFKLSGAQVVDSLKLASNLANVGDAKTLVIAPYFTTHKQLNDTE 404

Query: 346 -----IDQTLIRVSVGCESANDLIKDLASALKEL 374
                + + LIRVSVG E  +D+I D   + + +
Sbjct: 405 KLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 103/394 (26%), Positives = 154/394 (39%), Gaps = 84/394 (21%)

Query: 55  VYSRLAHPNSTRLES-IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGV 110
           VYSR  +P S  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 111 RAIANILTRNYGIEQHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAH 164
                I  + +GIE   +E     D EK   E    V+LE+  NP     D E +   AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 165 AKGALLIVDSTFAS-----PPLQYAWNFGADIVLYSATKYF------------------- 200
             G  ++VD+TF +      P++Y    GADIV +SATK+                    
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPW 230

Query: 201 ---------------GGHSDLLS---GVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242
                          G H  + +   G L       +  L+D    LG  +    SF+LL
Sbjct: 231 KDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLL 286

Query: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           + + T  +R  +  ENA KL ++L   QS +   +     +S    E  KK L  G+G V
Sbjct: 287 QGVETLSLRAERHGENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGV 344

Query: 303 --FAITLYTKEQCKQLPLK---------LKYFHHATSLGGIESLV------EWRAMTDPY 345
             F +        +  P K         LK   +  ++G  ++LV        + + D  
Sbjct: 345 LSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKE 404

Query: 346 -----IDQTLIRVSVGCESANDLIKDLASALKEL 374
                + + LIRVSVG E  +D+I D   + + +
Sbjct: 405 KLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 109/442 (24%), Positives = 177/442 (40%), Gaps = 100/442 (22%)

Query: 12  DDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRLAHPNSTRLES 69
           DD ++R   V  PI  +T+F ++D      ++     F  + P  +YSR  +P +  LE 
Sbjct: 18  DDNNHRPRAV--PIYSTTSFVFND------SQHGAQLFGLEVPGYIYSRFQNPTNNVLEE 69

Query: 70  -IFSEILDGYAVIYSSGLAA---FYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQ 125
            I +      A+  SSG AA     A + H     +     Y G      +  +  GIE 
Sbjct: 70  RIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTYNQFKVAFKRLGIEA 129

Query: 126 HPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS- 178
             +E     D EK   E    V+LES  NP     D E++   AH  G  ++VD+TF + 
Sbjct: 130 RFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHKHGIPVVVDNTFGAG 189

Query: 179 ----PPLQYAWNFGADIVLYSATKYF---------------------------------- 200
                P++Y    GADIV +SATK+                                   
Sbjct: 190 GFFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSKPAE 245

Query: 201 GGHSDLLS---GVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSE 257
           G H  + +   G L       +  L+D    LG  ++   +F+LL+ + T  +R  +  +
Sbjct: 246 GYHGTVYNETYGNLAYIVHVRTELLRD----LGPGMSPFAAFLLLQGVETLSLRGERHGQ 301

Query: 258 NATKLVRFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPV--FAITLYTKEQ 312
           NA  L ++L     E +  +  + +  L +    E  KK L  G+G V  F +       
Sbjct: 302 NALALAKWL-----EKNPHVAWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNAD 356

Query: 313 CKQLPLK---------LKYFHHATSLGGIESLV------EWRAMTDPY-----IDQTLIR 352
            +  P K         LK   +  ++G  ++LV        + ++DP      + + LIR
Sbjct: 357 KETDPFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLSDPEKLASGVTKDLIR 416

Query: 353 VSVGCESANDLIKDLASALKEL 374
           VSVG E  +D+I D   +  ++
Sbjct: 417 VSVGTEFIDDIIADFEQSFAKV 438

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 102/394 (25%), Positives = 154/394 (39%), Gaps = 84/394 (21%)

Query: 55  VYSRLAHPNSTRLES-IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGV 110
           VYSR  +P S  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 111 RAIANILTRNYGIEQHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAH 164
                I  + +GIE   +E     D EK   E    V+LE+  NP     D E +   AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 165 AKGALLIVDSTFAS-----PPLQYAWNFGADIVLYSATKYF------------------- 200
             G  ++VD+TF +      P++Y    GADIV +SATK+                    
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPW 230

Query: 201 ---------------GGHSDLLS---GVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242
                          G H  + +   G L       +  L+D    LG  +    SF+LL
Sbjct: 231 KDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLL 286

Query: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           + + T  +R  +  ENA KL ++L   +S +   +     +S    E  KK L  G+G V
Sbjct: 287 QGVETLSLRAERHGENALKLAKWLE--ESPYVSWVSYPGLASHSHHENAKKYLSNGFGGV 344

Query: 303 --FAITLYTKEQCKQLPLK---------LKYFHHATSLGGIESLV------EWRAMTDPY 345
             F +        +  P K         LK   +  ++G  ++LV        + + D  
Sbjct: 345 LSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKE 404

Query: 346 -----IDQTLIRVSVGCESANDLIKDLASALKEL 374
                + + LIRVSVG E  +D+I D   + + +
Sbjct: 405 KLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 102/394 (25%), Positives = 154/394 (39%), Gaps = 84/394 (21%)

Query: 55  VYSRLAHPNSTRLES-IFSEILDGYAVIYSSGLAAFYAA---MVHYNPKKIFIGQSYHGV 110
           VYSR  +P S  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 111 RAIANILTRNYGIEQHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAH 164
                I  + +GIE   +E     + EK   E    V+LE+  NP     D E +   AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 165 AKGALLIVDSTFAS-----PPLQYAWNFGADIVLYSATKYF------------------- 200
             G  ++VD+TF +      P++Y    GADIV +SATK+                    
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPW 230

Query: 201 ---------------GGHSDLLS---GVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242
                          G H  + +   G L       +  L+D    LG  +    SF+LL
Sbjct: 231 KDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLL 286

Query: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302
           + + T  +R  +  ENA KL ++L   QS +   +     +S    E  KK L  G+G V
Sbjct: 287 QGVETLSLRAERHGENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGV 344

Query: 303 --FAITLYTKEQCKQLPLK---------LKYFHHATSLGGIESLV------EWRAMTDPY 345
             F +        +  P K         LK   +  ++G  ++LV        + + D  
Sbjct: 345 LSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKE 404

Query: 346 -----IDQTLIRVSVGCESANDLIKDLASALKEL 374
                + + LIRVSVG E  +D+I D   + + +
Sbjct: 405 KLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 114/255 (44%), Gaps = 31/255 (12%)

Query: 143 LESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS---PPLQYAWNFGADIVLYSATKY 199
           +E+P NP     D+  L + A+  G  +++D T        L YA     DIV  S TK 
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGGLNVDILPYA-----DIVCTSLTKL 358

Query: 200 FGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN-----VANLESFMLLRSLRTYEMRITK 254
           F G S+++ G L++  +  S      R ++ ++     +   ++ +L  + R +E R  +
Sbjct: 359 FNGSSNVMGGSLILNPK--SSLYSSARAFVESDGFEDLLWCEDAKVLEINSRDFEDRTVR 416

Query: 255 QSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLYT 309
            ++N  +L+  L        KV K IY+ ++ +EE  K     +  +GGYG +F++  Y+
Sbjct: 417 ANKNTERLLSELILVNE--GKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMAFYS 474

Query: 310 KEQCKQLPLKLKYFHH---------ATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360
           +E  K     LK F           A     +    E   ++    D  LIRVSVG E +
Sbjct: 475 EEDSKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGLEDS 534

Query: 361 NDLIKDLASALKELQ 375
             L+   + A+  L+
Sbjct: 535 QWLLDVFSDAINMLE 549

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 110/260 (42%), Gaps = 39/260 (15%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     D+  L R A   G  ++VD T A   +       AD+V  S TK F
Sbjct: 419 VFMETPSNPLLKMGDLLELKRLADIYGFYVVVDET-AGGFVNIDVLPHADLVCSSLTKIF 477

Query: 201 GGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL---ESFMLLRSLRTYEMRITKQSE 257
            G S++++G LV+   +   +   +    G     L   ++  L R+ R +  R  K + 
Sbjct: 478 SGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLERNSRDFVTRTLKVNS 537

Query: 258 NATKLVR--FLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITLYT 309
           NA  L+    + +    F K    IY+  L +EE       V+ +  GGYG +F++T Y 
Sbjct: 538 NAEMLLNDVLIPEEGHLFSK----IYYPRLTSEETKQNYDTVRCKPNGGYGGLFSLTFYE 593

Query: 310 KEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------------IDQTLIRV 353
            EQ K+       F +A  L    SL     +  PY                ++  L+RV
Sbjct: 594 IEQAKK-------FFNALELCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVEANLVRV 646

Query: 354 SVGCESANDLIKDLASALKE 373
           SVG E A  L K    A+ E
Sbjct: 647 SVGLEDAEHLRKVFREAISE 666

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 136/335 (40%), Gaps = 61/335 (18%)

Query: 77  GYAVIYSSGLAAFYAAMVHYNP---KKIFIGQSYHGVRAIANILTRNY--GIEQHP---- 127
           GYA  +S        A+V Y P   K +  G  Y    +I  +    +  G   H     
Sbjct: 323 GYASPHSPN-----GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSGDHKAMAQ 377

Query: 128 LEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNF 187
           LEDI         V +E+P NP     D+++L R A   G  L+VD T     +      
Sbjct: 378 LEDILHSGEPILAVFIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGG-FVNIDVLP 436

Query: 188 GADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLK---------------DDRIYLGTN 232
            AD+V  S TK F G S++++G LVV   +                     +D IYL  N
Sbjct: 437 HADLVCSSLTKIFSGDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERN 496

Query: 233 VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE--- 289
             +  S    RSL     R+ K +E    L + L  HQ     + K I++ +L +EE   
Sbjct: 497 SRDCAS----RSL-----RVNKNTE--LLLEKVLLPHQG---SLFKKIFYPTLTSEETKR 542

Query: 290 ---FVKKQLVGGYGPVFAITLY----------TKEQCKQLPLKLKYFHHATSLGGIESLV 336
               V+ +  GGYG +F++T +          T E CK   L    F  A     +    
Sbjct: 543 NYDAVRCKPDGGYGGLFSLTFHEENRAKVFFDTLELCKGPSLGTN-FTLACPYTVLAHYA 601

Query: 337 EWRAMTDPYIDQTLIRVSVGCESANDLIKDLASAL 371
           E   + +  ++++L+RVSVG E  + L K    A+
Sbjct: 602 EMDVVAEYGLERSLVRVSVGLEDFDHLRKVFQRAI 636

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 131/304 (43%), Gaps = 39/304 (12%)

Query: 99  KKIFIGQSYHGVRAIANILTRNYGI---EQHPLEDIEKCASEGDIV---HLESPVNPYGT 152
           K +  G  Y    +I       Y +   +   +E+++K    G+ +    +E+P NP   
Sbjct: 342 KTVMFGFPYTDTLSILEKFNHTYFLGSGDSKAMEELKKILHSGEQILALFMEAPSNPLLK 401

Query: 153 SSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLV 212
             D+  L   A++ G  ++VD T           F ADIV  S TK F G S++++G +V
Sbjct: 402 MGDLIELRELANSFGFYIVVDDTAGGFVNIDVLPF-ADIVCSSLTKIFSGDSNVIAGSIV 460

Query: 213 VKE--------EATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVR 264
           +          E    Q  +D ++        ++  L R+ R +  R  K ++N  +L+ 
Sbjct: 461 LNPQSKLYSFAETFMEQQYEDCLWCE------DALYLERNSRDFVARTLKVNQNTERLLN 514

Query: 265 FLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLYTKEQCKQLPLK 319
            +   Q    K+ K IY+ SL ++E  K     +   GGYG +F++T Y  +  K     
Sbjct: 515 KVLLPQE--GKLFKKIYYPSLTSKETKKNYDAVRGHQGGYGGLFSLTFYNLDSAKTFFNT 572

Query: 320 LKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVSVGCESANDLIKDLAS 369
           L+      SLG   +L    A+   Y          ++  L+RVSVG E  ++L K   +
Sbjct: 573 LQ-LCKGPSLGTNFTLACPYAIIAHYQELDRVAKYGVESNLVRVSVGLEREDELCKVFQT 631

Query: 370 ALKE 373
           A+ E
Sbjct: 632 AIDE 635

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 113/273 (41%), Gaps = 55/273 (20%)

Query: 128 LEDIEKCASEGD---IVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYA 184
           L+D++     G+    V +E+P NP     D+  L + +   G  ++VD T     +   
Sbjct: 391 LQDLQTILHSGEQILAVFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGF-VNLD 449

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEA----------------TSRQLKDDRIY 228
             F ADIV  S TK F G S++++G +V+  ++                T     +D IY
Sbjct: 450 GLFHADIVCSSLTKVFNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLIY 509

Query: 229 LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDH--QSEFDKVLKTIYHSSLQ 286
           L  N          R      +RI   +E       +L D+  +    K+ K IY+ S  
Sbjct: 510 LEKNS---------RDFVAKTLRINYTTE-------YLLDNVFKPHVGKLFKRIYYPSQN 553

Query: 287 TEEF------VKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLV---- 336
           +EE       +K +  GGYG VF++T +  +Q K     LK     T LG   + V    
Sbjct: 554 SEEIKQNYEAIKCKKDGGYGGVFSVTFFQLDQAKVFFNNLKLTKQIT-LGNNSTTVCPYT 612

Query: 337 ------EWRAMTDPYIDQTLIRVSVGCESANDL 363
                 E   + +  ++  LIRV VG E+ N L
Sbjct: 613 MLKHKDELERVKEYGLEDNLIRVCVGLENKNTL 645

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 111/251 (44%), Gaps = 51/251 (20%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D+  L + A A    +I+D T         LQYA     DIV  S 
Sbjct: 427 VFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQYA-----DIVCSSL 481

Query: 197 TKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN-----VANLESFMLLRSLRTYEMR 251
           TK F G S++++G LV+    +SR  K  R +  ++     +   +S  L R+ R    R
Sbjct: 482 TKIFSGDSNVMAGSLVLN--PSSRLYKLARRFFASDDYEDLLWCEDSIYLERNSRDCVSR 539

Query: 252 ITKQSENATKLVR--FLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGGYGPVF 303
             K +ENA +L++   L    + F    K IY+ SL + E       VK Q  GGYG +F
Sbjct: 540 SMKINENAERLLKGTLLPLEGTLF----KKIYYPSLTSSETKANYDAVKCQPNGGYGGLF 595

Query: 304 AITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------------ID 347
           ++T +  E C       K F ++  L    SL     +  PY                ++
Sbjct: 596 SLTFFDDE-CA------KAFFNSLDLCKGPSLGTNFTLACPYTILAHYGEMDVVAKYGLE 648

Query: 348 QTLIRVSVGCE 358
           + L+RVS+G E
Sbjct: 649 KNLVRVSIGLE 659

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 125/288 (43%), Gaps = 52/288 (18%)

Query: 128 LEDIEKCASEGD---IVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYA 184
           ++++E+    G+    V +E P NP    +D++ L   A+  G  +++D T         
Sbjct: 440 MKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNIDV 499

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLG------TNVANLES 238
             F ADIV  S ++ FGG S++++G +V+  +    Q    +++L         V   ++
Sbjct: 500 LPF-ADIVCSSLSQSFGGDSNVMAGSMVLNPQEKLYQFA--QLFLNQLGEYENYVWCEDA 556

Query: 239 FMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE--------- 289
            +L R+ R +  R    + N+  L+  +       DK+ K IY+ SL ++E         
Sbjct: 557 IILERNSRDFIPRSITINHNSEYLINEVLLPNEGPDKIFKKIYYPSLTSDETKENYDKLR 616

Query: 290 ------FVKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTD 343
                 F K++  GGYG + ++T +  +  K      ++F       G  SL     +  
Sbjct: 617 CKKIPNFEKEE--GGYGGIISLTFHNLDTSK------RFFDEINITKG-PSLSTNHTLAC 667

Query: 344 PY----------------IDQTLIRVSVGCESANDLIKDLASALKELQ 375
           PY                +++ LIR+ +GCES  DL K    A+++ Q
Sbjct: 668 PYTILSYFDNLAQVEKFGVEENLIRIKIGCESKEDLAKVFLHAIEKAQ 715

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 139/333 (41%), Gaps = 66/333 (19%)

Query: 91  AAMVHYNP---KKIFIGQSYHGVRAIANILTRNYGI---EQHPLEDIEKCASEGD---IV 141
            A + Y P   K +  G S +  + I +     +     + + L+D+E     G+    V
Sbjct: 369 GASIGYGPPYKKTVLFGFSNNDTKNILSEFNHTHYFACGDSNSLKDLECTLHSGEQILAV 428

Query: 142 HLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSAT 197
            +E+P NP     D+  L R A+  G  +I+D T         L YA     DIV  S T
Sbjct: 429 FVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNIDVLPYA-----DIVCSSLT 483

Query: 198 KYFGGHSDLLSGVLVVKEEAT--------SRQLKDDRIYLGTNVANLESFMLLRSLRTYE 249
           K F G S++++G +V+  +            QL +   +L       ++  L R+ R + 
Sbjct: 484 KIFSGSSNVIAGSMVLNPQEKLYSFAQVFMSQLGEYEDHLWCE----DAIYLERNSRDFI 539

Query: 250 MRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLV------- 296
            R  K ++N   L++ +   Q    K+ K I++ SL + E       V+ + +       
Sbjct: 540 ARTIKTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKVNYDAVRCKSIDKDSDEE 599

Query: 297 GGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------- 345
           GGYG +F++     EQ        K F +  +L    SL     ++ PY           
Sbjct: 600 GGYGGLFSLAFNKIEQA-------KIFFNELNLSKGPSLGTNFTLSCPYTVLMYYDKLDE 652

Query: 346 -----IDQTLIRVSVGCESANDLIKDLASALKE 373
                ++++L+RVS+G ES ++L K    A+ E
Sbjct: 653 VAKYEVEESLVRVSIGIESQDELQKAFQHAIDE 685

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 117/259 (45%), Gaps = 36/259 (13%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D++ L R +      ++VD T         L YA     DIV  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN------VANLESFMLLRSLRTYEM 250
           TK F G S++++G LV+  +    +    R ++ T       +   ++  L R+ R +  
Sbjct: 442 TKIFSGDSNVIAGSLVLNPKGKIYEFA--RKFMKTEDGYEDCLWCEDALCLERNSRDFVE 499

Query: 251 RITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGGYGPVFA 304
           R  K + N   L+  +   Q    K+ K IY+ SL +EE       V     GGYG +F+
Sbjct: 500 RTIKVNTNTNILLTKVLLPQ--VGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFS 557

Query: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVS 354
           +T ++ E+ K+    L+      SLG   +L    A+   Y          +++ L+RVS
Sbjct: 558 LTFFSIEEAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVS 616

Query: 355 VGCESANDLIKDLASALKE 373
           VG E+++ L K    A+++
Sbjct: 617 VGLENSDVLCKVFQRAIEK 635

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 113/257 (43%), Gaps = 36/257 (14%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D++ L R +      ++VD T         L YA     DIV  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN------VANLESFMLLRSLRTYEM 250
           TK F G S++++G LV+       +    R ++ T       +   ++  L R+ R +  
Sbjct: 442 TKIFSGDSNVIAGSLVLNPRGKIYEFA--RKFMSTEDGYEDCLWCEDALCLERNSRDFVE 499

Query: 251 RITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKK------QLVGGYGPVFA 304
           R  K + N   L+  +   Q    K+ K IY+ SL +EE  K          GGYG +F+
Sbjct: 500 RTIKVNTNTDVLLTKVLLPQ--VGKLFKKIYYPSLTSEETKKNYDNVMSTKDGGYGGLFS 557

Query: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVS 354
           +T +  E+ K+    L+      SLG   +L    A+   Y          +++ L+RVS
Sbjct: 558 LTFFNIERAKKFFNSLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVS 616

Query: 355 VGCESANDLIKDLASAL 371
           VG E+++ L K    A+
Sbjct: 617 VGLENSDVLCKVFQQAI 633

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 96/390 (24%), Positives = 152/390 (38%), Gaps = 82/390 (21%)

Query: 55  VYSRLAHPNSTRLESIFSEILDGYAVI-YSSGLAAFYAA---MVHYNPKKIFIGQSYHGV 110
           +YSR+ +P    LE   + +  G A +  SSG AA   A   + H     +     Y G 
Sbjct: 54  IYSRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGT 113

Query: 111 RAIANILTRNYGIEQHPL-----EDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAH 164
                +  +  GIE   +     ED EK   E    ++LES  NP     D E +   AH
Sbjct: 114 YNQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAH 173

Query: 165 AKGALLIVDSTFAS-----PPLQYAWNFGADIVLYSATKY-------------------- 199
             G  ++VD+TF +      P++Y    GADIV +SATK+                    
Sbjct: 174 KHGIPVVVDNTFGAGGFFCQPIKY----GADIVTHSATKWIGGHGVTVGGVIIDSGKFPW 229

Query: 200 ---------FGGHSDLLSGVLVVKEEATSRQLKDDRIY----LGTNVANLESFMLLRSLR 246
                    F   S+   G++       +  +   R      LG  ++    F+LL+ L 
Sbjct: 230 KDYPEKFPQFSQPSEGYHGLIFNDAFGPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLE 289

Query: 247 TYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT---EEFVKKQLVGGYGPVF 303
           T  +R  +   NA KL ++L     E    +  + +  L +    E  KK L  G+G V 
Sbjct: 290 TLSLRGERHGSNALKLAQYL-----ESSPYVSWVSYPGLPSHSHHENAKKYLENGFGGVL 344

Query: 304 AITLYT-----------KEQCKQLPLKLKYFHHATSLGGIESLV------EWRAMTD--- 343
           +  +             K    Q+   LK   +  ++G  ++LV        + +TD   
Sbjct: 345 SFGVKDLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEK 404

Query: 344 --PYIDQTLIRVSVGCESANDLIKDLASAL 371
               + + LIRVSVG E  +D+I D  ++ 
Sbjct: 405 LASGVTKDLIRVSVGTEFIDDIIADFEASF 434

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 94/406 (23%), Positives = 162/406 (39%), Gaps = 68/406 (16%)

Query: 24  PINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILDGYAVIYS 83
           P NV +    DDD L      E +  M +    S   +  +  L+   +   D Y  ++ 
Sbjct: 242 PFNVGSGEALDDDQLNSDIPAETITSMGESGSNSTFENTATDDLKFHVNPNTDVY--LFP 299

Query: 84  SGLAAFYAA---------------------MVHYNP---KKIFIGQSYHGVRAIANILTR 119
           SG+A+ + A                     ++ Y P   K +  G  Y    +I      
Sbjct: 300 SGMASIFTAHRLLLNFDAKRLSRSSSRQDKLIGYGPPFKKTVMFGFPYTDTLSILRKFNH 359

Query: 120 NYGIEQ------HPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVD 173
            + + Q      + L++I     +   V +E+P NP     D++ L R +      ++VD
Sbjct: 360 THFLGQGDSTSMNALKNILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVD 419

Query: 174 STFAS----PPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYL 229
            T         L YA     DIV  S TK F G S++++G LV+       +    R ++
Sbjct: 420 ETVGGFVNIDVLPYA-----DIVCSSLTKIFSGDSNVIAGSLVLNPRGKIYEFA--RKFM 472

Query: 230 GTN------VANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHS 283
            T       +   ++  L R+ R +  R  K + N   L++ +   Q    K+ K IY+ 
Sbjct: 473 KTEDGYEDCLWCEDALCLERNSRDFVERTIKVNTNTDILLKRVLLPQ--VGKLFKKIYYP 530

Query: 284 SLQTEEF------VKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVE 337
           SL +E+       V     GGYG +F++T +  E+ K+    L+      SLG   +L  
Sbjct: 531 SLTSEDTKRNYDSVMSTKDGGYGGLFSLTFFNIEEAKKFFNNLE-LCKGPSLGTNFTLAC 589

Query: 338 WRAMTDPY----------IDQTLIRVSVGCESANDLIKDLASALKE 373
             A+   Y          ++  L+RVSVG E+++ L      A+++
Sbjct: 590 PYAIIAHYQELDEVAQYGVETNLVRVSVGLENSDVLCNVFQRAIEK 635

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 108/453 (23%), Positives = 174/453 (38%), Gaps = 100/453 (22%)

Query: 2   VDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKP--VYSRL 59
           V L     + DD  NR   V  PI  +T++ ++D      ++  +  F  + P  +YSR+
Sbjct: 8   VQLHAGQENPDDNANRPRAV--PIYATTSYVFND------SKHGSQLFGLETPGYIYSRI 59

Query: 60  AHPNSTRLES-IFSEILDGYAVIYSSGLAA---FYAAMVHYNPKKIFIGQSYHGVRAIAN 115
            +P    LE  I +      A+  +SG A+     + + H     +     Y G      
Sbjct: 60  MNPTVDVLEKRIAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGGTYNQFK 119

Query: 116 ILTRNYGIEQHPLE-----DIEKCASE-GDIVHLESPVNPYGTSSDIESLARRAHAKGAL 169
           +  +  GIE   +E     D EK   E    V+LE+  NP     D + +   AH  G  
Sbjct: 120 VAFKRLGIETRFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHKHGIP 179

Query: 170 LIVDSTFAS-----PPLQYAWNFGADIVLYSATKYF------------------------ 200
           ++VD+TF +      P++Y    GADIV +SATK+                         
Sbjct: 180 VVVDNTFGAGGFFAQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPE 235

Query: 201 ----------GGHSDLLS---GVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRT 247
                     G H  + +   G L       +  L+D    LG  +    +F LL+ + T
Sbjct: 236 KFPQFSIPSEGYHGMIFNDAFGPLAFIGHVRTELLRD----LGPALNPFAAFQLLQGVET 291

Query: 248 YEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITL 307
             +R  +  ENA KL  +L   QS +   +      S    E  KK L  G+G V +   
Sbjct: 292 LSLRAERHGENALKLAAWLE--QSPYVSWVSYPGLPSHSHHENAKKYLTNGFGGVLSFGA 349

Query: 308 Y----TKEQCKQLPL---------KLKYFHHATSLGGIESLV-------------EWRAM 341
                  E   + P           LK   +  ++G  ++LV             E +A 
Sbjct: 350 KDLPNNAEAEAKNPFAAAGAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQLTHEEKAS 409

Query: 342 TDPYIDQTLIRVSVGCESANDLIKDLASALKEL 374
           +   + + LIRVSVG E  +D+I D   + +++
Sbjct: 410 SG--VTKDLIRVSVGTEFIDDIINDFQQSFEQV 440

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 131/302 (43%), Gaps = 30/302 (9%)

Query: 97  NPKKIFIGQSYHGVRAIANILTRNYGI---EQHPLEDIEKCASEGD---IVHLESPVNPY 150
           N K +  G  Y     +       Y +   ++  ++++ K    G+    V +E+P NP 
Sbjct: 345 NKKTVIFGFPYADTLHVLQEFNETYFLGEGDESSMKELTKILHSGEQILAVFIETPSNPL 404

Query: 151 GTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGV 210
               ++  L R +   G  +I+D T           F ADIV  S TK F G S+++ G 
Sbjct: 405 LKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTFSGDSNVIGGS 463

Query: 211 LVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRITKQSENATKLV-RF 265
           +V+  ++   +     + L     +L    ++  L R+ R +  R  + + +   L+ + 
Sbjct: 464 MVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRINYSTEYLLDKI 523

Query: 266 LSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITLYTKEQCKQLPLK 319
           L  H  E +K+ K IY+ +L ++E       V+ +  GGYG +F++T + ++        
Sbjct: 524 LKPHVGE-NKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDEDHAAAFYDN 582

Query: 320 LKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVSVGCESANDLIKDLAS 369
           LK  +   SLG   +L     +   Y          +++ L+R+SVG ES + L K    
Sbjct: 583 LK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLESQSILGKIFQE 641

Query: 370 AL 371
           A+
Sbjct: 642 AI 643

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 116/258 (44%), Gaps = 34/258 (13%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +E+P NP     D++ L R +      ++VD T         L YA     DI+  S 
Sbjct: 388 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIICSSL 442

Query: 197 TKYFGGHSDLLSGVLVVKE-----EATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMR 251
           TK F G S++++G LV+       E   + +K +  Y    +   ++  L R+ R +  R
Sbjct: 443 TKIFSGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDC-LWCEDALCLERNSRDFVER 501

Query: 252 ITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGGYGPVFAI 305
             K + N   L+  +   Q    K+ K IY+ SL +EE       V     GGYG +F++
Sbjct: 502 TIKVNTNTDILLTKVLLPQ--VGKLFKKIYYPSLTSEETKRNYDSVMATRDGGYGGLFSL 559

Query: 306 TLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVSV 355
           T +  E+ K+    L+      SLG   +L    A+   Y          +++ L+RVSV
Sbjct: 560 TFFDIEKAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSV 618

Query: 356 GCESANDLIKDLASALKE 373
           G E+++ L +    A+++
Sbjct: 619 GLENSDVLCRVFQRAIEK 636

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 112/260 (43%), Gaps = 43/260 (16%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     D++ L + A   G  +++D T        L Y     ADIV  S T
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGGLNVDILPY-----ADIVCTSLT 371

Query: 198 KYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRIT 253
           K F G S+++ G +++  +++      +  +      +L    ++ +L  + R +E R  
Sbjct: 372 KLFSGTSNVMGGSVLLNPDSSLYPYAQE-YFQSCEFEDLLWSEDAVVLEANSRDFEARTL 430

Query: 254 KQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLY 308
           + +EN   L+  +     E  K++K +Y+ ++ +EE  K     +   GGYG +F+I  +
Sbjct: 431 RTNENTVNLLTKV--LLPEEGKLIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFH 488

Query: 309 TKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIR 352
            +E  K     LK F   ++            +  PY+                D  L+R
Sbjct: 489 NEEDAKCFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHFELVEVAELGADPNLVR 541

Query: 353 VSVGCESANDLIKDLASALK 372
           VSVG E    L +   +AL+
Sbjct: 542 VSVGLEEFQGLREVFLNALE 561

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 111/259 (42%), Gaps = 43/259 (16%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     D++ L   A   G  +++D T        L YA     DIV  S T
Sbjct: 321 VFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGLNVDILPYA-----DIVSTSLT 375

Query: 198 KYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRIT 253
           K F G S+++ G +V+  +++      +  +   N  +L    ++ +L R+ R +E R  
Sbjct: 376 KLFNGASNVMGGSVVLNPKSSLYPYARE-YFRSANFEDLLWCEDAIVLERNSRDFEDRTL 434

Query: 254 KQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLY 308
           + + N   L+  L     E  K+ K IY+ ++ ++E  +     +   GGYG +F++  +
Sbjct: 435 RANANTGILLNDL--LLPEEGKICKKIYYPTVTSKETFENYESVRNERGGYGCLFSVAFF 492

Query: 309 TKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIR 352
            +   K     LK F   ++            +  PY+                D  +IR
Sbjct: 493 NEGDAKAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADPNIIR 545

Query: 353 VSVGCESANDLIKDLASAL 371
           VSVG E    L+K  +SAL
Sbjct: 546 VSVGLEDIQWLLKVFSSAL 564

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 111/258 (43%), Gaps = 41/258 (15%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     +++ L R A A G  +++D T        L Y     ADIV  S T
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGGLNVDILPY-----ADIVCTSLT 371

Query: 198 KYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL---ESFMLLRSLRTYEMRITK 254
           K F G S+++ G +V+  ++   Q   +    G     L   ++ +L R+ R +E R  +
Sbjct: 372 KLFNGASNVMGGSVVLNPKSALYQRAREYFKSGEFEDLLWGEDAVVLERNSRDFEDRTLR 431

Query: 255 QSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFAITLYT 309
            + N  KL+        E  K  K IY+ ++ ++E +      +   GGYG +F++  ++
Sbjct: 432 ANTNTEKLL--KELLLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHS 489

Query: 310 KEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIRV 353
           +   +     LK F   ++            +  PY+                D ++IRV
Sbjct: 490 EGDAEAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADSSIIRV 542

Query: 354 SVGCESANDLIKDLASAL 371
           SVG E    L+   +SAL
Sbjct: 543 SVGLEETQLLLDVFSSAL 560

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 121/271 (44%), Gaps = 31/271 (11%)

Query: 128 LEDIEKCASEGD---IVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYA 184
           +ED++K    G+    V +E+P NP     D+  L + A+  G  ++VD T A   +   
Sbjct: 381 MEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDET-AGGFVNID 439

Query: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEA-----TSRQLKDDRIYLGTNVANLESF 239
               AD+V  S TK F G S+L++G LV+  +        + L   + Y  T     ++ 
Sbjct: 440 VLPHADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCE-DAL 498

Query: 240 MLLRSLRTYEMRITKQSENATKLV-RFLSDHQSEFDKVLKTIYHSSLQTEEF------VK 292
            L R+ R +  R  + + N   L+ + L   +    K+ K IY+ SL + E       VK
Sbjct: 499 ALERNSRDFVQRTIQVNHNTEYLLNKVLIPLEG---KLFKKIYYPSLTSPETKRHYDAVK 555

Query: 293 KQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY------- 345
             +  GYG +F++T +   Q +     L+      SLG   +L    A+   Y       
Sbjct: 556 CSIDAGYGGLFSLTFFNLAQARVFFDSLQ-LCKGPSLGTNFTLACPYAILAHYQELDEVA 614

Query: 346 ---IDQTLIRVSVGCESANDLIKDLASALKE 373
              ++++L+RVSVG E+   L +    A+ E
Sbjct: 615 RYGVEKSLVRVSVGLENRESLCQVFQHAIAE 645

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 117/254 (46%), Gaps = 24/254 (9%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++  L R +   G  +I+D T           F AD+V  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 201 GGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRITKQS 256
            G S+++ G +V+  ++   +     + L     +L    ++  L R+ R +  R  + +
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 552

Query: 257 ENATKLV-RFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITLYT 309
            N   L+ + +  H  E + + K IY+ +L ++E       V+ +  GGYG +F++T + 
Sbjct: 553 YNTEYLLDKIIKPHVGE-NALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 611

Query: 310 KEQCKQLPLKLKYFHHATSLGGIESLV---------EWRAMTDPY-IDQTLIRVSVGCES 359
           ++  +     L+  +   SLG   +LV            AM + + +++ L+R+SVG E+
Sbjct: 612 EDHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGLEN 670

Query: 360 ANDLIKDLASALKE 373
              L K    A+ +
Sbjct: 671 QLTLGKIFQKAIDQ 684

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 110/259 (42%), Gaps = 43/259 (16%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS---PPLQYAWNFGADIVLYSAT 197
           V +E+P NP     D++ L R A A G  ++VD T        L Y     ADIV  S T
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIGGLNVDVLPY-----ADIVCTSLT 372

Query: 198 KYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRIT 253
           K F G S+ + G +++  + +S        +      +L    ++ +L  + R ++ R  
Sbjct: 373 KLFNGSSNAMGGSIILNPK-SSLYSSACEYFKSAEFEDLLWCEDAVVLEANSRDFQDRTL 431

Query: 254 KQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE-FVKKQLV----GGYGPVFAITLY 308
           + + N  KL+  +     E  K+ K IY+ ++ ++E F   + V    GGYG +F++  Y
Sbjct: 432 RANINTEKLLNEV--LLPEEGKICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSMAFY 489

Query: 309 TKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIR 352
            +   K     LK F   ++            +  PY+                D  LIR
Sbjct: 490 NEGDAKTFYDTLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADPNLIR 542

Query: 353 VSVGCESANDLIKDLASAL 371
           VSVG E    L+   +SA+
Sbjct: 543 VSVGLEDTQTLLDVFSSAI 561

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 108/263 (41%), Gaps = 44/263 (16%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSA 196
           V +ESP NP     D+  L R +   G  +++D T         L YA     D+V  S 
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPYA-----DVVCSSL 485

Query: 197 TKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTN-----VANLESFMLLRSLRTYEMR 251
           TK F G S++++G +V+   +   +     ++L        +   ++  L R+ R +  R
Sbjct: 486 TKIFSGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAICLERNSRDFISR 545

Query: 252 ITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVG-GYGPVFA 304
               +EN   L+  +   Q    K+ K +++      E       VK +  G GYG +F+
Sbjct: 546 SILVNENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKNYDQVKAKTAGSGYGGLFS 605

Query: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------------IDQ 348
           +T Y  EQ K        F ++ +L    SL     +  PY                ++ 
Sbjct: 606 VTFYNIEQAKM-------FFNSLNLCKGPSLGTNFTLACPYTVLAHYQEMEEVAKFGLED 658

Query: 349 TLIRVSVGCESANDLIKDLASAL 371
            L+RVSVG ES   L K   +A+
Sbjct: 659 NLVRVSVGLESKQHLEKVFQTAI 681

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 113/252 (44%), Gaps = 24/252 (9%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++  L R +   G  +I+D T           F ADIV  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 201 GGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRITKQS 256
            G S+++ G +V+  ++   +     + L     +L    ++  L R+ R +  R  + +
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 257 ENATKLV-RFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITLYT 309
            +   L+ + L  H  E + + K IY+ SL ++E       V+ +  GGYG +F++T + 
Sbjct: 564 YSTEYLLDKILKAHVGE-NGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSLTFHD 622

Query: 310 KEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRVSVGCES 359
           ++        L+  +   SLG   +L     +   Y          +++ L+R+SVG ES
Sbjct: 623 EDHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISVGLES 681

Query: 360 ANDLIKDLASAL 371
            + L K    A+
Sbjct: 682 QSTLGKIFQEAI 693

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 135/314 (42%), Gaps = 31/314 (9%)

Query: 87  AAFYAAMVHYNP---KKIFIGQSYHGVRAIANILTRNYGI---EQHPLEDIEKCASEGD- 139
           AA  A +V Y P   K +  G  Y    +I       + +   ++  +E +++    G+ 
Sbjct: 338 AAGSADVVGYGPPYKKTVMFGFPYTDTLSILRKFNHTHFLGDGDEKSMEQLKEILHSGEQ 397

Query: 140 --IVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSAT 197
              V +E+P NP     ++  L   A A G  +++D T A   +       AD+V  S T
Sbjct: 398 ILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDET-AGGFVNIDVLPHADMVCSSLT 456

Query: 198 KYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLG--TNVANLESFMLL-RSLRTYEMRITK 254
           K F G S++++G LV+  ++          + G   ++   E  + L R+ R +  R   
Sbjct: 457 KIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEFEDLLWCEDVIYLERNSRDFVTRTLT 516

Query: 255 QSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLV-----GGYGPVFAITLYT 309
            ++N  +L+  +   Q +  K+ K I++ SL + E  +         GGYG +F++T Y 
Sbjct: 517 VNKNTAQLLEEVLIPQEK--KLFKKIFYPSLTSPETKRNYDAILCPKGGYGGLFSLTFYN 574

Query: 310 KEQ----------CKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359
           ++Q          CK   L    F  A     +    E   +    ++++L+RVSVG ES
Sbjct: 575 EKQARVFFDTLELCKGPSLGTN-FTLACPYAILAHYTELEEVAKFGVERSLVRVSVGLES 633

Query: 360 ANDLIKDLASALKE 373
              L    + A+ E
Sbjct: 634 PQVLNAVFSRAIAE 647

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 121/306 (39%), Gaps = 65/306 (21%)

Query: 129 EDIEKCASEG-DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTF-ASPPLQYAWN 186
           ED EK   +    V+LES  NP     D E +   AH  G  ++VD+TF A       + 
Sbjct: 138 EDFEKAFDDKTKAVYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFK 197

Query: 187 FGADIVLYSATKY-----------------------------FGGHSDLLSGVLVVKEEA 217
           FGADI+ +SATK+                             F   S+   G++      
Sbjct: 198 FGADIITHSATKWIGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALG 257

Query: 218 TSRQLKDDRIY----LGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEF 273
               +   R+     LG  +    +F LL+ + T  +R  + + NA KL ++L     E 
Sbjct: 258 PLAYIAHVRVELLRDLGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYL-----ES 312

Query: 274 DKVLKTIYHSSLQT---EEFVKKQLVGGYGPVFAITLYTKEQCK-----------QLPLK 319
              +  + +  L +    E  KK L  G+G V +I +                  Q+   
Sbjct: 313 SPYVSWVSYPGLPSHSHHENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVVDS 372

Query: 320 LKYFHHATSLGGIESLV------EWRAMTDPY-----IDQTLIRVSVGCESANDLIKDLA 368
           LK   +  ++G  ++LV        + ++D       + + LIR+SVG E  +D+I D  
Sbjct: 373 LKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGDFE 432

Query: 369 SALKEL 374
            A +++
Sbjct: 433 QAFEKV 438

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 113/251 (45%), Gaps = 22/251 (8%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     ++  L R +   G  +I+D T           F ADIV  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRITKQS 256
            G S+++ G +V+  ++   +     + L     +L    ++  L R+ R +  R  + +
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDLLWCEDAIYLERNSRDFIARTVRIN 513

Query: 257 ENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEE------FVKKQLVGGYGPVFAITLYTK 310
            +   L+  +       +++ K IY+ +L ++E       V+ +  GGYG +F++T + +
Sbjct: 514 YSTEYLLDKILKPHVGGNELFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 573

Query: 311 EQCKQLPLKLKYFHHATSLGGIESLV---------EWRAMTDPY-IDQTLIRVSVGCESA 360
                    L+  +   SLG   +L          +  AM + + +++ L+R+SVG ES 
Sbjct: 574 HHAAAFYDNLQ-LNKGPSLGTNFTLAFPYTLMTYYQELAMAEKFGVERNLLRISVGLESQ 632

Query: 361 NDLIKDLASAL 371
           + L K    A+
Sbjct: 633 STLGKIFQEAI 643

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 118/268 (44%), Gaps = 42/268 (15%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYF 200
           V +E+P NP     D+  L R +   G  +IVD T A   +       ADI+  S TK F
Sbjct: 438 VFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIAG-FVNIDAIIHADIICSSLTKVF 496

Query: 201 GGHSDLLSGVLVVKE-----EATSRQLK-----------DDRIYLGTNVANLESFMLLRS 244
            G S++++G +V+       +   R L            +D +YL  N  +  S      
Sbjct: 497 TGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLWCEDILYLEKNSRDFLS------ 550

Query: 245 LRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF------VKKQLVGG 298
            +T  +  T +    T L  ++   ++   K+ K IY+ +  ++E       +K +  GG
Sbjct: 551 -KTTRINNTTEYLVNTVLSPYVGKKEAN-GKLFKKIYYPTTTSKETKMCYDAIKCKTYGG 608

Query: 299 YGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLV----------EWRAMTDPYIDQ 348
           YG VF+IT +  E+ K     LK      SLG   + V          E   +++  +D+
Sbjct: 609 YGGVFSITFHDIEKAKLFFNNLK-LSKTISLGSNYTTVCPYTVLKHGDELEKVSEYGLDE 667

Query: 349 TLIRVSVGCESANDLIKDLASALKELQD 376
           TLIRV VG E+   L ++ + A+++  +
Sbjct: 668 TLIRVCVGLENKTSLKENFSRAIEKTMN 695

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 113/257 (43%), Gaps = 39/257 (15%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP---LQYAWNFGADIVLYSAT 197
           V +E+P NP     +++ L R A   G  +I+D T        L YA     DIV  S T
Sbjct: 312 VFVETPSNPLLNMPNLKDLRRLADQYGFFIIIDDTIGGINVDILPYA-----DIVCTSLT 366

Query: 198 KYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM-------LLRSLRTYEM 250
           K F G S+++ G +V+  +++       R Y  +  A+ E  +       L R+ R +E 
Sbjct: 367 KLFNGASNVMGGSIVLNPKSSIYPYA--REYFKS--ADFEDLLWCEDAVVLERNSRDFEN 422

Query: 251 RITKQSENATKLV-RFLSDHQSEFDKVLKTIYHSSLQTEEFVK-----KQLVGGYGPVFA 304
           R    + N  KL+   L   Q    K+ K +Y+ ++ +EE  +     +   GGYG +F+
Sbjct: 423 RTLHANANTEKLLNEVLIPEQG---KLCKKVYYPTVTSEETFRNYESVRNERGGYGCLFS 479

Query: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLV----------EWRAMTDPYIDQTLIRVS 354
           +  Y +   K     LK F    S G   +L           E  A++    D  +IRVS
Sbjct: 480 VAFYNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFGADPNIIRVS 538

Query: 355 VGCESANDLIKDLASAL 371
           VG E    L++  ++AL
Sbjct: 539 VGLEDTQWLLEVFSNAL 555

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 127/303 (41%), Gaps = 48/303 (15%)

Query: 106 SYHGVRAIANILTRNYGIEQHPLEDIEKCASEGD---IVHLESPVNPYGTSSDIESLARR 162
           +Y  ++ + N+    Y  E   +  ++     G+    V +E+P  P     ++  L   
Sbjct: 372 TYKMLKTLNNVYCLPYVSEIDCMNKLKNILHSGEQILAVLIEAPSTPLLKMGNLLELKEL 431

Query: 163 AHAKGALLIVDST----FASPPLQYAWNFGADIVLYSATKYFGGH-SDLLSGVLVVKEEA 217
           ++  G ++IVD T    F    L +A     D+V  S TK F G   ++++G + +   +
Sbjct: 432 SNLFGFIIIVDETVGGFFNVDALVHA-----DVVCTSLTKIFSGDVGNVMAGAMALNSNS 486

Query: 218 T----SRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLV-RFLSDHQSE 272
           T    ++    D      N+   ++ ++ R+ R +  ++ K +     L+ + L  H  E
Sbjct: 487 TIYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKINYTTDYLLDKVLIPHIGE 546

Query: 273 FDKVLKTIYHSSL------QTEEFVKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHA 326
            + + K IYH  L      Q  E +K +  GGYG VF+I     EQ        K F++ 
Sbjct: 547 HN-LFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFNNLEQA-------KLFYNC 598

Query: 327 TSLGGIESLVEWRAMTDPY----------------IDQTLIRVSVGCESANDLIKDLASA 370
            ++    SL     +  PY                + ++LIRVSVG E+   L +   +A
Sbjct: 599 LNVAKGPSLGTTMTLACPYTILYHYADIEKVSKYGLSESLIRVSVGLENRKQLCQLFQAA 658

Query: 371 LKE 373
           + E
Sbjct: 659 IDE 661

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 125/295 (42%), Gaps = 25/295 (8%)

Query: 95  HYNPKKIFIGQSYHGVRAIANILTRNYGIEQHPLEDIEKCASEGDIVH---------LES 145
            ++ K + +G   H    +   L+++Y I ++  + + K     +I+H          E+
Sbjct: 342 QHSKKTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLK---EILHSGEQILAVITET 398

Query: 146 PVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSD 205
           P N     +++  L + +   G  ++VD +        A  +  DIV  S  K F G  D
Sbjct: 399 PTNGLLDVTNLVELKQLSELFGFYIVVDESVGGFVNVDALVY-CDIVCSSLVKMFSGTED 457

Query: 206 LLSGVLVVKEEATSRQLKDDRI---YLGTNVANLESFMLLRSLRTYEMRITKQSENATKL 262
           ++SG +VV  ++         +   +  ++V   E  + L       +  +K+   ATK 
Sbjct: 458 VVSGSMVVNPQSKLYDFAQTFMASEHEPSSVLWCEDIIQLEQNSRDFVSKSKRINTATK- 516

Query: 263 VRFLSDH-QSEFDKVLKTIYHSSLQTE---EFVKKQLVGGYGPVFAITLYTKEQCKQLPL 318
            R L D    +   +   ++H S+        +K +  GGYG VFA+   T E+ +    
Sbjct: 517 -RLLRDVILPQRGTIFTEVHHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLERARSFYD 575

Query: 319 KLKYFHHATSLGGIESLVEWRAMTDPY--IDQTLIRVSVGCESANDLIKDLASAL 371
           +L        LGG  ++     + + Y  +D+TLIRVSVG E  + L +    A+
Sbjct: 576 RLNVC-KGPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLEDYDVLKRAFEEAI 629

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 113/261 (43%), Gaps = 35/261 (13%)

Query: 141 VHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFAS----PPLQYAWNFGADIVLYSA 196
           V LE+P NP     D+  L + +   G  ++VD T +       L Y      DIV  S 
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSYC-----DIVCSSL 372

Query: 197 TKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANL----ESFMLLRSLRTYEMRI 252
           TK F G S++++G LVV   +       D +       +L    +S  L R+ R +  R 
Sbjct: 373 TKIFSGDSNVIAGSLVVNPASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRA 432

Query: 253 TKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEF-----VKKQLVGGYGPVFAITL 307
            K ++ A  LV  +   +    ++L+ IY+ SL + E        K   GGYG + +I  
Sbjct: 433 QKINKIAEDLVSTVLLEEEG--QLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLISIVF 490

Query: 308 YTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYID----------QTLIRVSVGC 357
             ++Q K     L   +   SLG   +LV   A+   Y +          + L+R+SVG 
Sbjct: 491 KREDQAKVFYDNLS-LNKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGL 549

Query: 358 ESANDLIKDLASALKELQDAA 378
           ES    ++ L +  ++  DAA
Sbjct: 550 ES----LETLQTIFRKAFDAA 566

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 11/62 (17%)

Query: 321 KYFHHATSLGGIESLVEWRA-MTDPYI--DQT--------LIRVSVGCESANDLIKDLAS 369
           + F  A SLGGIESL+E  A MT   I  DQ         LIR+SVG E  +DL+ D+ +
Sbjct: 21  RLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLLDDIKN 80

Query: 370 AL 371
           AL
Sbjct: 81  AL 82

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 14/116 (12%)

Query: 270 QSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLYTKEQ--------CKQLPLKLK 321
           +S + KVL+ ++ S+LQ       + V G  P F   L+  EQ          +  L + 
Sbjct: 338 ESAYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDVS 397

Query: 322 YFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQDA 377
            FH   +   +E L EW A++D  +D++ +       +AN++  +L   L+  QD+
Sbjct: 398 LFHTENANRLVELLSEWLALSDEPLDESELN------AANEVADELYKILETNQDS 447

>KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {ON}
           
          Length = 1436

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 270 QSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLYTKEQ--------CKQLPLKLK 321
           +S + KVL+ ++ S+LQ       + V G  P F   L+  EQ          +  L   
Sbjct: 342 ESAYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDAS 401

Query: 322 YFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQDA 377
            FH   +   +E L EW A+ D  +D++ +       +AN++  +L   L+  QD+
Sbjct: 402 LFHTENANRLVELLSEWLALNDKPLDESELN------AANEVADELYKILETNQDS 451

>NDAI0F02700 Chr6 (663106..666831) [3726 bp, 1241 aa] {ON} Anc_2.171
          Length = 1241

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 294 QLVGGYGPVFAITLYTKEQCKQLPLKLKYFHH 325
           QL+  YGPV  I L +K +  +L L   Y HH
Sbjct: 355 QLIEKYGPVHIINLLSKTKSNELKLSKAYKHH 386

>KLLA0B00242g Chr2 complement(9894..11666) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q08295 Saccharomyces cerevisiae
           YOL157C
          Length = 590

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 139 DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAW 185
           DI   E     YGT+ DI +L  RAH  G  +IVD        ++AW
Sbjct: 76  DISDYEKVWPRYGTNEDIFNLIDRAHGLGIKIIVDLVINHCSSEHAW 122

>KLLA0D00231g Chr4 complement(9854..11626) [1773 bp, 590 aa] {ON}
           uniprot|Q9Y844 Kluyveromyces lactis mal22 Maltase,
          Length = 590

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 139 DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAW 185
           DI   E     YGT+ DI +L  RAH  G  +IVD        ++AW
Sbjct: 76  DISDYEKVWPRYGTNEDIFNLIDRAHGLGIKIIVDLVINHCSSEHAW 122

>KLTH0H05324g Chr8 (472845..474605) [1761 bp, 586 aa] {ON} similar
           to uniprot|P53051 Saccharomyces cerevisiae YGR287C
           Hypothetical ORF
          Length = 586

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 139 DIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAW 185
           DI   E     YGT+ D   L R AHA G  ++VD        ++AW
Sbjct: 66  DISDYEKVWPRYGTNEDCYQLIREAHAAGIRVVVDLVINHCSSEHAW 112

>Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 152

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 54/125 (43%), Gaps = 16/125 (12%)

Query: 4   LSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPN 63
            +T  +H     +    V  PI++STTF+       P  E E          YSR  +PN
Sbjct: 8   FATKAVHAGTHTDVHGSVIEPISLSTTFK-QHSPAQPVGEYE----------YSRSQNPN 56

Query: 64  STRLESIFSEILDG-YAVIYSSGLAAFYAAMVHYNPK---KIFIGQSYHGVRAIANILTR 119
              LE   + + +  +A+ +SSG +A  A ++   P+    + IG  Y G     + +  
Sbjct: 57  RKNLEDAVAALENAKHALAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFSKVAA 115

Query: 120 NYGIE 124
            +G+E
Sbjct: 116 AHGVE 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,673,915
Number of extensions: 1691337
Number of successful extensions: 5270
Number of sequences better than 10.0: 130
Number of HSP's gapped: 5168
Number of HSP's successfully gapped: 147
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)