Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR136W (LSB1)3.501ON2411516201e-80
Smik_6.2323.501ON2411505522e-70
Suva_7.4243.501ON2491504993e-62
Skud_7.4473.501ON2381134889e-61
Smik_16.4063.501ON2121133972e-47
YPR154W (PIN3)3.501ON2151143912e-46
Suva_16.4823.501ON2351143871e-45
Skud_16.4483.501ON2081133842e-45
NDAI0B059203.501ON2351153829e-45
TPHA0A057203.501ON2201193703e-43
SAKL0F02486g3.501ON2301133592e-41
Kpol_480.83.501ON2391153583e-41
KNAG0A079903.501ON2211193522e-40
KLTH0G02332g3.501ON2331143504e-40
Kwal_47.189053.501ON2361133427e-39
NCAS0F036003.501ON2371233383e-38
CAGL0F04829g3.501ON2021103267e-37
AFR320W3.501ON2571133254e-36
TDEL0D056903.501ON2011143198e-36
KNAG0B007503.501ON2171142972e-32
KAFR0G037403.501ON2341382913e-31
TBLA0C045303.501ON2221142885e-31
Ecym_12283.501ON2531082863e-30
KLLA0E03873g3.501ON2201122572e-26
ZYRO0D09702g3.501ON158572234e-22
ZYRO0G20372gsingletonON150651955e-18
TBLA0D029103.501ON2691251752e-14
TPHA0C040202.502ON485611544e-11
YHR016C (YSC84)1.356ON468771544e-11
KAFR0D033602.502ON455641519e-11
CAGL0K02761g2.502ON450521511e-10
TBLA0B054702.502ON539521501e-10
Ecym_27471.356ON452801473e-10
KLTH0D06138g2.502ON489781465e-10
NCAS0A089901.356ON434671448e-10
TBLA0A025705.470ON493731449e-10
TDEL0A027802.502ON451521439e-10
SAKL0E02200g2.502ON511521431e-09
Smik_8.811.356ON468511431e-09
NDAI0K021302.502ON459521421e-09
NDAI0G059601.356ON423551402e-09
KLLA0B13475g2.502ON508521402e-09
ZYRO0B01298g2.502ON411521393e-09
Kwal_26.79022.502ON532521393e-09
Skud_8.681.356ON475511384e-09
Suva_15.1991.356ON457511384e-09
Kpol_1056.372.502ON501521376e-09
Ecym_24402.502ON459531376e-09
SAKL0D09702g1.356ON428661377e-09
ABR008C2.502ON443501368e-09
Smik_8.472.502ON447521368e-09
Suva_8.512.502ON456521369e-09
TPHA0O012801.356ON454511351e-08
NDAI0A043505.470ON459551351e-08
AFR140C5.470ON388671342e-08
YHL002W (HSE1)2.502ON452521332e-08
Kwal_0.3711.356ON217511293e-08
NCAS0A050802.502ON450521323e-08
TPHA0A022101.356ON397511314e-08
KLTH0H12980g1.356ON399511314e-08
Kwal_55.212875.470ON461561314e-08
TDEL0D022401.356ON433631305e-08
CAGL0M01650g5.470ON466561305e-08
CAGL0I08965g1.356ON437721305e-08
Smik_7.3351.356ON460791305e-08
TBLA0D049501.356ON468791305e-08
YFR024C-A (LSB3)1.356ON459791305e-08
Skud_4.6615.470ON460561296e-08
SAKL0G03454g5.470ON468551297e-08
YDR388W (RVS167)5.470ON482561297e-08
Smik_4.6585.470ON472561297e-08
KLLA0A08360g1.356ON423631288e-08
KAFR0C044001.356ON459631288e-08
Skud_8.432.502ON454521288e-08
KLTH0F15114g5.470ON435591288e-08
KNAG0C020401.356ON464511288e-08
TPHA0E015005.470ON457601271e-07
KNAG0C046305.470ON516551271e-07
NCAS0A119205.470ON463561271e-07
AEL017W1.356ON416501271e-07
NCAS0B072501.356ON441511261e-07
TDEL0A033405.470ON473631262e-07
Kpol_1008.251.356ON449511252e-07
Skud_6.1081.356ON459721233e-07
Suva_6.961.356ON455801234e-07
CAGL0A02145g1.356ON391521225e-07
KAFR0E036405.470ON441551216e-07
ZYRO0D11110g5.470ON459551217e-07
ZYRO0G00792g1.356ON469741201e-06
TBLA0F034901.356ON511511191e-06
KAFR0A009701.356ON396511182e-06
NDAI0B045801.356ON424511182e-06
Kpol_440.105.470ON470591163e-06
KNAG0A067102.502ON419581145e-06
KLLA0E03059g5.470ON428621145e-06
KNAG0I015801.356ON581511146e-06
Ecym_25266.366ON524511147e-06
Ecym_23165.470ON421621138e-06
KLTH0E09790g2.159ON622661112e-05
Kpol_1072.562.159ON637521092e-05
TPHA0B028902.159ON634621093e-05
ACR266W2.159ON626511093e-05
TBLA0C055602.159ON673531084e-05
Ecym_23082.591ON678561075e-05
NCAS0D047406.366ON594611041e-04
SAKL0E10780g2.159ON625551032e-04
KAFR0J026506.366ON553501012e-04
TBLA0F002806.366ON576511013e-04
Kwal_47.178942.159ON621611013e-04
ZYRO0D17358g6.366ON668721004e-04
ABR082W2.591ON68356995e-04
SAKL0A00594g6.366ON63651987e-04
Kpol_325.126.366ON57050977e-04
CAGL0C03597g6.366ON58053977e-04
AGR306C5.170ON92358988e-04
KLLA0A04983g4.108ON125160979e-04
NDAI0I002206.366ON61557979e-04
ZYRO0G10098g4.108ON139261960.001
YLR191W (PEX13)7.365ON38672950.001
TPHA0H023806.366ON52850950.001
CAGL0E02783g4.108ON120377950.002
KLLA0C12551g2.591ON60757940.002
TBLA0B096202.319ON94154940.002
SAKL0G17600g4.335ON44159930.003
Suva_10.2877.365ON39286920.003
AGL237C6.366ON57850930.003
Skud_8.1752.159ON63352920.003
Smik_8.1922.159ON63352920.003
Kwal_23.64376.366ON63163920.004
Suva_2.1184.108ON116651920.004
TDEL0A078106.366ON55850910.004
Skud_3.1606.366ON58653910.005
YBL007C (SLA1)4.108ON124451910.005
Smik_2.1134.108ON123051910.005
Smik_3.1866.366ON59153910.005
Suva_3.1246.366ON60053910.005
Ecym_11474.335ON42270900.006
YCR088W (ABP1)6.366ON59253900.007
KLLA0F10175g6.366ON57650900.007
NCAS0A034904.108ON123556900.007
KLLA0E23365g8.539ON57554890.008
TDEL0B052202.159ON61352890.008
Skud_12.2567.365ON40372890.008
Kwal_47.169434.335ON46057890.008
YHR114W (BZZ1)2.159ON63352890.009
KLLA0F23848g2.159ON64954880.011
KLTH0A07348g6.366ON62651880.013
Ecym_72314.108ON114663880.013
KNAG0I027006.366ON57550870.013
Kpol_1025.404.108ON120262880.014
TDEL0G024902.319ON85053870.016
KNAG0C029104.108ON124454870.018
SAKL0H21912g4.108ON125356860.023
Ecym_54262.159ON67263850.024
NCAS0B060202.319ON86455850.026
Skud_2.1044.108ON121451850.026
Suva_15.3102.159ON63452850.027
Ecym_33662.319ON90653850.029
Suva_2.564singletonON4340750.030
Kpol_534.62.319ON88653850.031
KLLA0E09043g2.319ON81452850.032
ZYRO0A02662g2.319ON88653850.033
TDEL0F023804.108ON125557840.040
AER140C4.335ON41457830.043
Kpol_538.255.170ON70756830.044
NDAI0A033304.108ON122656840.045
KLLA0B04862g4.335ON39761820.056
SAKL0H24222g4.45ON152656830.058
TDEL0E055204.45ON158975830.058
NDAI0B033302.319ON91953820.059
SAKL0H10098g8.539ON55564820.061
Smik_13.2022.591ON66362820.071
SAKL0E06820g2.319ON90552820.076
TPHA0G009302.319ON82453810.088
KLLA0E06953g7.419ON35752800.089
CAGL0E01045g8.344ON21377790.093
YDL117W (CYK3)2.319ON88553810.094
ADL288C2.319ON92553800.11
Suva_2.3268.344ON24072790.12
Scer_YGOB_SDC25 (SDC25)4.45ON125263800.12
Skud_4.4208.344ON23372780.12
YMR032W (HOF1)2.591ON66962800.12
TBLA0H011608.344ON22450780.13
Smik_4.1192.319ON88753790.15
ZYRO0B16214g2.159ON65948790.16
Suva_4.1292.319ON88753790.17
TBLA0A006108.539ON59754790.17
Ecym_47107.365ON39960780.17
YDR162C (NBP2)8.344ON23672770.18
TBLA0D004507.413ON100571790.18
Skud_4.1372.319ON88753790.18
CAGL0I02750g2.159ON61951780.19
NCAS0A145707.419ON35555780.19
TBLA0C041004.108ON130263780.21
Kwal_14.23134.45ON151763780.22
AGR170C4.108ON112155780.22
KNAG0H035002.159ON63452780.23
Kpol_1045.217.419ON358109770.26
ZYRO0F13882g8.344ON28853760.27
KNAG0J027504.45ON165264770.29
Ecym_11678.539ON55072760.34
Kwal_26.83232.591ON62762760.35
Smik_4.4068.344ON23572750.35
SAKL0B11176g2.591ON63362760.35
KAFR0F007502.159ON60252760.39
Suva_10.4064.45ON158763760.40
Kwal_53.194498.344ON19950740.40
YLL017WsingletonOFF10361710.44
Suva_4.4548.539ON55292750.44
SAKL0H15048g8.344ON20750730.55
Skud_2.3268.539ON55392740.58
Skud_13.1882.591ON66962740.60
Ecym_42288.344ON26152730.63
NCAS0D019505.170ON93956740.63
KAFR0I010404.108ON120356740.69
Suva_13.2012.591ON66862730.78
TPHA0K016004.108ON113652730.83
CAGL0C01881g7.413ON99952730.87
TDEL0B030708.539ON54185720.99
KLLA0F14575g5.170ON85155721.1
KAFR0B058608.344ON24972711.2
TBLA0H027902.591ON58362711.3
TBLA0E015604.45ON139470721.3
NDAI0J008508.344ON24561701.4
CAGL0E03476g4.45ON156456711.4
TDEL0F046808.344ON26461701.4
KAFR0A055003.433ON105787711.6
Kpol_1045.277.413ON88054701.8
ZYRO0B04004g7.419ON37185701.8
KLTH0C06182g7.413ON102562701.9
Smik_2.3408.539ON55892702.1
Ecym_71347.419ON33253692.1
TPHA0K006807.419ON35554692.2
KLTH0D08580g2.591ON60061692.2
ZYRO0F01166g2.591ON74863702.3
KLLA0D16874g8.344ON22751682.4
KNAG0A050208.344ON27050682.6
Suva_2.337.413ON98254692.8
TPHA0I019308.539ON56686683.1
KAFR0L018807.413ON93049693.1
Kpol_2000.28.344ON22572663.8
ZYRO0B03850g7.413ON108958684.0
KLTH0G11682g8.344ON18750664.3
Kwal_27.107337.413ON101454674.3
KAFR0A056004.310ON225084674.4
KAFR0K020007.419ON33260674.4
AGL286C7.419ON33054674.5
Kpol_1024.458.539ON55454674.5
NDAI0A014707.419ON36755664.9
TPHA0K007207.413ON101154674.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR136W
         (241 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   243   1e-80
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   217   2e-70
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   196   3e-62
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   192   9e-61
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   157   2e-47
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   155   2e-46
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   153   1e-45
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   152   2e-45
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   151   9e-45
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   147   3e-43
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   142   2e-41
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   142   3e-41
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   140   2e-40
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   139   4e-40
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   136   7e-39
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   134   3e-38
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   130   7e-37
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   129   4e-36
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   127   8e-36
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   119   2e-32
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   116   3e-31
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   115   5e-31
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   114   3e-30
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   103   2e-26
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...    91   4e-22
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    80   5e-18
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    72   2e-14
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    64   4e-11
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    64   4e-11
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    63   9e-11
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    63   1e-10
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    62   1e-10
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    61   3e-10
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    61   5e-10
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    60   8e-10
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    60   9e-10
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    60   9e-10
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    60   1e-09
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    60   1e-09
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    59   1e-09
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    59   2e-09
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    59   2e-09
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    58   3e-09
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    58   3e-09
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    58   4e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    58   4e-09
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    57   6e-09
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    57   6e-09
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    57   7e-09
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    57   8e-09
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    57   8e-09
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    57   9e-09
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    57   1e-08
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    57   1e-08
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    56   2e-08
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    56   2e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    54   3e-08
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    55   3e-08
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    55   4e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    55   4e-08
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    55   4e-08
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    55   5e-08
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    55   5e-08
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    55   5e-08
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    55   5e-08
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    55   5e-08
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    55   5e-08
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    54   6e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    54   7e-08
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    54   7e-08
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    54   7e-08
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    54   8e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    54   8e-08
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    54   8e-08
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    54   8e-08
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    54   8e-08
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    54   1e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    54   1e-07
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    54   1e-07
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    54   1e-07
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    53   1e-07
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    53   2e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    53   2e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    52   3e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    52   4e-07
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    52   5e-07
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    51   6e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    51   7e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    51   1e-06
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    50   1e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    50   2e-06
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    50   2e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    49   3e-06
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    49   5e-06
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    49   5e-06
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    49   6e-06
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    49   7e-06
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    48   8e-06
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    47   2e-05
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    47   2e-05
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    47   3e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    47   3e-05
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    46   4e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    46   5e-05
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    45   1e-04
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    44   2e-04
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    44   2e-04
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    44   3e-04
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    44   3e-04
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    43   4e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    43   5e-04
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    42   7e-04
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    42   7e-04
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    42   7e-04
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    42   8e-04
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    42   9e-04
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    42   9e-04
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    42   0.001
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    41   0.001
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    41   0.001
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    41   0.002
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    41   0.002
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    41   0.002
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    40   0.003
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    40   0.003
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    40   0.003
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.003
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.003
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    40   0.004
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    40   0.004
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    40   0.004
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    40   0.005
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    40   0.005
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    40   0.005
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    40   0.005
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    40   0.005
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    39   0.006
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    39   0.007
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    39   0.007
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    39   0.007
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    39   0.008
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    39   0.008
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    39   0.008
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    39   0.008
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    39   0.009
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    39   0.011
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    39   0.013
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    39   0.013
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    38   0.013
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    39   0.014
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    38   0.016
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    38   0.018
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    38   0.023
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    37   0.024
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    37   0.026
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    37   0.026
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    37   0.027
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    37   0.029
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    33   0.030
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    37   0.031
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    37   0.032
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    37   0.033
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    37   0.040
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    37   0.043
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    37   0.044
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    37   0.045
KLLA0B04862g Chr2 (442398..443591) [1194 bp, 397 aa] {ON} conser...    36   0.056
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    37   0.058
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    37   0.058
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    36   0.059
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    36   0.061
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    36   0.071
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    36   0.076
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    36   0.088
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    35   0.089
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    35   0.093
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    36   0.094
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    35   0.11 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    35   0.12 
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    35   0.12 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    35   0.12 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    35   0.12 
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    35   0.13 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    35   0.15 
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    35   0.16 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    35   0.17 
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    35   0.17 
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    35   0.17 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    34   0.18 
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    35   0.18 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    35   0.18 
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    35   0.19 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    35   0.19 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    35   0.21 
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    35   0.22 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    35   0.22 
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    35   0.23 
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    34   0.26 
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    34   0.27 
KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa] ...    34   0.29 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    34   0.34 
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    34   0.35 
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    33   0.35 
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    34   0.35 
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    34   0.39 
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    34   0.40 
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    33   0.40 
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    32   0.44 
Suva_4.454 Chr4 (790985..792643) [1659 bp, 552 aa] {ON} YBR200W ...    33   0.44 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    33   0.55 
Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W ...    33   0.58 
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    33   0.60 
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    33   0.63 
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     33   0.63 
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    33   0.69 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    33   0.78 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    33   0.83 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    33   0.87 
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    32   0.99 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    32   1.1  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    32   1.2  
TBLA0H02790 Chr8 (653275..655026) [1752 bp, 583 aa] {ON} Anc_2.5...    32   1.3  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    32   1.3  
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    32   1.4  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    32   1.4  
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    32   1.4  
KAFR0A05500 Chr1 complement(1094398..1097571) [3174 bp, 1057 aa]...    32   1.6  
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    32   1.8  
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    32   1.8  
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    32   1.9  
Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W ...    32   2.1  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    31   2.1  
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    31   2.2  
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    31   2.2  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    32   2.3  
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    31   2.4  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    31   2.6  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    31   2.8  
TPHA0I01930 Chr9 (435881..437581) [1701 bp, 566 aa] {ON} Anc_8.5...    31   3.1  
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    31   3.1  
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    30   3.8  
ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa] ...    31   4.0  
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    30   4.3  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    30   4.3  
KAFR0A05600 Chr1 complement(1119055..1125807) [6753 bp, 2250 aa]...    30   4.4  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    30   4.4  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   4.5  
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    30   4.5  
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    30   4.9  
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    30   4.9  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    30   4.9  
NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]...    30   5.0  
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    30   5.0  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    30   5.0  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    30   5.8  
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    30   5.9  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     30   5.9  
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    30   6.3  
NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]...    30   6.4  
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    30   6.9  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    30   7.2  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    30   7.9  
NDAI0B01380 Chr2 complement(318357..320486) [2130 bp, 709 aa] {O...    30   8.0  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    29   8.5  
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    30   9.6  
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    29   9.6  
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    29   9.8  

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  243 bits (620), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 121/151 (80%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60
           MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRXXXXXXX 120
           LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTR       
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASPKSA 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXQYPSQQVS 151
                                  QYPSQQVS
Sbjct: 121 EAASSSTVSRPSVPPPSYEPAASQYPSQQVS 151

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  217 bits (552), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 115/150 (76%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60
           MSA+LVNRSLKNIRNELEFL+ESNVISGDIF+LINSKLPEKW+ N RSP NADTEEYVEA
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRXXXXXXX 120
           LYDFEAQQDGDLSLKTGDKIQVLEKISPDWY+GK+NN++GIFPANYVKPAFTR       
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXQYPSQQV 150
                                  QYP QQ 
Sbjct: 121 EGDLSSKVSRPSVPPPSYEPAVSQYPPQQT 150

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  196 bits (499), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 106/150 (70%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60
           MSASL+NRSLKNIRNEL+FLKES VIS DIF LINSKLPEKWD N R   NA  EE+VEA
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVEEFVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRXXXXXXX 120
           LYDFE QQ+GDL LKTGDKIQ+LEKISPDWYRGK+NN++GIFPANYVKPAF R       
Sbjct: 61  LYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSASPENE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXQYPSQQV 150
                                  QYPSQQ 
Sbjct: 121 GASLSSKVSRPSAPPPSYEPVVSQYPSQQA 150

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  192 bits (488), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60
           MSASL+NRSL NIRNELEFLKESNVISG++F  I+S LP KWD N +S  NA TEEYVEA
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTEEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTR 113
           LYDFEAQQDGDLSLKTGDKIQ+LEKIS DWY+GK+N+ IGIFPANYVKPAFTR
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTR 113

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  157 bits (397), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE-EYVE 59
           MSASL+NRSL NIR EL+FLKESNVIS D+F+ IN  LP +WD    S   + T  EYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           ALY F+ QQDGDL LK GDKIQ+LEK+SP+WY+G  N + GIFPANYVKPAF+
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFS 113

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  155 bits (391), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 74/114 (64%), Positives = 89/114 (78%), Gaps = 3/114 (2%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE--EYV 58
           MSASL+NRSL NIR EL+FLK SNVIS D+++ IN  LP KWD    +P+NA     EYV
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWD-PANAPRNASPASLEYV 59

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           EALY F+ QQDGDL LK GDK+Q+LEK+SP+WY+G  N + GIFPANYVKPAF+
Sbjct: 60  EALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFS 113

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  153 bits (387), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 74/114 (64%), Positives = 91/114 (79%), Gaps = 3/114 (2%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQ--NADTEEYV 58
           MSASLVNRSL NIR EL+FLKESNVIS D+F+ IN  LP KWD +  +P+  N+ + EYV
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPS-SAPRGSNSASLEYV 77

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           EA+Y F+ QQDGDL LK GDK+Q+LEK+SP+WY+G  N + GIFPANYVKP F+
Sbjct: 78  EAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFS 131

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  152 bits (384), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 70/113 (61%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE-EYVE 59
           MSASL+NRSL  IR EL+FLKESNVIS D+F+ IN  LP +W+ +  +   +    EYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           ALY F+ QQDGDL LK GDK+Q+LEK+SP+WY+G  N ++GIFPANYVKPAF+
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFS 113

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  151 bits (382), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 92/115 (80%), Gaps = 3/115 (2%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGN---QRSPQNADTEEY 57
           MSASL+NRSL NIR EL+FLKESNVIS + F  IN++LP+++D N   +     A T EY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           VEA+Y FE QQ+GDL+LK GDKIQV+EK SP+W++GK N ++GIFP+NYV+PAF+
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFS 115

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  147 bits (370), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 89/119 (74%), Gaps = 7/119 (5%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWD-GNQRSPQNADTE---- 55
           MS SL+NRSL  IR ELEFLKES VIS  +F+ INS LPE++D  N  S  +A T     
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
             EYVEA+Y F+ QQDGDL+++ GDKIQVLEKISP+WY+G  N K+G+FP+NY KPAF+
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFS 119

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  142 bits (359), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE-EYVE 59
           MSASL+NRSL  IR EL+FL+ES VIS + F+ I++ LP+++D N    +++    EYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           A+Y F+AQQDGDL+LK GDKIQVLEK S +WY+GK N  +G+FP+NYVKPAF+
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFS 113

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  142 bits (358), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 93/115 (80%), Gaps = 3/115 (2%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE---EY 57
           MS++ +NRSL +++ ELEFL++SNVISG+ F+ IN+ LP++ D ++ S    ++    EY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           VEA+Y F+ QQDGDL+++ GDKIQVLEKISP+WY+GK N K+G+FP+NYVKPAF+
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFS 115

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  140 bits (352), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 89/119 (74%), Gaps = 7/119 (5%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQ----RSPQNADTE- 55
           MSASL+NRSL N+R EL+FL+ES VIS + F  I   LP+K+D NQ    RS  ++++  
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
             EYVEALY F+ QQDGDL L+ GDKIQVLEK S +WY+GK   ++G+FP+NYVKPAF+
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFS 119

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  139 bits (350), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 91/114 (79%), Gaps = 3/114 (2%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQ--NADTEEYV 58
           MSAS +NRSL  +R ELEFL+ES+VI+ + +  I S LPE++D + R PQ  +A   E+V
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPS-RGPQQPSATQGEFV 59

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           EA+Y F+AQQDGDL+L+ GDK++VLEK SP+W++GK N ++G+FP+NYVKPAF+
Sbjct: 60  EAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFS 113

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  136 bits (342), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE-EYVE 59
           MSAS +NRSL  +R ELEFL+ESNVI+   +  I   LPE+++  + +P    ++ E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           A+Y F+AQQDGDL+L+ GDKI+VLEK SP+WY+G+ N ++G+FP+NYVKPAF+
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFS 113

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  134 bits (338), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (69%), Gaps = 12/123 (9%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWD-----------GNQRSP 49
           MSAS +NRSL  IR EL+FLKESNVIS + F+ I S LP K+D            N   P
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 50  QNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           Q+    E+VEA+Y FE QQ GDL+LK GDKI+V+EK SP+W++G+ N + G+FP+NYVKP
Sbjct: 61  QD-QGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119

Query: 110 AFT 112
           AF+
Sbjct: 120 AFS 122

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  130 bits (326), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60
           MS S +NRSL NIRNEL+FL+ESNVIS   F+ I  KLP         P    + EYVEA
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPM---SLEYVEA 57

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPA 110
           LYDF+ QQDGDL+++ GDKIQVLEK S +WYRG  N + G+FP+NYV+PA
Sbjct: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPA 107

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  129 bits (325), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 81/113 (71%), Gaps = 1/113 (0%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQN-ADTEEYVE 59
           MS++L+NRSL  IR EL FL +S VI+    E I S LP   +  + +P N A   EYVE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           ALY F+AQQ GDL  K G+KI+VLEK SP+WY+G+ N K+G+FP+NYVKPAF+
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFS 113

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  127 bits (319), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 84/114 (73%), Gaps = 12/114 (10%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE--EYV 58
           MSAS +NRSL  +R EL+FL+ESNVIS +I++++N  LP          QNA  +  EY+
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP----------QNASNKGGEYM 50

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           EALY F+ QQDGDL+L  GDKI+VLEK S +W++G+ N ++G+FPANYVK A++
Sbjct: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYS 104

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  119 bits (297), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 8/114 (7%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDG------NQRSPQNADT 54
           MS   VNRS+ NIR ELE+L ES VIS D F+  N KLP+ WDG       ++ P +   
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPH--E 58

Query: 55  EEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108
            EYVEA++ ++ Q+  DL L+ GDK+++LEK+S DWYRGK+  K+G+FP+NYVK
Sbjct: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  116 bits (291), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 83/138 (60%), Gaps = 29/138 (21%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQR------------- 47
           MS++L+NR++ NI+ EL+FL+ES +I+    + I  +LPEK+D + +             
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 48  ----------------SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY 91
                           +P  A+  EYVEALY FE QQ+GDL L  GDK+Q+LEK S +WY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 92  RGKSNNKIGIFPANYVKP 109
           +G  N +IG+FPANYVKP
Sbjct: 121 KGTCNGQIGMFPANYVKP 138

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  115 bits (288), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 79/114 (69%), Gaps = 2/114 (1%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWD--GNQRSPQNADTEEYV 58
           MS+SL+N+SL  I  EL+FL +SN I    +  I+  LP +     +++   ++  EE+V
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           EA+Y F+ QQDGDL L  GDKI V EK SP+W++GK N K+G+FP+NYV+PAF+
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFS 114

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  114 bits (286), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 75/108 (69%)

Query: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60
           MS+SL+NRSL NI+ ELEFL ESNVIS    + I S L    +G  ++      +EYVEA
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAASQQVLKEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108
           LY F  QQ GDL  K GDKI+VLEK S DWY+G+ N ++G+FP+NYVK
Sbjct: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  103 bits (257), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (66%), Gaps = 8/112 (7%)

Query: 6   VNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADT----EEYVEAL 61
           V  S+  I++EL++LKE   ++   ++ I S LP      +  P  ADT     E VEAL
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRV----RPQPPVADTMGQNNEIVEAL 59

Query: 62  YDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTR 113
           Y F+ QQDGDL+LK GDKI++LEK+SP+WY+GK N ++G+FP+NYVK   T+
Sbjct: 60  YAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSVDTK 111

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score = 90.5 bits (223), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 50/57 (87%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112
           E+VEA+Y F+ QQ+GDL+L  GDKI+VLEK SP+W+RG+ N ++G+FP+NYVKPAF+
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS 60

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 79.7 bits (195), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 45/65 (69%)

Query: 45  NQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPA 104
              S +     EYVE LY+F+ Q   DL +K GDK++V+EK+S DWY+GK N K G+FPA
Sbjct: 4   GHHSNKEKSQGEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPA 63

Query: 105 NYVKP 109
           NYVKP
Sbjct: 64  NYVKP 68

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 66/125 (52%), Gaps = 21/125 (16%)

Query: 1   MSASLVNRSLKN----IRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNA---- 52
           MSA     ++K+    IR  LE L ++  IS + ++ I   L  K    +RSP  +    
Sbjct: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHK----RRSPSASSYSN 56

Query: 53  ---------DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFP 103
                    +  +YVEA+Y +  +Q GDL L  GD I+V+ K SP WY G+ N K+G+FP
Sbjct: 57  PTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFP 116

Query: 104 ANYVK 108
            NYVK
Sbjct: 117 TNYVK 121

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%)

Query: 49  PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108
           PQ  +    V A+Y+  +Q++ +LS + GD I VLE++  DW+RG  + KIGIFP NYV 
Sbjct: 225 PQKPNIIRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVT 284

Query: 109 P 109
           P
Sbjct: 285 P 285

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 34  INSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWY 91
           ++ K+ +   GN+ +  N+ T   V ALY+F  +Q GDL+ K GD I +L+K     DW+
Sbjct: 391 LSHKMSKTGLGNESTATNSATPTAV-ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWW 449

Query: 92  RGKSNNKIGIFPANYVK 108
            G++N K GIFPANYV+
Sbjct: 450 TGRTNGKEGIFPANYVR 466

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%)

Query: 46  QRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPAN 105
           Q+ P  +   + V A+YDF + +  +LS K GD I VLE++  DW+RG    +IGIFP N
Sbjct: 204 QQQPSTSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLN 263

Query: 106 YVKP 109
           YV P
Sbjct: 264 YVTP 267

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 35/52 (67%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V ALYD  A +  +LS + GD I VLE++  DW+RG  + KIGIFP NYV P
Sbjct: 217 VRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V A+YD  A + G+LS K GD I+V+E++  DW+RG     +GIFP NYV P
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query: 31  FELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP-- 88
           F L+N+        + R   ++ T + V ALY F+ +QDGDL  +TGD I +L+K +   
Sbjct: 372 FGLLNTGSKGSHSASIRDRPSSGTPKAV-ALYTFKGEQDGDLPFRTGDVIAILKKSNSQD 430

Query: 89  DWYRGKSNNKIGIFPANYVK 108
           DW+ G+ N + GIFPANYV+
Sbjct: 431 DWWTGRVNGQEGIFPANYVE 450

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 2/78 (2%)

Query: 32  ELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY 91
           ++ N K  E    N+   QN  T   V AL+D   ++  +LS + GD I V+E++  DW+
Sbjct: 193 KVANQKHIESSHHNESQTQN--TVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWW 250

Query: 92  RGKSNNKIGIFPANYVKP 109
           RG+   ++GIFP NYV P
Sbjct: 251 RGRLRGRVGIFPLNYVTP 268

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 44  GNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGI 101
           G    P +        ALY F  +Q GDLS + GDKI +L++     DW+ G+ N K GI
Sbjct: 366 GENTDPTSGHASNEAVALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGI 425

Query: 102 FPANYVK 108
           FPANYV+
Sbjct: 426 FPANYVE 432

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKS 95
           +P  +      PQ+A   E V ALY+++AQ +GDLS   G  I+++++ +   +W+ GK 
Sbjct: 417 VPPSYTSATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKY 476

Query: 96  NNKIGIFPANYVK 108
           N + G+FP NYVK
Sbjct: 477 NGQQGVFPGNYVK 489

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V A+YD  +++  +LS + GD I VLE++  DW+RG    K+GIFP NYV P
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTP 279

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V A+YD  A +  +LS K GD I V+E++  DW+RG    ++GIFP NYV P
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY+F  +Q GDL+ K GD I +L+K     DW+ G++N K GIFPANYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V ALYD       +LS K GD I VLE++  DW++GK  ++ GIFP NYV P
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTP 284

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           E V ALY F  +Q GDL+ K GD I V++K     DW+ GK  NK GIFPANYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V A+YDF + +  +LS K GD I V+E++  DW+RG     +GIFP NYV P
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTP 278

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V+ALYD  + +  +L+ K GD I VLE++  DW+RG     IGIFP NYV P
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTP 283

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V AL+D   +   +LS + GD I+V+E++  DW+RG    KIGIFP NYV P
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTP 280

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY+F  +Q GDL+ K GD I +L+K     DW+ G+ N K GIFPANYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY+F  +Q GDL+ K GD I +L+K     DW+ G+ N K GIFPANYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V A+YD  + +  +LS K GD I VLE++  DW++G     IGIFP NYV P
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTP 291

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPA 110
           V A+Y   A +  +LS   GD I V+E++  DW+RG    K+GIFP NYV P 
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 45  NQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIF 102
           ++RSP ++   + V ALY F+ +Q GDL  + GD + +L+K     DW+ G+ N + GIF
Sbjct: 362 SRRSPASSGAPKAV-ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIF 420

Query: 103 PANYVK 108
           PANYV+
Sbjct: 421 PANYVE 426

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYV 107
           V+A++D  A +  +LS K GD I V+E++  DW+RG    K+GIFP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V ALYD    +  +LS + GD I VLE++  DW++G    K+GIFP NYV P
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 268

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V A+YD    +  +LS + GD I VLE++  DW++G    ++GIFP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  ++ GDLS K GD I +L+K     DW+ G+ N K GIFPANYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++E+ S   +W+ GK N + G+FP NYV+
Sbjct: 401 ETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 42  WDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI-SPDWYRGKSNNKIG 100
           +  +  SP      E   ALYDF AQ DGDLS      I++L++  +  W+ G+ N + G
Sbjct: 318 YGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREG 377

Query: 101 IFPANYV 107
           +FPANYV
Sbjct: 378 LFPANYV 384

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V ALYD    +  +LS + GD I VLE++  DW++G     +GIFP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  +Q GDL  + GD I +L+K     DW+ G++N + GIFPANYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (59%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V ALYD  + +  +LS   GD I VLE++  DW+RG      GIFP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           AL+ F+ +Q GDLS   GD + +L+K     DW+ G+ NN+ GIFPANYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F+ +Q GDL  + GD I +L+K     DW+ G++N + GIFPANYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ +GDL+   G  I+V+E+ +PD   W+ G+ N   G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 3/63 (4%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPAN 105
           SP +++  + V ALY F  ++ GDL  + GD I +L+K     DW+ G+ N + GIFPAN
Sbjct: 370 SPSSSNAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPAN 428

Query: 106 YVK 108
           YV+
Sbjct: 429 YVE 431

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+V+++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 39  PEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSN 96
           P + D +  +P+         ALY F  ++ GDLS + GD I +++K     DW+ GK N
Sbjct: 371 PPRRDASSGAPK-------AVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVN 423

Query: 97  NKIGIFPANYVK 108
            + GIFPANYV+
Sbjct: 424 GREGIFPANYVE 435

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 32  ELINSKLPEKWDGNQRSPQNADTEE-YVEALYDFEAQQDGDLSLKTGDKIQVLEKISP-- 88
            + ++  P+   G   +P +  T      ALY F  ++ GDL  + GD I +L+K     
Sbjct: 379 RISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQN 438

Query: 89  DWYRGKSNNKIGIFPANYV 107
           DW+ G+ N + GIFPANYV
Sbjct: 439 DWWTGRVNGREGIFPANYV 457

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 32  ELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--D 89
            L NSKL      +QR  Q  +      ALY F+ ++ GDLS + GD I +++K     D
Sbjct: 390 RLTNSKLSNTSTLSQR--QTNNNLPKAVALYTFDGEERGDLSFRKGDIIVIIKKSESQDD 447

Query: 90  WYRGKSNNKIGIFPANYVK 108
           W+ G+ N + GIFPANYV+
Sbjct: 448 WWSGRCNGEEGIFPANYVE 466

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 32  ELINSKLPEKWDGNQRSPQNADTEE-YVEALYDFEAQQDGDLSLKTGDKIQVLEKISP-- 88
            + ++  P+   G   +P +  T      ALY F  ++ GDL  + GD I +L+K     
Sbjct: 378 RISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQN 437

Query: 89  DWYRGKSNNKIGIFPANYV 107
           DW+ G+ N + GIFPANYV
Sbjct: 438 DWWTGRVNGREGIFPANYV 456

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQR-TPDANEWWTGRYNGQQGVFPGNYVQ 456

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ +GDL+   G  I+V+E+ +    W+ G+ N + G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPAN 105
           SP          ALY F+ ++ GDL  + GD I +++K     DW+ G+ N K GIFPAN
Sbjct: 359 SPARNSGAPKAVALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPAN 418

Query: 106 YVK 108
           YV+
Sbjct: 419 YVE 421

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPAN 105
           +P ++       ALY F  ++ GDL  + GD I +L+K     DW+ G+ N + GIFPAN
Sbjct: 395 APSSSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPAN 454

Query: 106 YVK 108
           YV+
Sbjct: 455 YVE 457

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
           V ALYD    +  +LS +  D I VLE++  DW++G    K+GIFP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI--SPDWYRGKSNNKIGIFPANYVK 108
           A   E V ALYD++AQ +GDL+   G  I+V+E+   +  W+ G+ N   G+FP NYV+
Sbjct: 374 ASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  ++ GDL  + GD I VL+K     DW+ G+ N + GIFPANYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 51  NADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
            A   EY  +LY+++AQ  GDLS   G  IQ++++ +   DW+ G  N + G+FP NYV+
Sbjct: 395 TAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +   +W+ G+ N + G+FP NYV+
Sbjct: 459 ETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           E V ALY+++AQ  GDLS   G  I+++E+ +PD   W+ G+ N + G+FP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQGVFPGNYVQ 459

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYV 107
           ALY F+ +Q GDL  + GD I +L++     DW+ G+ N + GIFPANYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  ++ GDL  + GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 5/63 (7%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPAN 105
           +P  A+T   V ALYD++AQ  GDLS   G  I+V+++     +W+ G+ N + G+FP N
Sbjct: 410 APPAANT---VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGN 466

Query: 106 YVK 108
           YV+
Sbjct: 467 YVQ 469

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  ++ GDL  K GD I +L+K     DW+ G+ N   GIFPANYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 39  PEKWDGNQRSPQNADTEE-YVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKS 95
           P+   G   +P +  T      ALY F  ++ GDL  + GD I +L+K     DW+ G+ 
Sbjct: 385 PQTSQGRFTAPTSPSTSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRV 444

Query: 96  NNKIGIFPANYV 107
           + + GIFPANYV
Sbjct: 445 SGREGIFPANYV 456

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 32  ELINSKLPEKWDGNQRSPQNADTEE-YVEALYDFEAQQDGDLSLKTGDKIQVLEKISP-- 88
            + ++  P+   G   +P +  T      AL+ F  ++ GDL  + GD + +L+K     
Sbjct: 374 RISSASTPQTSQGRFAAPTSPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQN 433

Query: 89  DWYRGKSNNKIGIFPANYVK 108
           DW+ G+ N + GIFPANYV+
Sbjct: 434 DWWTGRVNGREGIFPANYVE 453

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYV 107
           V ALYDF  QQ GDLS K  D I V +K     DW+ G ++   G+FPANYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKIS--PDWYRGKSNNKIGIFPANYVK 108
           E V ALY+++AQ  GDLS   G  I+++++ +   +W+ G+ N + G+FP NYV+
Sbjct: 384 ETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKI--SPDWYRGKSNNKIGIFPANYVK 108
           E V ALYD++AQ  GDLS      I+++++   + +W+ G+ + ++G+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 40  EKWDGNQRSPQNADT---EEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGK 94
           EK +    SP   DT        ALY F  ++ GDL  + GD I +L+K     DW+ G+
Sbjct: 394 EKAEFGAASPSAGDTFSNTPKAVALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGR 453

Query: 95  SNNKIGIFPANYVK 108
              + GIFPANYV+
Sbjct: 454 VGGREGIFPANYVE 467

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  ++ GDLS + GD I +++K     DW+ G+ + + GIFPANYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY+F  +++GDL  K GD I ++++     DW+ G  N K G+FPANYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           ALY F  ++  DL  + GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKIS--PDWYRGKSNNKIGIFPANYVK 108
           A   E   +LY+++AQ  GDLS   G  I+++E+ +   +W+ G+ N + G+FP NYV+
Sbjct: 409 APQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109
            +T + V A+YD E     +L+ +  D I V+E+   DW+ G    ++GIFP NYV P
Sbjct: 213 TNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTP 270

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI-SPDWYRGKSNNKIGIFPANY 106
           +P  +   E   ALYD+ AQ +GDL+   G  IQV+++  +  W+ G  N   G+FP NY
Sbjct: 363 TPPTSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNY 422

Query: 107 VK 108
           V+
Sbjct: 423 VE 424

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYRGKSNNKIGIFPANYVK 108
           AL+DF   + GDL+ K GD I ++++     DW+ G+ N + G+FPANYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYVK 108
           A YD+EA +D +L+ K GD+I  +E +  DW+ G  K+  + G+FP+NYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI-SPDWYRGKSNNKIGIFPANY 106
           +P  A   E   +LY F AQ   DL+      I++L++  S  W+ G+ N + G+FP NY
Sbjct: 356 TPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNY 415

Query: 107 VK 108
           V+
Sbjct: 416 VR 417

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 47  RSP---QNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEK-ISPDWYRGKSNNKIGIF 102
           R+P   ++ +    V+AL+D+EAQ D ++S++ GD I VL+      W  G+ N + G+F
Sbjct: 557 RAPPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLF 616

Query: 103 PANYVK 108
           P NY +
Sbjct: 617 PTNYCQ 622

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           VEA+YD+EA  D +LS+  G+ I+V+       W  G+SN   G+FP++Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANY 106
           S +   T   V+ALYD+EAQ D ++S+  GD I V++      W  G+ N   G+FP++Y
Sbjct: 573 SRRKTTTTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSY 632

Query: 107 VK 108
            K
Sbjct: 633 CK 634

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYRGKSNNKIGIFPANYV 107
           V A+YD+ AQ D ++S++ GD I+VL   + + W  G+ N   G+FP+NY 
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 7/53 (13%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPD----WYRGKSNNKIGIFPANYVK 108
           ALY +EAQ D ++SL  GD I+V   I PD    W  G+ NNK  +FP +Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKV---IKPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEK-ISPDWYR--GKSNNKIGIFPANYVK 108
           + LY +    D ++S+  GD I V+EK     W +    S  +IG+ P++Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  YVEALYDFEAQQDGD-LSLKTGDKIQVLEKISPDWYRGK---SNNKIGIFPANYVK 108
           Y +ALY F    + D L+ + GD + + EK++ DWY G+   SN + G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 49  PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANY 106
           P+    E +  A YD+EA +D +L+    DKI  +E +  DW+ G  +S+ + G+FP+NY
Sbjct: 530 PEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNY 589

Query: 107 V 107
           V
Sbjct: 590 V 590

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 7/55 (12%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPD----WYRGKSNNKIGIFPANYVK 108
           +EALYD++AQ D +LS+  G  ++VL+   PD    W  G+ +   G+FP +Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVLK---PDDGSGWTYGELDGAKGLFPTSYCK 625

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           A YD+EA +D +L+ +  DKI  +E +  DW+ G  + N + G+FP+NYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYVK 108
           A YD+EA +D +L+    DKI  +E +  DW+ G  +S+ + G+FP+NYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 49  PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEK-ISPDWYRGKSNNKIGIFPANYV 107
           P+       VEA+Y ++AQ + + SL  GD I VL+      W  G+ N + G+FP +Y 
Sbjct: 561 PRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYC 620

Query: 108 K 108
           K
Sbjct: 621 K 621

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--S 95
           LP +   N+    N  +     A YD++A +D +L+ +  DKI  +E +  DW+ G+  S
Sbjct: 593 LPARHVENENESGNTSSNPSAIAEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGS 652

Query: 96  NNKIGIFPANYV 107
             + G+FP+NYV
Sbjct: 653 TGEKGLFPSNYV 664

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 57  YVEALYDFEAQQDGD-LSLKTGDKIQVLEKISPDWYRGK---SNNKIGIFPANYVK 108
           Y  A+Y F    D D L  + GD + + EK++ DWY G+    N K G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYVK 108
           A YD+EA ++ +L+   GDKI  +E +  DW+ G  +   + G+FP+NYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           A YD++A +D +L+   GDKI  +E +  DW+ G  +   + G+FP+NYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           +  A YD+EA +D +L+ +  DKI  +E +  DW+ G  +   + G+FP+NYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY-----RGKSNNKIGIFPANYVKPA 110
           V A Y +E+  DGDL+ + G +I+V+      WY      G  N + GIFP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKS--NNKIGIFPANYVK 108
           A T++  +A+YDF A    +L++K GD I +L ++ S DWY  +S    K GI PA +V+
Sbjct: 409 AMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVE 468

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYRGK-------SNNKIGIFPANYVKPA 110
           +ALYD+ AQ D +L++K GD + +LEK S  DW+  K        +  +G+ P  Y++ A
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVK 108
           V ALYD+E  Q+   +L     D  Q+ +    DW+  +   N+++G  P NYV+
Sbjct: 74  VVALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNYVE 128

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 53  DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           +T+ +  A YD++A ++ +L+    DKI  +E +  DW+ G  + N + G+FP+NYV
Sbjct: 555 ETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 41.6 bits (96), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYRGK-------SNNKIGIFPANYVKP 109
           V+ALYD+E Q D +L++K  D + +LEK   D W+  K       +    G+ P+NYV+P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 110 A 110
           A
Sbjct: 68  A 68

 Score = 29.6 bits (65), Expect = 8.8,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKPA 110
           V ALYD+E  Q  D +++    +   + +    DW   + KS+   G  P NYV+PA
Sbjct: 74  VRALYDYEEAQNPDEEITFLENELFDLFDDQDQDWLLVQSKSSGAYGFIPGNYVEPA 130

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 44  GNQRSPQNADTEEYVEALYDFEAQQ-DGDLSLKTGDKIQVLEKISP-----DWYRGKS-N 96
           GN   P +    E+  ALYDF  +  + +++LK GD + +L K  P     DW++ ++ N
Sbjct: 297 GNGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKN 356

Query: 97  NKIGIFPANYVK 108
             IG  P NY++
Sbjct: 357 GNIGYIPYNYIE 368

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYV 107
           A YD++A +D +L+   G KI  +E +  DW+ G+  +  + G+FPANYV
Sbjct: 475 AEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 9/77 (11%)

Query: 41  KWDGNQRSPQNADTEEYVE------ALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRG 93
           ++ G QR P   + E   +      ALYDFEA+   +L+++ GD + V+ +K S DW+  
Sbjct: 352 EFKGAQRDPGLREVEMATKSSKRGVALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMV 411

Query: 94  K--SNNKIGIFPANYVK 108
           +  SN K G+ PA +++
Sbjct: 412 ELISNGKKGLVPAQFIE 428

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDW--YRGKSNNKIGIFPANYVKPA 110
           + ALYDF+  Q+   +L  K  D   V +   PDW   R  S+N+ G  P NYV+PA
Sbjct: 74  MRALYDFDQAQNPQEELVFKENDMFDVYDDKDPDWILVRSHSSNEYGFVPGNYVEPA 130

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 56  EYVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYRG---KSNNKIGIFPANYVK 108
           +YV+A+Y + E  ++  L   +GD + ++E I+ DWY G   + N + G+ P NYVK
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYVK 108
           V+A Y +  Q  GDL    GD ++V  KI+ DWY G+   N K  G FP N+VK
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFPNNFVK 67

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 7/59 (11%)

Query: 57  YVEALYDF--EAQQDG---DLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYVK 108
           Y  ALYD+  +  Q G   DL+ K GD I+V++K   +W+ G+     + G FP N+V+
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 30  IFELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQ-DGDLSLKTGDKIQVLEKISP 88
           I ++ NS   +   GN   P +    E+  ALYDF  +    +++LK GD + +L K  P
Sbjct: 289 IAKVQNSGAIQASQGNGDEPIDPSKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDP 348

Query: 89  -----DWYRGKS-NNKIGIFPANYVK 108
                DW++ ++ N  IG  P NY++
Sbjct: 349 LGKDSDWWKVRTKNGSIGYIPYNYIE 374

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           A YD+EA +D +L+ + GD I  ++ +  DW+ G  +   + G+FP+NYV
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYV 574

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           +EA+Y +EAQ D ++S+  GD+I V+       W  G+ +   G+FP +Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           +EA+Y +EAQ D ++S+  GD I V+       W  G+ +   G+FP +Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 48  SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPAN 105
           SP+  +      A YD EA++  +L+ K GDKI  +  +  DW+ G  +   + G+FP+N
Sbjct: 566 SPEQGEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSN 625

Query: 106 YVK 108
           YV+
Sbjct: 626 YVQ 628

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGK--SNNKIGIFPANYVKP 109
           YDF A+   +L++K+GDK+ +L +K S DW+  +   + K G+ PA +V+P
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEP 404

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           A YD+EA ++ +L+    DKI  ++ +  DW+ G  + N + G+FP+NYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGK--SNNKIGIFPANYVKP 109
           YDF A+   +L++K+GDK+ +L +K S DW+  +   + K G+ PA +++P
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEP 412

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYVKP 109
           V A+YD+E  Q+ D  L+    D   V +    DW   KS  +N+ G  P NYV+P
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFDVFDDKDADWLLVKSTVSNEFGFIPGNYVEP 129

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGK--SNNKIGIFPANYVKP 109
           YDF A+   +L++K+GDK+ +L +K S DW+  +   + K G+ PA +++P
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEP 409

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYVKPA 110
           V A+YD+   Q+ D  L+    D   V +    DW   KS  +N+ G  P NYV+PA
Sbjct: 74  VRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA 130

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 44  GNQRSPQNADTEEYVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYRG---KSNNK 98
            N  S Q A    Y   LYD+E Q +    LS+K GD IQ++ +    W+ G   ++  K
Sbjct: 348 SNSNSLQKAVPTMYATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKTK 407

Query: 99  IGIFPANYVK 108
            G+FP +YV+
Sbjct: 408 -GLFPQSYVQ 416

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           A YD+EA +D +L+ +  ++I  ++ +  DW+ G  +S+ + G+FP+NYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 58  VEALYDF-EAQ-QDGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKP 109
           ++ALYD+ EAQ Q+ +L+    D   V +   PDW   + +++N++G  P NYV+P
Sbjct: 74  MKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYVEP 129

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 17  LEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNAD-TEEYVEALYDFEAQQDGDLSLK 75
           LE    +N    +I  +I        D   R  Q A  +++    ++DF  +   +L++K
Sbjct: 329 LELHTGNNDTCNEIMSIIGEFKGASRDPGLREVQMATKSKKQARIMFDFIGEAQDELTVK 388

Query: 76  TGDKIQVL-EKISPDWYRGK--SNNKIGIFPANYVKP 109
            GD + +L +K S DW+  +   ++K G+ PA +V+P
Sbjct: 389 EGDMVYILNDKSSKDWWTCELVDSHKRGVVPAQFVEP 425

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 55  EEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANY 106
           E+ ++ALY+++AQ  G+LS   GD   V ++ + DWY     ++ K G+ P NY
Sbjct: 65  EKVIKALYNYQAQSAGELSFNKGDFFHVQQEEN-DWYEASNPADGKRGMVPKNY 117

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           ++A YD+EAQ D +LSL   D + V+       W  G+ N + G+FP +Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 7/72 (9%)

Query: 44  GNQRSPQNADTEEYVEALYDFEAQQDG-DLSLKTGDKIQVLEKISP-----DWYRGKS-N 96
           G+   P +    E+  ALYDF  +    +++L  GD + +L K  P     DW++ ++ N
Sbjct: 314 GSGSEPIDPSKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKN 373

Query: 97  NKIGIFPANYVK 108
            KIG  P NY++
Sbjct: 374 GKIGYIPYNYIE 385

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 57  YVEALYDFEAQ---QDGDLSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYVK 108
           Y  AL+D+E     Q  DL+ +  + I+V++K    W+ G++    K G FPANYV+
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           +EA+Y +EAQ D ++S+  GD I V+       W  G+ +   G+FP +Y K
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 55  EEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKSNNKIGIFPANYV 107
           ++ + A Y +++Q   +LSL+ GDKI+VL E     W  G+ N   G+FP  Y 
Sbjct: 595 QKTMTAAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYVK 108
           A YD EA++  +L+ + GDKI  +  +  DW+ G  +   + G+FP+NYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 50  QNADTEEYVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPAN 105
           + AD    V A+YD++  Q+ D  LS + GD   + +    DW+  R   + K+G  P N
Sbjct: 66  EEADVLYQVHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGN 125

Query: 106 YVK 108
           YV+
Sbjct: 126 YVE 128

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYRGK-------SNNKIGIFPANYVKPA 110
           +A+Y +E Q D +L ++  D + VLEK    DW+  K       +   +G+ P NY++ A
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG--KSNNKIGIFPANYV 107
           A YD++A ++ +L+    DKI  +E +  DW+ G  + N + G+FP+NYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 52  ADTEEYVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYV 107
           AD    V+A+YD+   Q+ D  L     D   V +   PDW   R  S N+ G  P NYV
Sbjct: 68  ADVISQVKAVYDYHEVQNPDEELVFNENDTFDVYDDKDPDWILARSISTNQFGFIPGNYV 127

Query: 108 KP 109
           +P
Sbjct: 128 EP 129

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGK--SNNKIGIFPANYVKP 109
           LYDF A+ + +L++K G  + ++ ++ S DW+  +   + K G+ P+++++P
Sbjct: 388 LYDFTAESNDELTIKQGQVVYIINDQKSKDWWLCELIDSGKRGVVPSHFIEP 439

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+ DW+ GK   N K  G FP N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFV 64

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 60  ALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKP 109
           ALYD++  Q+ D  L+ K  D   + +   PDW   R + +  +G  P NYV+P
Sbjct: 76  ALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 57  YVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDW--YRGKSNNKIGIFPANYVK 108
           + +ALYD++  Q+ D  L    GD+  V +   PDW     K++ +IG  P NYV+
Sbjct: 73  HAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVE 128

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 46  QRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKSNNKIGIFPA 104
           +R+P +  T   V A+YD+ A+   ++S++ GD I+V+ +     W  G+     G+FP+
Sbjct: 612 RRNPTSLRT---VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPS 668

Query: 105 NYV 107
           NY 
Sbjct: 669 NYC 671

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYVKP 109
           V A Y +  Q  GDL    GD ++V  +++ DW+ G+   N K  G FP N+V P
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGK--SNNKIGIFPANYVKP 109
           Y+F A+   +L++K+GDK+ +L+ K S DW+  +   + K G+ PA +++P
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEP 405

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYVKP 109
           V A+YD+E  Q+ D  L+    D   VL+    DW   KS  +N+ G  P NYV+P
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNYVEP 129

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           +EA Y +EA+ D ++S+  GD I V+       W  G+ +   G+FP +Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYVK 108
           V ALY +  +Q  DL     D I+V  K+  DW  G+   N K G FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 33.5 bits (75), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 72  LSLKTGDKIQVLEKISPD---WYRGKSNNKIGIFPANYVK 108
           L+   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQR-TPDANEWWTGRYNGQQGVFPGNYVQ 39

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V A Y +  Q  GDL    GD ++V +KI+ DW+ G    N K  G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYV 107
           V+  + +  ++  DL    GD I+V  +++ DWY GK   N K G FP+NYV
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEV-TRVTGDWYFGKLIRNKKQGYFPSNYV 61

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+ DW+ G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKPA 110
           V ALYD++  Q+ D  L+    ++  V +   PDW   + KS    G  P NYV+P 
Sbjct: 74  VRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPC 130

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYRGK-------SNNKIGIFPANYVKPA 110
           +ALYD+E Q   +L+++  + + +LEK   D W+  K       ++  +G+ P+NYV+ A
Sbjct: 9   KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVEQA 68

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 6/57 (10%)

Query: 57  YVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYRG---KSNNKIGIFPANYVK 108
           Y  ALYD++ Q +    LS+K GD IQV+ +    W+ G   ++  K G+FP +YV+
Sbjct: 353 YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTK-GLFPQSYVQ 408

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNK-----IGIFPANYVK 108
           V A+  +E Q   DL +  GDKI VL      WY G+  +K      GIFP+++VK
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYVKP 109
           V+ALYD+E  Q+ +  L     D   V +   PDW   KS  +N++G  P NYV+P
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQP 129

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGK--SNNKIGIFPANYVK 108
           A +++    L DF A+ + +L++K GD + +L +K S DW+  +     + G+ PA +++
Sbjct: 368 AKSKKQARVLVDFIAESNDELTVKEGDMVYILNDKKSKDWWMCELVKTGEKGVVPAQFIE 427

Query: 109 P 109
           P
Sbjct: 428 P 428

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYRGK-------SNNKIGIFPANYVKPA 110
           +A+YD+E Q   +L LK  D + +LEK    DW+  K       +   +G+ P+NY++ A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

>KLLA0B04862g Chr2 (442398..443591) [1194 bp, 397 aa] {ON} conserved
           hypothetical protein
          Length = 397

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 49  PQNADTEEYVEALYDF---EAQQDGDLSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFP 103
           P    + +Y +A+ DF   E   +  LSL+  D I++  K +  W+ G+S   NKIG FP
Sbjct: 329 PYQKHSPQYCKAIADFVPTEEDSENSLSLRKEDVIKIYRKEAEVWWYGQSLRTNKIGYFP 388

Query: 104 A 104
            
Sbjct: 389 V 389

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG---KSNNKI--GIFPANYVK 108
           V A YD+   +   L L  GD + VL K    W+ G    SNNK   G FP NY K
Sbjct: 26  VVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 45  NQRSP-QNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG---KSNNKI- 99
           +Q SP  N    + V A++D+  +   +L+L+ GD I V+ K    W+ G   ++N K+ 
Sbjct: 37  DQSSPICNVSPVDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVH 96

Query: 100 -GIFPANYVKPAFTR 113
            G FP NY + + ++
Sbjct: 97  RGWFPQNYCRSSHSQ 111

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V A Y +  Q  GDL    GD ++V  +++ DW+ GK   N K  G FP N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGDIMEV-TRVAGDWFYGKLLRNRKCAGYFPNNFV 66

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 6/64 (9%)

Query: 48  SPQNADT---EEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIF 102
           +P++ D    E+ ++A+Y+++AQ  G+LS   GD   VL +   +WY     S+ K G+ 
Sbjct: 58  APKSKDISSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMV 116

Query: 103 PANY 106
           P +Y
Sbjct: 117 PKSY 120

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
           Y   LYDF+A++  +L+   G+ + V    + +W+  K   ++   G+ P  +V
Sbjct: 158 YAIVLYDFQAEKSDELTSYAGENLFVCAHHNYEWFIAKPIGRLGGPGLVPVGFV 211

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYRGK--------SNNKIGIFPANY 106
           EY +A+Y     +   L+    GD I + E ++ DWY+G+         N+++G+ P N+
Sbjct: 596 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNF 655

Query: 107 VK 108
           ++
Sbjct: 656 IQ 657

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYV 107
           V+A+Y +  +++ DL     D I+V  K    WY G+   N K G FPANYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG---KSNNKIGIFPANYV 107
           V+A Y +  Q  GDL    GD + V  K + DWY G   ++    G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 35.4 bits (80), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 59  EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108
           EALY ++A Q    ++S + G+ ++V +     W   KSN + GI P+NYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 35.0 bits (79), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 9/77 (11%)

Query: 40  EKWDGNQRS-------PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY- 91
           E  DGN          PQ+    +   ALYDFE + D +L LK GD I +  +    W  
Sbjct: 74  EDIDGNHTDKRASVVMPQDYVVNQKAVALYDFEPENDNELGLKEGDVIFISYRHCQGWLV 133

Query: 92  -RGKSNNKIGIFPANYV 107
            +  +  K G+ P  +V
Sbjct: 134 AQNDTQTKTGLVPEEFV 150

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ GK   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGKLLRNKKCSGYFPHNFV 65

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 35.4 bits (80), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYVK 108
           V+A+Y +  + + DL     D I+V  K+  +W  G+   N K G FP NYV+
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQ 63

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKS 95
           LP+ +  NQR+           ALYDFE + D +L L  GD + +  K    W     +S
Sbjct: 105 LPDDYIVNQRAV----------ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENES 154

Query: 96  NNKIGIFPANYV 107
            +K G+ P  +V
Sbjct: 155 RSKTGLVPEEFV 166

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
           1252 aa] {ON} ANNOTATED BY YGOB - skipping over
           frameshift in strain S288c
          Length = 1252

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG-------KSNNKIGIFPANYVKPA 110
           VE  Y +  +    LSL+ GD I VL K S  W+ G        +NN   I    +  P+
Sbjct: 31  VECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVLIRHSANNNNNSLILDRGWFPPS 90

Query: 111 FTR 113
           FTR
Sbjct: 91  FTR 93

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKS 95
           LP+ +  NQR+           ALYDFE + D +L L  GD + +  K    W     +S
Sbjct: 105 LPDDYIVNQRAV----------ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENES 154

Query: 96  NNKIGIFPANYV 107
            +K G+ P  +V
Sbjct: 155 RSKTGLVPEEFV 166

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYRGK--------SNNKIGIFPANY 106
           EY +A+Y     +   L+    GD + + E ++ DWY+G+         N++IG+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 107 VK 108
           ++
Sbjct: 662 IQ 663

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKIGIFPANYV 107
           ALYDF  + D +L L  GD I +  K    W   +  +NNKIG+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKSNNKIGIFPANYVK 108
           YD++AQ++ +++++ GD + VL E     W   + +   G+ P NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
           Y   LYDFEA ++ +L++  G+ + +      +W+ G+   +I   G+ P ++V
Sbjct: 165 YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIGGPGLVPISFV 218

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 56  EYVEALYDFEAQQDG-DLSLKTGDKIQVLEKISP-----DWYRGKS-NNKIGIFPANYVK 108
           E+  A+YDF  +    + SLK GD + ++ K+ P      W++ ++   ++G  P+NY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKS 95
           LP+ +  NQR+           ALYDFE + D +L L  GD + +  K    W     +S
Sbjct: 105 LPDDYIVNQRAV----------ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENES 154

Query: 96  NNKIGIFPANYV 107
            +K G+ P  +V
Sbjct: 155 GSKTGLVPEEFV 166

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 43  DGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKIS---PDWYRG--KSNN 97
           DG++ +P    T     A+ +++ + D +L++  GDKIQVL   S     WY G   + N
Sbjct: 11  DGDKNAP--TKTFPLYMAVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTN 68

Query: 98  KIGIFPANYVK 108
           + G++P N+ +
Sbjct: 69  EKGLYPLNFTQ 79

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK--SNNKI-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYV 107
           + A Y++ +Q D +LSL  GD + VL+      W  G+ N   G+ P +Y 
Sbjct: 568 ITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSYC 618

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 6/55 (10%)

Query: 58  VEALYDFEAQQDGD---LSLKTGDKIQVLEKISPDWYRG-KSNNKIGIFPANYVK 108
           V+ALY ++A  D D   LS + GD ++V   I   W++  K N + GI P+NYVK
Sbjct: 300 VKALYSYKAD-DSDAYELSFEQGDILKV-SDIEGRWWKARKENGQTGIIPSNYVK 352

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 50  QNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGK--SNNKIGIFPANY 106
           Q + T+   +  YDF A+   +L++  GD + V+ ++ S +W+  +  S  K G+ PA++
Sbjct: 391 QASQTKRKAQISYDFLAESHDELTVHAGDAVYVIDDQKSSEWWMVELISTGKKGVVPADF 450

Query: 107 VKP 109
           V+P
Sbjct: 451 VEP 453

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKP 109
           V+A+Y+++  Q+ D  L     +   V +    DW   + +S N++G  P NYV+P
Sbjct: 74  VKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEP 129

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
           (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 10/63 (15%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEK----------ISPDWYRGKSNNKIGIFPANYV 107
           V A  DF A +   L L  GD + VL K          +SP   RG      G FP N+ 
Sbjct: 26  VIASCDFVATKKSQLRLNVGDVVYVLGKNESGWWDGVVVSPGGVRGAHRCVRGWFPQNHT 85

Query: 108 KPA 110
           +PA
Sbjct: 86  RPA 88

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDW--YRGKSNNKIGIFPANYVK 108
           V ++YD+E  Q+ D  L  + GD+  V +    DW   R +++  +G  P NYV+
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVE 128

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           V A Y + AQ D +LSL+ GD ++V++      W  G+ +   G+ P +Y K
Sbjct: 583 VTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 49  PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD----WY--RGKSNNKIGIF 102
           PQ + ++E  + LY +  Q D ++S+  GD   V+E ++PD    W   R  +    G+ 
Sbjct: 497 PQASSSDEENKVLYAYTQQDDDEISVTPGD---VIELVTPDSGSGWTQIRNVTTGAEGLV 553

Query: 103 PANYV 107
           P  Y+
Sbjct: 554 PTTYI 558

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 20/109 (18%)

Query: 13  IRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVE-----------AL 61
           IRN  + LK SN       E +N+ + E  +GN  +        Y E           AL
Sbjct: 249 IRNPTDTLKTSN-------ENVNTFVTESSNGNTETTMGDTLGLYSEFGDESFPYTARAL 301

Query: 62  YDFEAQ-QDG-DLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108
           Y ++A   DG ++S + G+ ++V +     W   K   ++GI P+NYV+
Sbjct: 302 YSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNN--KIGIFPANYVKPA 110
           ALYDFE + D +L L+ GD + +  +    W   ++ N  K G+ P  +V  A
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYA 185

>KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa]
           {ON} Anc_4.45 Scer_YGOB_SDC25
          Length = 1652

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 54  TEEYVEALYDFE---AQQDGDLSLKTGDKIQVLEKISPDWYRGKS----NNKI--GIFPA 104
           T + V A++DF    A     LS + GD + VL K +  W+ G S    +NK+  G FP 
Sbjct: 89  TLDIVVAVHDFNYPPASATNKLSFQRGDTVYVLAKSASGWWDGLSIADTDNKVIRGWFPY 148

Query: 105 NYVK 108
           N+V+
Sbjct: 149 NHVR 152

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 41  KWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKS--NNK 98
           K +G   SP N +    ++ALY + AQ  G+LS   G+ + V+ +   +W+   S  + +
Sbjct: 53  KNNGGGVSPSN-EVPIILKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGR 110

Query: 99  IGIFPANYVKPA 110
            G+ P +Y +P 
Sbjct: 111 KGMVPKSYFEPV 122

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
           Y   LYDF+A++  +LS   G+ + +    + +W+  K   ++   G+ P  +V
Sbjct: 150 YAIVLYDFKAEKSDELSAFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFV 203

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYRGK---SNN-----KIGIFPANY 106
           +Y +ALY F EA +   ++ + GD + + E++  DW+ G+   S++     + GI P NY
Sbjct: 563 KYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRYGIIPRNY 622

Query: 107 VK 108
           ++
Sbjct: 623 IE 624

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKS 95
           LP+ +  NQR+           ALYDFE + D +L L  G+ + +  K    W     +S
Sbjct: 105 LPDDYIVNQRAV----------ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENES 154

Query: 96  NNKIGIFPANYV 107
            +K G+ P  +V
Sbjct: 155 RSKTGLVPEEFV 166

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNN--------KIGIFPANY 106
           +Y +ALY + E  ++  ++ +  D I + ++++ DWY G+  N        + G+ PANY
Sbjct: 569 KYAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGLVPANY 628

Query: 107 VK 108
           ++
Sbjct: 629 IE 630

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYRGKSNNKIGIFPANYVK 108
           +E ++D+ AQ D ++S+  GD + V++      W  G+ N   G+ P +Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 11/63 (17%)

Query: 58  VEALYDFE--AQQDGD---LSLKTGDKIQVLEKISPDWYRG----KSNNKI--GIFPANY 106
           V A YDF    ++DG    LS++ GD I +L K S  W+ G     S+ K+  G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 107 VKP 109
            +P
Sbjct: 126 GRP 128

>Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2) -
           interacts with Nap1, which is involved in histone
           assembly [contig 398] FULL
          Length = 199

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYV 107
           ALYDF A+ D +L LK GD + +  + +  W   ++    + G+ P  YV
Sbjct: 76  ALYDFVAENDNELELKEGDVLFIGYRHAQGWLVAENMDRTRTGLVPEEYV 125

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essential
           Ras guanine nucleotide exchange factor (GEF) localized
           to the membrane; expressed in poor nutrients and on
           non-fermentable carbon sources; homologous to CDC25;
           contains a stop codon in S288C; full-length gene
           includes YLL016W
          Length = 103

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG-------KSNNKIGIFPANYVKPA 110
           VE  Y +  +    LSL+ GD I VL K S  W+ G        +NN   I    +  P+
Sbjct: 31  VECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVLIRHSANNNNNSLILDRGWFPPS 90

Query: 111 F 111
           F
Sbjct: 91  F 91

>Suva_4.454 Chr4 (790985..792643) [1659 bp, 552 aa] {ON} YBR200W
           (REAL)
          Length = 552

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 25  VISGDIFELINSKLPEKWDGNQRSPQNADTEE------YVEALYDFEAQQDGDLSLKTGD 78
           V+    FE+ +   P   +G   S +    E       Y   LYDF+A++  +L+   G+
Sbjct: 122 VVPKSYFEVFDRTRPSSVNGTNSSSRKVTNESLNMGSLYAIVLYDFKAEKADELTTYVGE 181

Query: 79  KIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
            + +    + +W+  K   ++   G+ P  +V
Sbjct: 182 NLFICAHHNCEWFIAKPIGRLGGPGLVPVGFV 213

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYV 107
           A+YDF  + D +L+LK GD + +  K    W     +   K G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W
           (REAL)
          Length = 553

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 25  VISGDIFELINSKLPEKWDGNQRSPQNADTEE------YVEALYDFEAQQDGDLSLKTGD 78
           V+    FE+ +   P   +G   S +    E       Y   LYDF+A++  +L+   G+
Sbjct: 122 VVPKSYFEVFDRTRPSSVNGTSTSSRKVTNESLNMGSLYAIVLYDFKAEKADELTTFVGE 181

Query: 79  KIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
            + +    + +W+  K   ++   G+ P  +V
Sbjct: 182 NLFICAHHNCEWFIAKPIGRLGGPGLVPVGFV 213

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYRGK--------SNNKIGIFPANY 106
           EY +A+Y     +   L+    GD + + E ++ DWY+G+         ++++G+ P N+
Sbjct: 602 EYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYNF 661

Query: 107 VK 108
           ++
Sbjct: 662 IQ 663

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYV 107
           V ALYDF  + D +L LK GD I +  K    W   ++    + G+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 53  DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108
           DT   V+A + ++++ + DL+      I V      +WY G+  +K GIFP ++VK
Sbjct: 5   DTPFKVQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKP 109
           V+A YD+E  Q+ D  L+    D  +V +    DW   +  S N+ G  P NYV+P
Sbjct: 74  VKASYDYEQVQNPDEELTFHENDIFEVYDDKDQDWLLVKSLSTNEFGFVPGNYVEP 129

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYRG--------KSNNKIGIFPANY 106
           EY +A+Y     +   L+    GD I + E ++ DW++G        + ++++G+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 107 VK 108
           ++
Sbjct: 661 IQ 662

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKS--NNKIGIFPANYVKP 109
           + DFEA+ + +LS++ G  + ++ ++ S DW+  ++    K GI PA +++P
Sbjct: 383 ILDFEAEANDELSVRVGQVVYIIDDQKSRDWWMCEAVDTGKRGIIPAQFIEP 434

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query: 63  DFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFPANYVKP 109
           ++  + + ++ +K GDKI+VL    +    WY+GK+    ++G++PA + +P
Sbjct: 10  EYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 42/85 (49%), Gaps = 8/85 (9%)

Query: 31  FELINSKLPEKWDGNQRSPQNADTEE-----YVEALYDFEAQQDGDLSLKTGDKIQVLEK 85
           FE+I+   P   +G+  S +++  +      Y   LYDF+A++  +L+   G+ + +   
Sbjct: 121 FEVIDKTRPHSRNGSIVSRRSSHDQSKMGTLYAIVLYDFQAEKSDELTAYAGENLFICAH 180

Query: 86  ISPDWYRGKSNNKI---GIFPANYV 107
            + +W+  K   ++   G+ P  +V
Sbjct: 181 HNYEWFIAKPIGRLGGPGLVPVAFV 205

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK-----SNNKIGIFPANYV 107
           VEAL+ + +  + DL    G  I VLE    +W+ G+        K GIFP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 12/72 (16%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKS 95
           LP ++  NQR+           ALYDFE + D +L L  GD + +  +    W     + 
Sbjct: 105 LPNEYVINQRAI----------ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQP 154

Query: 96  NNKIGIFPANYV 107
             K G+ P  +V
Sbjct: 155 RTKTGLVPEEFV 166

>TBLA0H02790 Chr8 (653275..655026) [1752 bp, 583 aa] {ON} Anc_2.591
           YMR032W
          Length = 583

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYRGK--------SNNKIGIFPANY 106
           +Y +ALY        +L+    GD + +   I  DWY+G+        + +K G+ P+N+
Sbjct: 519 QYAKALYPLVDNPATELAHFHKGDYLLLTHIIDKDWYKGEVYANDMIDATHKYGLIPSNF 578

Query: 107 VK 108
           V+
Sbjct: 579 VR 580

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1394

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 18/70 (25%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRG----------------KSNNKI-- 99
           V  +++F       L L++G  I V+EK S  W+ G                 S  KI  
Sbjct: 12  VVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSGSFSPKSGSTQKIIR 71

Query: 100 GIFPANYVKP 109
           G FPANY KP
Sbjct: 72  GWFPANYTKP 81

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 49  PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNK--IGIFPANY 106
           P++    ++  ALYDFE + D +L LK  D + +  K    W   ++  +   G+ P  Y
Sbjct: 100 PKDYVVNQWAVALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEY 159

Query: 107 V 107
           V
Sbjct: 160 V 160

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 8/56 (14%)

Query: 62  YDFEA--QQDGDLSLKTGDKIQVLEKISPDWYRG-----KSNNKI-GIFPANYVKP 109
           ++F A  +++  LS++ GD + VL K    W+ G     KS+  + G FP NY KP
Sbjct: 26  FEFNAGNKKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKP 81

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 49  PQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANY 106
           PQ+    +   ALYDFE + D +L L  GD + +  +    W     +   K G+ P  +
Sbjct: 110 PQDYLINQLAVALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEF 169

Query: 107 V 107
           V
Sbjct: 170 V 170

>KAFR0A05500 Chr1 complement(1094398..1097571) [3174 bp, 1057 aa]
           {ON} Anc_3.433 YGR094W
          Length = 1057

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 14  RNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLS 73
           R+ LEF+   N+++ D   L+N    E+W G +R        E ++ +  F  Q+D +++
Sbjct: 404 RHNLEFI---NILTDD--GLLNENCGEEWQGMKRFDARKKVIEKLKEMGLFVGQEDNEMT 458

Query: 74  LKT----GDKIQVLEKISPDWYRGKSN 96
           + T    GD I+ L  + P W+  + +
Sbjct: 459 IPTCSRSGDIIEPL--LKPQWWVAQGD 483

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFPANYVK 108
           A+ ++  + + +L  K GDKIQV+   E+ +  WY GK+    + G++PA + +
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRTQQEGLYPAVFTQ 91

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 15/85 (17%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEA-----------LYDFEAQQDG--DLSLKTGDKIQVLE 84
           + E  +GN  +      E Y +A           LY ++A +D   ++S + G+ ++V  
Sbjct: 280 MTETSNGNTDTTMGGTLELYSDAGEESFPYTAQTLYRYQADEDDAYEISFEQGEILKV-S 338

Query: 85  KISPDWYRGK-SNNKIGIFPANYVK 108
            I   W++ K S  + GI P+NYVK
Sbjct: 339 DIEGRWWKAKRSTGETGIIPSNYVK 363

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFPANYV----KPAF 111
           + ++  + + +L +K GDKIQV+   E+ +  WY G++   N+ G++P  +     KP+ 
Sbjct: 39  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQEISKPSL 98

Query: 112 TR 113
            R
Sbjct: 99  VR 100

>Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W
           (REAL)
          Length = 558

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/92 (20%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 25  VISGDIFELINSKLPEKWDGNQRSPQNADTEE------YVEALYDFEAQQDGDLSLKTGD 78
           V+    FE+ +   P   +G   S +    +       Y   LYDF+A++  +L+   G+
Sbjct: 122 VVPKTYFEVFDRTKPSSVNGTNSSSRKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGE 181

Query: 79  KIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
            + +    + +W+  K   ++   G+ P  +V
Sbjct: 182 NLFICAHHNCEWFIAKPIGRLGGPGLVPVGFV 213

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 59  EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYRGK-SNNKIGIFPANYVK 108
            ALY +EA +    ++S + G+ ++V + I   W++ K SN + GI P+NYV+
Sbjct: 273 RALYAYEADESDAYEISFQQGEILRVGD-IEGRWWKAKRSNGETGIIPSNYVE 324

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQ-QDG-DLSLKTGDKIQVLEKISPDWYRGK-SNNKIGIFPANYVK 108
            +ALY ++A   DG ++S + G+ ++V   I   W++ K  N ++GI P+NYV+
Sbjct: 299 AKALYSYQADDADGYEISFEQGEILKV-SDIEGRWWKSKRENGQVGIIPSNYVQ 351

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 9/61 (14%)

Query: 57  YVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYRGK---SNN-----KIGIFPANYV 107
           Y +ALY F E  +   ++   GD + + E++  DW+ G+   S N     + GI P NY+
Sbjct: 537 YAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYRYGIIPRNYI 596

Query: 108 K 108
           +
Sbjct: 597 E 597

>ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON}
           similar to uniprot|Q05080 Saccharomyces cerevisiae
           YMR032W HOF1 Bud neck-localized SH3 domain-containing
           protein required for cytokinesis
          Length = 748

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 9/63 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYRGK--SNNKI------GIFPANY 106
           +Y +A+Y    +   +L+  + GD + +  +++ +WYRG+  SN+ +      G+ P N+
Sbjct: 684 KYAKAVYPLYEENVPELAQFQRGDYLLITGEVNDEWYRGEVYSNDYVSQGSSSGLIPHNF 743

Query: 107 VKP 109
           +KP
Sbjct: 744 IKP 746

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNN--KIGIFPANYVK 108
           A+Y F  + D +L LK GD + +  K    W   ++++  K G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.344
           YDR162C
          Length = 270

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYV 107
           ALYDFE + D +L LK  D + +  K    W     +   K G+ P  +V
Sbjct: 141 ALYDFEPENDNELELKEEDVVYISYKHGQGWLVAENEQRTKTGLVPEEFV 190

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 5/54 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLE---KISPDWYRGKS--NNKIGIFPANYVK 108
           A+ ++  + + +LS+K GDKI+V+    + +  WY G++    + G++PA + K
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>TPHA0I01930 Chr9 (435881..437581) [1701 bp, 566 aa] {ON} Anc_8.539
           YBR200W
          Length = 566

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 29  DIFELINSKLPEKWDGNQRSPQNADTEEY----VEALYDFEAQQDGDLSLKTGDKIQVLE 84
           DIF    S    +   +++S  +AD + +      A YDF A  + +LS++ G    +  
Sbjct: 125 DIFSTAKSICSSR---DRKSQHSADMDTFGSLNAIASYDFVADNEEELSVEVGQTFVIWA 181

Query: 85  KISPDWYRG---KSNNKIGIFPANYV 107
               +W+     ++ NKIG+ P +Y+
Sbjct: 182 HHDFEWFVAMPTENTNKIGLVPTSYL 207

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFP 103
           A+  +  + + ++S+K GDKIQV+   E  +  WY G++    K G+FP
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFP 81

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 12/72 (16%)

Query: 38  LPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKS 95
           LP  +  NQR+           ALYDF  + D +L L+ GD + +  K    W     + 
Sbjct: 95  LPTNYIVNQRAV----------ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQG 144

Query: 96  NNKIGIFPANYV 107
             K G+ P  +V
Sbjct: 145 RTKTGLVPEEFV 156

>ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa]
           {ON} some similarities with uniprot|P39969 Saccharomyces
           cerevisiae YER114C BOI2 Protein implicated in polar
           growth functionally redundant with Boi1p interacts with
           bud- emergence protein Bem1p contains an SH3 (src
           homology 3) domain and a PH (pleckstrin homology) domain
          Length = 1089

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 12/58 (20%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFPANYVK 108
           EY + + D       +L +K GDKIQV+   E+ +  WY G++   N+ G+FP  + +
Sbjct: 45  EYTKRMQD-------ELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLFPVIFTQ 95

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYV 107
           ALYDF  + D +L L+ GD + +  +    W   ++    + G+ P  YV
Sbjct: 73  ALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERTRTGLVPEEYV 122

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFPANYVK 108
            + ++  + + +L +K GDKIQV+   E+ +  WY G++   N+ G++P  + +
Sbjct: 41  TITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQ 94

>KAFR0A05600 Chr1 complement(1119055..1125807) [6753 bp, 2250 aa]
           {ON} Anc_4.310 YLR430W
          Length = 2250

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 14  RNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLS 73
            N L+ + + N  +  + ++ N+K+PE   G+  S Q   T+     L  +        S
Sbjct: 360 HNILDLIFDKNAFTTKLIKIQNNKIPENTIGSYFSLQGTVTDLLSWTLPFYH-------S 412

Query: 74  LKTGDKIQVLEKISPDWYRGKSNN 97
           L    +IQ+++K+S  + RG +NN
Sbjct: 413 LSVSKRIQMVKKVSMAFLRGIANN 436

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 53  DTEEYV-EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYRGK-SNNKIGIFPANYVK 108
           D   YV +ALY ++A +    ++S + G+ ++V   I   W++ K  N + GI P+NYV+
Sbjct: 266 DNFAYVAKALYSYQADESDQYEISFEQGEILRV-SDIEGRWWKAKRENGETGIIPSNYVQ 324

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYRGK-SNNKIGIFPANYVK 108
            +ALY +EA      ++S + G+ ++V + I   W++ K +N + GI P+NYV+
Sbjct: 270 AKALYAYEADASDAYEISFQQGEILRVGD-IEGRWWKAKKANGETGIIPSNYVE 322

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKI---GIFPANYV 107
           Y   LYDF+A++  +L++  G+ + +    + +W+  K   ++   G+ P ++V
Sbjct: 156 YAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 209

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 58  VEALYDFEAQQDGD---LSLKTGDKIQVLEKISPDWYRGK-SNNKIGIFPANYVK 108
           V+ALY ++A  D D   +S   G+ ++V   I   W++ K  N + GI P+NYV+
Sbjct: 311 VKALYSYQAD-DADAYEISFDQGEILKV-SDIEGRWWKAKRENGQTGIIPSNYVE 363

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYRGKS--NNKIGIFPANYVK 108
           A+ ++  + + +L  + GDKIQVL   E+ +  WY G++    + G++PA + +
Sbjct: 80  AINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGRNLRTQEEGLYPAVFTQ 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,098,893
Number of extensions: 558790
Number of successful extensions: 2072
Number of sequences better than 10.0: 308
Number of HSP's gapped: 1988
Number of HSP's successfully gapped: 343
Length of query: 241
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 135
Effective length of database: 41,326,803
Effective search space: 5579118405
Effective search space used: 5579118405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)